Está en la página 1de 381

35 (13,4) DICIEMBRE 2010

LA PROFESIN DOCENTE: ESCENARIOS, PERFILES Y TENDENCIAS


COORDINADOR: PABLO PALOMERO FERNNDEZ

ISSN 1575-0965

Asociacin Universitaria de Formacin del Profesorado (AUFOP)

Revista Electrnica Interuniversitaria de Formacin del Profesorado (REIFOP)


continuacin de la antigua Revista de Escuelas Normales

Nmero 35 (13, 4)
La profesin docente: escenarios, perfiles y tendencias

Zaragoza (Espaa), Diciembre 2010

La Revista Electrnica Interuniversitaria de Formacin del Profesorado. Edicin Digital de la antigua Revista de Escuelas Normales (REIFOP), es un rgano de expresin de la Asociacin Universitaria de Formacin del Profesorado (AUFOP), entidad cientfico-profesional de carcter no lucrativo. Se edita en colaboracin con la Universidad de Zaragoza.

Sede Social, redaccin, administracin y correspondencia Universidad de Zaragoza Facultad de Educacin San Juan Bosco, 7 50071 Zaragoza Espaa Editor Jos Emilio Palomero Pescador Universidad de Zaragoza. Facultad de Educacin (emipal@unizar.es) Pginas web http://www.aufop.com/ Administrador del sitio web: Jos Emilio Palomero Pescador Diseo de portadas y diseo web Jos Palomero Fernndez * depalo@thewelltime.com * http://www.thewelltime.com/ -ISSN: 1575-0965 -DEPSITO LEGAL: VA-369-99 -CDIGOS UNESCO: Preparacin y empleo de profesores 5803

Asociacin Universitaria de Formacin del Profesorado (AUFOP). Reservados todos los derechos. Queda prohibida la reproduccin parcial o total sin la autorizacin por escrito de la AUFOP. La Revista no se identifica necesariamente con los contenidos de los artculos publicados, que son responsabilidad exclusiva de los autores. Slo el Editorial representa la opinin de la Revista. Tampoco se responsabiliza de las erratas contenidas en los documentos originales remitidos por los/as autores.

JUNTA DIRECTIVA
Presidente ANTONIO GARCA CORREA (Universidad de Murcia. Facultad de Educacin). Vicepresidenta HENAR RODRGUEZ NAVARRO (Universidad de Valladolid. Facultad de Educacin y Trabajo Social). Secretario JOS EMILIO PALOMERO PESCADOR (Universidad de Zaragoza. Facultad de Educacin). Administradora MARA ROSARIO FERNNDEZ DOMNGUEZ (Universidad de Zaragoza. Facultad de Educacin). Vocales FERNANDO ALBUERNE LPEZ (Universidad de Oviedo. Facultad de Psicologa). JUAN BENITO MARTNEZ (Universidad de Murcia. Escuela Universitaria de Trabajo Social) JUAN JOS CCERES ARRANZ (Universidad de Valladolid. Escuela Universitaria de Educacin de Soria) EMILIO GARCA GARCA (Universidad Complutense de Madrid. Facultad de Filosofa). EDUARDO FERNNDEZ RODRGUEZ (Universidad de Valladolid. Facultad de Educacin y Trabajo Social) CARLOS LATAS PREZ (Universidad de Extremadura. Facultad de Formacin del Profesorado y Educacin Social de Cceres). JAVIER J. MAQUILN SNCHEZ (Universidad de Murcia. Facultad de Educacin) MARTN RODRGUEZ ROJO (Universidad de Valladolid. Facultad de Educacin). LUIS FERNANDO VALERO IGLESIAS (Universitat Rovira i Virgili de Tarragona. Facultat de Cincies de lEducaci i Psicologia).

CONSEJO DE REDACCIN
Presidente Editor
MARTN RODRGUEZ ROJO (UNIVERSIDAD DE VALLADOLID) JOS EMILIO PALOMERO PESCADOR (UNIVERSIDAD DE ZARAGOZA) JAVIER J. MAQUILN SNCHEZ (UNIVERSIDAD DE MURCIA) MARA ROSARIO FERNNDEZ DOMNGUEZ (UNIVERSIDAD DE ZARAGOZA)

Secretario del Consejo de Redaccin Administracin

Correspondencia con autores Relaciones institucionales

EDUARDO FERNNDEZ RODRGUEZ (UNIVERSIDAD DE VALLADOLID) MARA PILAR TERUEL MELERO (UNIVERSIDAD DE ZARAGOZA) ANTONIO GARCA CORREA (UNIVERSIDAD DE MURCIA) MARA PAZ GARCA SANZ (UNIVERSIDAD DE MURCIA) SANDRA RACIONERO PLAZA (UNIVERSITAT DE BARCELONA) JESS ALBERTO ECHEVERRY SNCHEZ (UNIVERSIDAD DE ANTIOQUA, COLOMBIA) GABRIEL GALARZA LPEZ (UNIVERSIDAD DE BOLVAR, ECUADOR) RENATO GRIMALDI (UNIVERSIT DEGLI STUDI, TORINO, ITALIA) JUAN MILA DEMARCHI (UNIVERSIDAD DE LA REPBLICA, MONTEVIDEO, URUGUAY) ERICA ROSENFELD HALVERSON (UNIVERSITY OF WISCONSIN-MADISON, EE.UU.

Relaciones internacionales

Soporte informtico

PABLO PALOMERO FERNNDEZ (UNIVERSIDAD DE ZARAGOZA) LVARO RETORTILLO OSUNA (UNIVERSIDAD DE VALLADOLID) CARLOS SALAVERA BORDS (UNIVERSIDAD DE ZARAGOZA) HENAR RODRGUEZ NAVARRO (UNIVERSIDAD DE VALLADOLID)

Base de datos y certificaciones

Vocales

FERNANDO ALBUERNE LPEZ (UNIVERSIDAD DE OVIEDO) MARA PILAR ALMAJANO DE PABLOS (UNIVERSITAT POLITCNICA DE CATALUA) JUAN BENITO MARTNEZ (UNIVERSIDAD DE MURCIA) JULIA BORONAT MUNDINA (UNIVERSIDAD DE VALLADOLID) ADELICIO CABALLERO CABALLERO (UNIVERSIDAD COMPLUTENSE DE MADRID) JUAN JOS CCERES ARRANZ (UNIVERSIDAD DE VALLADOLID) NIEVES CASTAO POMBO (UNIVERSIDAD DE VALLADOLID) EMILIO GARCA GARCA (UNIVERSIDAD COMPLUTENSE DE MADRID) TERESA GARCA GMEZ (UNIVERSIDAD DE ALMERA) ALFONSO GARCA MONJE (UNIVERSIDAD DE VALLADOLID) ANTONIO GMEZ ORTIZ (UNIVERSIDAD DE BARCELONA) MARA NIEVES LEDESMA MARN (UNIVERSIDAD DE VALENCIA) MARIO MARTN BRIS (UNIVERSIDAD DE ALCAL DE HENARES) JUAN BAUTISTA MARTNEZ RODRGUEZ (UNIVERSIDAD DE GRANADA) SANTIAGO MOLINA MOLINA (UNIVERSIDAD DE ZARAGOZA) JESS MUOZ PEINADO (UNIVERSIDAD DE BURGOS) ANA PONCE DE LEN ELIZONDO (UNIVERSIDAD DE LA RIOJA) LUIS FERNANDO VALERO IGLESIAS (UNIVERSITAT ROVIRA I VIRGILI DE TARRAGONA)

CONSEJO ASESOR
JUAN AZCOAGA (UNIVERSIDAD DE BUENOS AIRES, ARGENTINA) CESAR COLL (UNIVERSITAT DE BARCELONA, ESPAA) MARIO DE MIGUEL (UNIVERSIDAD DE OVIEDO, ESPAA) JOHN ELLIOT (UNIVERSITY OF EAST ANGLIA, NORWICH, REINO UNIDO) ENRIQUE GASTN (UNIVERSIDAD DE ZARAGOZA, ESPAA) JOS GIMENO SACRISTN (UNIVERSIDAD DE VALENCIA, ESPAA) JOS RAMN FLECHA GARCA (UNIVERSITAT DE BARCELONA, ESPAA) NITA FREIRE (THE PAULO AND NITA FREIRE PROJECT FOR CRITICAL PEDAGOGY) HENRY GIROUX (MCMASTER UNIVERSITY, CANAD) GORDON KIRK (UNIVERSITY OF EDINBURGH, REINO UNIDO) DANIEL LPEZ STEFONI (UNIVERSIDAD DE LOS LAGOS, CHILE) PETER MC LAREN (UNIVERSITY OF CALIFORNIA, LOS NGELES, ESTADOS UNIDOS) JESS PALACIOS (UNIVERSIDAD DE SEVILLA, ESPAA) NGEL PREZ GMEZ (UNIVERSIDAD DE MLAGA, ESPAA) STEPHEM KEMMIS (DEAKIN UNIVERSITY, AUSTRALIA) ROBERT STAKE (UNIVERSITY OF ILLINOIS, CHICAGO, ESTADOS UNIDOS)

CONSEJO ACADMICO
PILAR ABS OLIVARES (Universidad de Zaragoza. Facultad de Ciencias Sociales y Humanas de Teruel). VICENTA ALTABA RUBIO (Universitat Jaume I de Castelln. Facultat de Cincies Humanes i Socials). GERMN ANDRS MARCOS (Universidad de Valladolid. Escuela Universitaria de Educacin de Soria). ASUNCIN BARRERAS GMEZ (Universidad de la Rioja. Facultad de Letras y de la Educacin). ANA ROSA BARRY GMEZ (Universidad de Las Palmas de Gran Canaria. Facultad de Formacin del Profesorado). JOAN BISCARRI GASSIO (Universitat de Lleida. Facultat de Cincies de lEducaci). FLORENTINO BLZQUEZ ENTONADO (Universidad de Extremadura. Instituto de Ciencias de la Educacin. Badajoz). HERMINIO DOMINGO PALOMARES (Universitat de les Illes Balears. Facultat dEducaci). CARMEN FERNNDEZ BENNOSAR (Universitat de les Illes Balears. Facultat dEducaci). MARA ROSARIO FERNNDEZ DOMNGUEZ (Universidad de Zaragoza. Facultad de Educacin). JOS FERNNDEZ GARCA (Universidad de Jan. Facultad de Humanidades y Ciencias de la Educacin). MARA DEL PILAR FERNNDEZ VIADER (Universitat de Barcelona. Facultat de Formaci del Professorat). MARA SAGRARIO FLORES CORTINA (Universidad de Len. Facultad de Educacin). ROSARIO GARCA GMEZ (Universidad de Universidad de la Rioja. Facultad de Letras y de la Educacin). AMANDO LPEZ VALERO (Universidad de Murcia. Facultad de Educacin). GONZALO MARRERO RODRGUEZ (Universidad de Las Palmas de Gran Canaria. Facultad de Formacin del Profesorado).

JUAN MONTAS RODRGUEZ (Universidad de Castilla-La Mancha. Escuela Universitaria de Magisterio de Albacete). MARTN MUELAS HERRIZ (Universidad de Castilla La Mancha. Escuela Universitaria de Magisterio de Cuenca). CONCEPCIN NAVAL DURN (Universidad de Navarra. Facultad de Filosofa y Letras). JESS NIETO (Universidad de Valladolid. Escuela Universitaria de Educacin de Segovia). ANTONIO ONTORIA PEA (Universidad de Crdoba. Facultad de Ciencias de la Educacin). JOS ANTONIO ORAMAS LUIS (Universidad de la Laguna. Facultad de Educacin). MARA DEL MAR POZO ANDRS (Universidad de Alcal de Henares. Escuela Universitaria de Magisterio de Guadalajara). ROSARIO QUECEDO (Euskal Herriko Unibertsitatea. Escuela Universitaria de Magisterio de Bilbao). TOMS RODRGUEZ (Universidad de Cantabria. Facultad de Educacin de Cantabria). SCAR SENZ BARRIO (Universidad de Granada. Facultad de Ciencias de la Educacin). SEBASTIN SNCHEZ FERNNDEZ (Universidad de Granada. Facultad de Educacin y Humanidades de Melilla). FRANCISCO JOS SILVOSA COSTA (UniversidadedeSantiagodeCompostela.EscolaUniversitariadeFormacindoProfesoradodeLugo). CARME TOLOSANA LIDN (Universitat Autnoma de Barcelona. Facultat de Cincies de lEducaci). MARA DEL CARMEN URONS JAMBRIMA (Universidad de Salamanca. Facultad de Educacin). MANUEL VZQUEZ (Universidad de Sevilla. Facultad de Ciencias de la Educacin). LUIS J. VENTURA DE PINHO (Universidade de Aveiro. Departamento de Cincias da Educao). MIGUEL NGEL VILLANUEVA VALDS (Universidad Complutense de Madrid. Facultad de Educacin). NAZARIO YUSTE (Universidad de Almera. Facultad de Humanidades y Ciencias de la Educacin).

COMIT DE APOYO INSTITUCIONAL


(Universitat dAlacant. Facultat dEducaci). JAVIER CERMEO APARICIO (Universidad Complutense de Madrid. Facultad de Educacin). MARA EVA CID CASTRO (Universidad de Zaragoza. Facultad de Educacin). CONCEPCIN MARTN SNCHEZ (Universidad de Murcia. Facultad de Educacin). MARIANO RUBIA AVI (Universidad de Valladolid. Escuela Universitaria de Educacin de Soria). SEBASTIN SNCHEZ FERNNDEZ (Universidad de Granada. Facultad de Educacin y Humanidades de Melilla). MARA ANTONIA CANO IBORRA

INSTITUCIONES COLABORADORAS
- Departamento de Didctica y Organizacin Escolar (Universidad de Valladolid). - Departamento de Educacin (Universidad de Alcal de Henares). - Departamento de Psicologa y Sociologa (Universidad de Zaragoza). - Departamento de Teora e Historia de la Educacin (Universidad de Mlaga). - Escuela Universitaria de Educacin de Soria (Universidad de Valladolid). - Escuela Universitaria de Formacin del Profesorado de Guadalajara (Universidad de Alcal de Henares). - Facultat dEducaci (Universitat dAlacant). - Facultad de Letras y de la Educacin (Universidad de la Rioja). - Facultad de Educacin (Universidad de Cantabria). - Facultad de Educacin y Humanidades de Melilla (Universidad de Granada). - Facultad de Educacin (Universidad de Zaragoza). - Facultad de Ciencias de la Educacin de la Universidad de Crdoba. - Facultad de Ciencias de la Educacin de la Universidad de Granada. - Facultat de Cincies Humanes i Socials de la Universitat Jaume I de Castelln. - Facultad de Educacin de la Universidad de Len. - Facultad de Educacin de la Universidad de Murcia. - Facultad de Educacin de la Universidad de Valladolid. - Facultad de Humanidades y Educacin de la Universidad de Burgos. - Vicerrectorado de Investigacin de la Universidad de Zaragoza.

NDICE DE IMPACTO, CATLOGOS, DIRECTORIOS Y BASES DE DATOS EN LOS QUE APARECE RESEADA LA REIFOP

CONSULTAR http://www.aufop.com/aufop/paginas/view/1/home

Revista Electrnica Interuniversitaria de Formacin del Profesorado


continuacin de la antigua Revista de Escuelas Normales

Nmero 35 (13, 4)
ISSN 1575-0965

NDICE
Editorial...................................................................................................................... 13 Tema monogrfico

Laprofesindocente:escenarios,perfilesytendencias
CoordinadoporPabloPalomeroFernndez

Presentacin: La profesin docente: escenarios, perfiles y tendencias PabloPalomeroFernndez(Coordinador).... 21

Profesin docente y calidad de la educacin Competencias ticas del profesor y calidad de la educacin EmilioGarcaGarca................................................................................................................ 29 Vocacin docente versus profesin docente en las organizaciones educativas FaustinoLarrosaMartnez...................................................................................................... 43 Propuestas de solucin para los problemas educativos de hoy PresentacinA.CaballeroGarca............................................................................................ 53 Inclusin, convivencia y cultura de paz en las aulas El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica AndreaFranciscoAmatyMLidnMolinerMiravet................................................................ 69 Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco FlixEtxeberra,IakiKarreraeHilarioMurua....................................................................... 79

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes AmeliaBarqun,NereaAlzola,MonikaMadinabeitiayAneUrizar... 95 Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa) AzucenaOchoaCervantesySalvadorPeiriGregori........................................................... 113 Metacognicin y competencia de aprender a aprender en Educacin Infantil: una propuesta para facilitar la inclusin MaraConsueloSiz,ValleFloresyJosMaraRomn........................................................ 123 Mujeres y educacin: Escenarios de ayer y de hoy Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas TeresaGonzlezPrez........................................................................................................... 133 Primeros pasos de la Escuela Normal Femenina de Santander, 1915 CarmenRubalcabaPrez....................................................................................................... 145 Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada MRosaLuengoGonzlezyPrudenciaGutirrezEsteban................................................... 155 Realidad, pensamiento y formacin del profesorado Definicin y contextualizacin del perfil profesional del maestro en HUHEZI NereaAlzola,NekaneArratibel,ArantxaMongelos,BegoaPedrosa, KarmelePrezyLeireUriarte. 169 Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas CarolaAstudillo,AlciraRivarosayFlixOrtiz....................................................................... 181 Implicacin del alumnado en el proceso de aprender a pensar JuanManuelMuozGonzlezyAntonioOntoriaPea........................................................ 191 Una mirada sobre el proceso de formacin del profesor como investigador en la Universidad Pblica Federal brasilea CarlaCristinaDutraBrigoyClesarLuizLoch....................................................................... 201 El influjo educativo de los profesores en el abandono de la prctica fsico-deportiva de los adolescentes AnaPoncedeLen,MngelesValdemoros,yEvaSanz.............................................. 211 Trabajando la prevencin: habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela CarlosSalavera..................................................................................................................... 221

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas PedroAllueva,MLuisaHerreroyJuanAgustnFranco........................................................ 227 Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza AlfonsoHerediaManrique.................................................................................................... 241 Aproximaciones didcticas El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin JavierArleguiyJuliaIbarra.................................................................................................. 255 Anlisis del andamiaje en un proceso de lectura conjunta JavierGonzlezGarca.......................................................................................................... 265 Manuales de Historia de la Literatura o qu literatura se ensea RebecaSoleryPabloLorenteMuoz.................................................................................... 283 Tendencias y desafos en estimulacin multisensorial y en psicomotricidad Psicomotricidad: qu formacin dicen poseer los profesores de Educacin Infantil y Educacin Especial de la provincia de Huelva? DeliaMartnDomnguezySaraRodrguezSnchez.............................................................. 295 Psicomotricidad y Arteterapia GabrielaAraujoCaixetayGisellaN.GabelnMadueo...................................................... 307 La integracin sensorial en el aula multisensorial y de relajacin: estudio de dos casos AlfonsoLzaroLzaro,SilviaBlascoCasorrnyAnaLagranjaFabra................................... 321 El cuaderno de bitcora y la formacin de los psicomotricistas. Sobre cmo fomentar el encuentro entre la cultura acadmica y la cultura experiencial JosEmilioPalomeroPescador,PabloPalomeroFernndezy MaraRosarioFernndezDomnguez................................................................................... 335 Tesis Doctorales...................................................................................... 347 Recensiones Bibliogrficas....................................................................... Autores.................................................................................................... 355 369

Revista Electrnica Interuniversitaria de Formacin del Profesorado


continuacin de la antigua Revista de Escuelas Normales

Number 35 (13, 4)
ISSN 1575-0965

INDEX
Editorial..................................................................................................................... 13 Monographic theme

Theteachingprofession:scenarios,profilesandtendencies
CoordinatedbyPabloPalomeroFernndez

Introduction: The teaching profession: scenarios, profiles and tendencies PabloPalomeroFernndez(Coordinador).... 21

The teaching profession and education quality The teachers ethical competences and quality education EmilioGarcaGarca................................................................................................................. 29 Teaching vocation versus teaching profession in educational organisations FaustinoLarrosaMartnez....................................................................................................... 43 Innovative solutions to current educational problems PresentacinA.CaballeroGarca............................................................................................ 53 Inclusion, coexistence and a culture of peace in the classroom Service learning at University: a strategy in training critical citizens AndreaFranciscoAmatandMLidnMolinerMiravet........................................................... 69 Intercultural competences of teachers with immigrant students in the Basque Country FlixEtxeberra,IakiKarreraandHilarioMurua................................................................... 79 Undergraduate Teacher Education students thoughts on immigration and immigrants AmeliaBarqun,NereaAlzola,MonikaMadinabeitiaandAneUrizar.. 95

A comparative study of teachers performance in situations which alter school coexistence: The cases of Queretaro (Mexico) and Alicante (Spain) AzucenaOchoaCervantesandSalvadorPeiriGregori........................................................ 113 Metacognition and the learning to learn competence in Infant Education: A proposal promoting inclusion MaraConsueloSiz,ValleFloresandJosMaraRomn..................................................... 123 Women and education: Past and present scenarios Learning to teach in the nineteenth century. Initial training of Spanish female school teachers TeresaGonzlezPrez............................................................................................................ 133 First Steps of the Escuela Normal Femenina (Female School of Education) in Santander, 1915 CarmenRubalcabaPrez........................................................................................................ 145 Tangled in time. Women, time and education: A conditioned relationship MRosaLuengoGonzlezandPrudenciaGutirrezEsteban................................................ 155 Reality, thoughts and teacher training Defining and contextualising the professional profile of the school teacher at the HUHEZI Faculty of the Modragon Unibertsitatea (Spain) NereaAlzola,NekaneArratibel,ArantxaMongelos,BegoaPedrosa, KarmelePrezandLeireUriarte..............................................................................................169 Analysing a training design for science teachers: methodological considerations CarolaAstudillo,AlciraRivarosaandFlixOrtiz.................................................................... 181 Learners involvement in the learning to think process JuanManuelMuozGonzlezandAntonioOntoriaPea.................................................... 191 A look at the process of teachers training as researchers at the Brazilian federal public university CarlaCristinaDutraBrigoandClesarLuizLoch.................................................................. 201 Teachers educational effect on the abandonment of phyisicalsport practice by the youth AnaPoncedeLen,MngelesValdemorosandEvaSanz........... 211 Working on prevention: Communication abilities in schizophrenics. Knowing the disease to work from the school CarlosSalavera...................................................................................................................... 221

University students and lecturers thinking styles. Educational implications PedroAlluevaTorres,MLuisaHerreroandJuanAgustnFranco........................................ 227 An analysis of academic achievement among Teacher Education students at the Faculty of Education of the Universidad de Zaragoza (Spain) AlfonsoHerediaManrique..................................................................................................... 241 Didactic approaches The role of the numerical values of experimental mesaurements in Inquiry-Based Learning JavierArleguiyJuliaIbarra................................................................................................... 255 An Analysis of scaffolding in a joint reading process JavierGonzlezGarca......................................................................................................... 265 History of Literature handbooks or what literature is taught RebecaSolerandPabloLorenteMuoz................................................................................ 283 Tendencies and challenges in multisensory stimulation and in Psychomotricity Psychomotricity: Which training do Infant Education and Special Education teachers say they have in the Huelva region in Spain? DeliaMartnDomnguezandSaraRodrguezSnchez.......................................................... 295 Psychomotricity and Art Therapy GabrielaAraujoandGisellaN.Gabeln........................................................ 307 Sensory integration in the Multisensory and Relaxation Room: Two case studies AlfonsoLzaroLzaro,SilviaBlascoCasorrnandAnaLagranjaFabra............................. 321 The logbook and training psychomotricists: How to promote the link between the academic culture and the experiential culture JosEmilioPalomeroPescador,PabloPalomeroFernndez andMaraRosarioFernndezDomnguez............................................................................. 335 Tesis Doctorales......................................................................................... 347 Recensiones Bibliogrficas......................................................................... 355 Autores..................................................................................................... 369

EDITORIAL

RIFOP y ERIFOP: La larga trayectoria de una revista con una fuerte proyeccin internacional (19852010)
orraelda21deabrilde1985cuandoenlaasambleafinaldelIISeminarioEstatalde Escuelas Universitarias de Magisterio (Valladolid), se acordaba crear la Revista Interuniversitaria de Formacin del Profesorado (RIFOP), continuacin de la antigua Revista de Escuelas Normales, fundada y dirigida por Modesto Bargall (Guadalajara, 1923 1927), Rodolfo Llopis (Cuenca, 19271929), Antonio Gil Muiz (Crdoba, 19291931), ModestoBargall(Guadalajara,19311932)yPabloCorts(Madrid,19321936).

El citado acuerdo daba sus primeros frutos dos aos ms tarde, el 6 de abril de 1987, momento en que se present en Teruel, en el contexto del III Seminario Estatal de Escuelas Universitarias de Magisterio, el nmero cero de la RIFOP, del que se publicaron 2.000 ejemplaresyquefuefinanciadoensutotalidadporlasuniversidadesdeValladolidyZaragoza. Desde aquella fecha fundacional (21 de abril de 1985) hasta el momento actual (30 de noviembrede2010)hantranscurridomsdeveinticincoaos(uncuartodesiglo)depresencia ininterrumpidadelaRevistaInteruniversitariadeFormacindelProfesoradoenlahistoriade laeducacin.

Enelciberespacio Lahistoriadenuestrarevistaesyalarga.Trasunadcadapublicndoseexclusivamente ensoportepapel,amediadosdelosaosnoventadelsigloXXlaAsociacinUniversitariade Formacin del Profesorado (AUFOP), entidad editora de la misma, acometi, con plena conciencia de la fuerza e impacto de las nuevas tecnologas de la informacin y de la comunicacin,unnuevoproyecto,quecomenzadarsusprimerosfrutosen1997,yquevino aincrementardeformanotablesuvisibilidadanivelnacionaleinternacional.Elproyectono era otro que abrir una pgina web propia (www.aufop.uva.es/aufop) en la que indizar la revistaimpresaycrear,simultneamente,unasegundarevistadecarcterdigitalpresenteen lneaenabiertoyatextocompleto:LaRevistaelectrnicaInteruniversitariadeFormacindel Profesorado (REIFOP), un servicio gratuito que presta la AUFOP desde hace ya ms de trece aosatodalacomunidadacadmica. Inicibamos esta segunda etapa all en agosto de 1997, fecha en la que se edit el nmero cero de esta nueva publicacin (la pgina web se puso en lnea el da 1 de junio de 1997), en el que quedaron recogidas las comunicaciones presentadas al VIII Congreso de Formacin del Profesorado. Hacia un proyecto profesional de formacin del profesorado,

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1317

13

congreso que organizado por la AUFOP y por la Escuela Universitaria de Educacin de vila (UniversidaddeSalamanca),sehabacelebradoenlaciudaddevilalosdas5,6y7dejunio de1996. Tal como sealamos entonces, fue aquel congreso un excelente marco para seguir reflexionando sobre la educacin, sobre la funcin docente y sobre el perfil profesional de profesores,orientadores,educadoresymaestros.UndebatequequieneshacemoslaRIFOPy la REIFOP hemos mantenido abierto de forma ininterrumpida y permanente desde los momentosfundacionalesdenuestrarevista. No en vano, en los ms de veinticinco aos transcurridos desde aquel 21 de abril de 1985hastalafecha,hemospublicadountotalde105nmeros(70enlarevistaimpresay35 msenladigital),enlosquehanparticipadocercadedosmilautoresdetodoelmundo:tan sloen2010haycontribucionesdeacadmicospertenecientesaunas60universidadesde17 pases diferentes; y a la vez hemos promovido y organizado, en colaboracin con diferentes universidades(comolasdeValladolid,Extremadura,CastillaLaMancha,Zaragoza,Cantabria, Murcia, Mlaga y Salamanca) numerosos congresos relacionados con la funcin docente y con la formacin inicial y permanente del profesorado de todos los niveles del sistema educativo. Los dos ltimos bien recientes: I Congreso Internacional Profe 10. Reinventar la profesin docente. Nuevas exigencias y escenarios en la era de la informacin y la incertidumbre(Mlaga,8,9y10denoviembrede2010),yICongresoInternacionalvirtualde FormacindelProfesorado.LaformacindelprofesoradoenelsigloXXI:Propuestasantelos cambios econmicos, sociales y culturales (Murcia, 9, 10 y 11 de diciembre de 2010), este ltimoanpendientedecelebracin. Volviendo a los primeros pasos (1997) de la Revista electrnica Interuniversitaria de FormacindelProfesorado,enelnmero113delarevistaPCActual(noviembrede1999:7) sedestacabaquelaexcitacinquehaprovocadoInternetentrelosespaolesesaltsima.El problema radica en la complejidad y mala calidad, en general, de los accesos a la Red, que desmoralizahastaalosusuariosexpertos.Espaatenaporaquellasfechasunostresmillones de internautas, frente a los veintisiete millones que tiene en la actualidad segn el informe PaneldeHogaresdelObservatorioNacionaldelasTelecomunicacionesydelaSociedaddela Informacin(ONTSI),correspondientealprimertrimestrede2010. Estemismo nmerodePCActualvenaacompaadodeunCDtemticodedicadoala Universidad, en el que se incluan las mejores pginas web de las universidades espaolas, entrelasquefigurabaladelaAsociacinUniversitariadeFormacindelProfesorado,entonces alojadaenlawebsitedelaUniversidaddeValladolid.Fueestapginawebunadelasprimeras quepusoenlnea(conartculosatextocompletoyenabierto)unarevistacientficaespaola; y, en todo caso, fue aquella website la que permiti que la AUFOP hiciese el primer lanzamiento al ciberespacio de la Revista Interuniversitaria de Formacin del Profesorado en susdosversiones,impresaydigital. Efectivamente,fueenladcadadelosaos90delsigloXXcuandocomenz,graciasala progresiva maduracin y popularizacin de Internet, la emigracin del papel al ciberespacio, ungirorevolucionario,comparablealaaparicindelaimprenta,quelaAUFOPsupodetectar tempranamente. Si a principios del ao 1995 apenas haba un puado de revistas cientficas que ofreciesen algn contenido en Internet, en 1997 continuaban siendo muy pocas las que mostrabanenlneaartculosatextocompleto.La REIFOP,que publicsuprimernmeroen agosto de 1997, fue una de las primeras en hacerse presente en la red. El navegante an puede visitar de forma ntegra la versin original de aquella website en Internet Archive: WaybackMachine,unaespeciedemquinadelpasadodedicadaapreservarsitiosdeInternet que permite al cibernauta ponerse en contacto con todas las eras de la web. Incluso en tiempos ms recientes, una buena parte de las revistas cientficas siguen sin suficiente

14 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1317

visibilidadenlared:SegnelUlrichsperiodicalsdirectory,elrepertorioderevistascientficas ms prestigioso del mundo, en 2006 tan slo eran accesibles a travs de Internet 19.488 revistasacadmicas,el38,5%delas50.581queentalfechaestabanactivas,segnUlrichs,a escalamundial. Traseldiseodeunasegundawebsite(www.aufop.org),activadaenda3dejuniode 2002,conmotivodelacelebracindelXCongresodeFormacindelProfesorado:Laformacin delprofesoradoanteelfenmenodelaviolenciayconvivenciaescolar(celebradoenCuenca losdas3al6dejuniode2002),laAUFOPysusrevistasmejoraronnotablementesupresencia enlared,consiguiendountotalde1.424.940pginasvistasdeentrelasalojadasenlacitada website,sibiennodisponemosdedatosrelativosalnmerodevisitantesqueaccedieronalas mismas. Sin embargo, a partir de 2005 la website de la AUFOP entr en un largo perodo de decadencia e inactividad, al no disponer de personal que estuviese dispuesto a mantenerla, periodo que se prolong hasta enero de 2008, momento en que la AUFOP puso en lnea la websiteactual(www.aufop.com)que,entanslotresaosdeactividadhaconseguidounalto niveldevisibilidadinternacional. Actualmente,enaufop.comtenemosalojados,enabiertoyatextocompleto,casitodos losartculospublicadosenambasrevistas(papelyelectrnica),aexcepcindelosnmerosde larevistaimpresacorrespondientesalosaos2009y2010,queestnenperododeembargo. De estos ltimos, nicamente son visibles en lnea los ndices, los resmenes y tambin algunosdesusartculos.

ndicedeimpacto Porotraparte,cabedestacarqueelndicedeimpactodelsitioactualdelaAUFOPha idosubiendodeformaespectacularalolargodelostresaosquellevaenlnea,comoqueda patenteenlosdatosqueseaportanacontinuacin.Tansloenloquevadelao2010,los cibernautashanvisitadocasielmismonmerodepginasdeaufop.com(1.416.641)quelas que visitaron en la anterior website de la AUFOP (aufop.org) a lo largo de toda su historia (1.424.940). En este sentido, aufop.com recibe hoy visitas de navegantes de todo el mundo. Tomandocomoreferencialosdatosestadsticoscorrespondientesalosmesesdeseptiembre, octubre y noviembre de 2010, los cibernautas ms activos en aufop.com pertenecen a los siguientes pases: Espaa (127.278 pginas visitadas), Mxico (73.949), Colombia (28.299), Argentina(26.213),Per(24.125),Chile(23.959),Venezuela(21.635),EstadosUnidos(14.208), Ecuador(7.233),Bolivia(4.724)yAlemania(4.437).Nosvisitan,adems,cibernautasdeotros muchos pases, como Puerto Rico, Canad, Panam, Costa Rica, Guatemala, Repblica Dominicana,Japn,Cuba,Israel,Brasil,Portugal,ElSalvador,Uruguay,Australia,GranBretaa, Paraguay,Nicaragua,Francia,Honduras,Polonia,China,CoreadelSur,Italia,Turqua,Vietnam yunlargusimoetctera. A continuacin dejamos, por otra parte, constancia de algunos datos ms globales, relativosalndicedeimpactodelawebsitedelaAUFOPdesdeel1deenerode2008hastael 30denoviembrede2010.

AO 2008 2009 2010

VISITAS 34.608 279.800 407.195

VISITANTES 28.878 241.691 339.097

PGINAS 89.255 544.215 1.416.641

SOLICITUDES 1.455.627 4.282.448 5.734.075

GIGAS 28,84 151,44 228,98

Losdatosde2010secorrespondenalosmesesdeeneroanoviembre(ambosincluidos).

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1317

15

Almargendeloanterior,laRevistaInteruniversitariadeFormacindelProfesorado(en susdosversiones,impresaydigital)harecurridodurantelosltimosaosaotrasvasquehan contribuido,tambin,aincrementarsundicedeimpactoysuvisibilidadinternacional.Deesta forma,hoyambasrevistasestnpresentesennumerososrepositoriosybasesdedatos,tales comoLATINDEX,DICE,FUENTEACADMICAPREMIER,MIAR,INRECS,LLISTESCARHUS,ERCE, REDALYC, DIALNET, DOAJ, EREVISTAS, EBSCOHOST, REDINET, SUMARIS CBUC, OEI, COMPLUDOC,ISOC,SUDOC,ZBD,COPAC,IRESIEyenunsinfnderepositoriosdediferentes pases.

Mirandoalfuturo Como ha sealado recientemente Paul Aubert (Circunstancia, Ao V, 14, septiembre 2007),fueatravsdelaRevistadeEscuelasNormales,juntoconlaRevistadePedagoga,el BoletnEscolar,LaEscuelaModernayelBoletndelaInstitucinLibredeEnseanza,comose difundieron ideas nuevas en Espaa, en particular mediante las recensiones de obras de Montessori,Piaget,Petersen,Audemars,Claparde,CousinetoVermeylenydelosautoresde larevistaPourlreNouvelle,rganodelarenovacinpedaggicaeuropea. Enlneaconloanterior,laRevistaInteruniversitariadeFormacindelProfesorado,que naci con la intencin de rescatar el nombre y el espritu de renovacin pedaggica de la antigua Revista de Escuelas Normales, sigue manteniendo hoy, tras veinticinco aos de historia,sufilosofaenfavordelasreformaspedaggicasdecorteprogresistaysuvoluntadde promoverundebatecientficodealtacalidadenlosplanosnacionaleinternacionalentornoa temasclavedelasCienciasdelaEducacin.Enesadireccinnoshemosmovidohastalafecha, yenellaqueremosseguirmovindonosenelfuturo. En este sentido, el monogrfico que presentamos en este nmero (La profesin docente: Escenarios, perfiles y tendencias) es una muestra ms de ese espritu de pensamiento crtico y renovacin pedaggica que nos anima. En l encontrarn nuestras lectoras y lectores temticas tan sugerentes como las competencias ticas del profesor, la formacin para la ciudadana crtica, la convivencia en las aulas,la interculturalidad, el perfil profesionaldelmaestro,lasmujeresylaeducacin,laculturaexperiencialenlasaulasyun largoetcteradeescenariosdeinvestigacinyaproximacionesdidcticas. En esa misma lnea se movern tambin el conjunto de monografas que estamos preparando para los prximos nmeros de ambas revistas, entre las que destacamos las siguientes: Educacin democrtica y nuevos escenarios ciudadanos, La formacin del profesoradoenelsigloXXI:Propuestasanteloscambioseconmicos,socialesyculturales,La educacin inclusiva hoy: Escenarios y protagonistas, Evaluacin de experiencias de implantacindelosgradoseneducacinsuperior,Inteligenciaemocionalyaltahabilidad,Otra investigacinesposible(temticaalaquededicaremosunnmerocadaaoapartirde2012) oElamorylaeducacin,conelpensamientodeHumbertoMaturanacomofondo. Para finalizar este editorial queremos dejar reflejadas dos citas sobre la Revista Interuniversitaria de Formacin del Profesorado, dar la palabra a algunos de los autores que han opinado sobre la misma. Nos parecen especialmente significativas por la distancia temporal,onceaos,quehayentreellas:launaesde1994ylaotrade2005.Aunqueambas serefierenalaRIFOP,estamosconvencidosdequenuestrarevistaelectrnicaestcercade conseguir reconocimientos semejantes. No en vano ocupa actualmente la posicin nmero cuatroenDICE,labasededatosdelaANECA,sobreuntotalde196revistaspertenecientesa lamacroreadeHumanidadesyCienciasSocialesyJurdicas. Sealan Garca Snchez, Rodrguez Prez & Gonzlez Snchez (2005), en un artculo tituladoValoracindeladifusinendocerevistasdeeducacinenespaol:anlisisdelfactor de impacto y otros ndices bibliomtricos (Aula Abierta, 85, 344), que la Revista

16 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1317

InteruniversitariadeFormacindelProfesoradoeslaquintarevistaespaoladeeducacinque ms citas recibe (100 en 2003, que es el ao estudiado), tras Enseanza de las Ciencias, CuadernosdePedagoga,RevistadeEducacineInfanciayAprendizaje.Esteartculodestaca, por otra parte, que el factor de impacto de la Revista Interuniversitaria de Formacin del Profesoradoesimportante(0,257),elquintomsaltodelasrevistasespaolasdeeducacin, comparableenopinindeestosautoresaldemuchasrevistaseninglsincluidasenelISIde campo. Once aos antes, en una poca an muy cercana a los momentos fundacionales de la RIFOP,cuandostatenaunatrayectoriadetanslosieteaos,Guerea,RuizBerrio&Tiana Ferrer(1994)dejaronescritoensuHistoriadelaeducacinenlaEspaacontempornea:diez aosdeinvestigacinquelaRevistaInteruniversitariadeFormacindelProfesoradoesunade las10principalesrevistasespaolasdeeducacin. Entre nuestros proyectos de futuro tambin est el de seguir trabajando en lnea con esasdosreferencias. El Consejo de Redaccin

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1317

17

MONOGRAFA:

LAPROFESINDOCENTE: ESCENARIOS,PERFILESYTENDENCIAS

Coordinador: Pablo Palomero Fernndez

PRESENTACIN

La profesin docente: escenarios, perfiles y tendencias


PabloPALOMEROFERNNDEZ(Coordinador)

Correspondencia: PabloPalomeroFernndez Correoelectrnico: pabpalom@unizar.es Telfono: +34976761027 Direccinpostal: FacultaddeCienciasSociales ydelTrabajo UniversidaddeZaragoza C/ViolantedeHungra,23 50009Zaragoza

RESUMEN
En este artculo se hace una presentacin del nmero 35, volumen 13(4) de la Revista electrnica Interuniversitaria de FormacindelProfesorado:Laprofesindocente:escenarios, perfiles y tendencias, en el que participan autores de veintiocho instituciones pertenecientes a cinco pases: Espaa, Brasil, Mxico, Argentina y Per. Se trata de un volumen que consta de veintiocho artculos seguidos de un conjunto de resmenes de tesis doctorales y recensiones bibliogrficas, cuyo marco general es el escenario de la profesindocente. PALABRAS CLAVE: Profesin docente, Formacin del profesorado,Calidaddelaeducacin.

The teaching profession: scenarios, profiles and tendencies


ABSTRACT
This article introduces the special issue of the Revista Electrnica Interuniversitaria de Formacin del Profesorado,35,volumen13(4)entitledTheteachingprofession:Scenarios,profilesandtendencies.It containscontributionsfromauthorsaffiliatedtotwentyeightdifferentinstitutionsacrossfivecountries: Spain,Brazil,Mexico,ArgentinaandPeru.Thetwentyeightarticlesincludedarefollowedbyanumber ofPhDthesissummariesandbookreviews,whosegeneralframeworkisthatoftheteachingprofession.

KEY WORDS: Theteachingprofession,Teachertraining,Educationquality.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2125

21

Pablo Palomero Fernndez

El nmero 35, volumen 13(4) de la Revista electrnica Interuniversitaria de Formacin del Profesorado, cuyo marco general es el escenario de la profesin docente, es un volumen que consta de un total de veintiocho artculos. Tras el editorial y la presentacin, este nmero est estructurado en seis bloques, conectados con diferentes desafos, perfiles y tendencias en el mbito de esta profesin. Son los siguientes: 1) Profesin docente y calidad de la educacin; 2) Inclusin, convivencia y cultura de paz en las aulas; 3) Mujeres y educacin: escenarios de ayer y de hoy; 4) Realidad, pensamiento y formacin del profesorado; 5) Aproximaciones didcticas; y 6) Tendencias y desafos en estimulacin multisensorial y en psicomotricidad. El volumen finaliza con dos captulos ms: En el primero de ellos se recoge una sntesis de cuatro tesis doctorales muy recientes y en el segundo se ofrecen seis recensiones bibliogrficas.

Pases e instituciones participantes


En primer lugar queremos destacar que en este nmero participan autores de veintiocho instituciones, pertenecientes a cinco pases: Espaa, Brasil, Mxico, Argentina y Per; y, tambin, que en el mismo estn representadas un total de veinticinco universidades: Alicante, Autnoma de Quertaro (Mxico), Barcelona, Burgos, Camilo Jos Cela, Cantabria, Complutense de Madrid, Crdoba, Extremadura, Granada, Guanajuato (Mxico), Huelva, Jaume I de Castelln, La Laguna, La Rioja, Mondragn Unibertsitatea, Nacional de Ro Cuarto (Crdoba/Argentina), Pas Vasco, Pblica de Navarra, Sevilla, Universidad Nacional de Educacin a Distancia, Universidad Pblica Federal Brasilea, Universidad San Pablo CEU, Valladolid y Zaragoza. Finalmente, tambin participan en este volumen otros profesionales del mundo de la educacin provenientes de Brasil, de Per y del Colegio Pblico de Educacin Especial Gloria Fuertes de Andorra (Teruel), centro que fue galardonado recientemente con el Primer Premio Nacional a la Calidad Educativa Marta Mata (2009). Por otra parte, cabe resaltar que en el caso de los autores espaoles, en este volumen se ofrecen contribuciones de acadmicos pertenecientes a doce comunidades autnomas: Andaluca, Aragn, Cantabria, Castilla Len, Catalua, Extremadura, Islas Canarias, La Rioja, Madrid, Navarra, Pas Vasco y Valencia.

Bloques temticos
Como ya hemos sealado previamente, este volumen est estructurado en forma de bloques temticos, cuyos contenidos expondremos seguidamente. El primero de ellos, Profesin docente y calidad de la educacin, consta de tres artculos: 1) Competencias ticas del profesor y calidad de la educacin, del que es autor Emilio Garca Garca (Universidad Complutense de Madrid); 2) Vocacin docente versus profesin docente en las organizaciones educativas, de Faustino Larrosa Martnez (Universidad de Alicante); y 3) Propuestas de solucin para los problemas educativos de hoy, del que es autora Presentacin A. Caballero Garca (Universidad Camilo Jos Cela). El segundo bloque, Inclusin, convivencia y cultura de paz en las aulas, est integrado por un total de cinco artculos: 1) El AprendizajeServicio en la Universidad: una estrategia en la formacin de ciudadana crtica, del que son autoras Andrea Francisco Amat y Mara Lidn Moliner Miravet (Universidad Jaume I de Castelln); 2) Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco, cuyos autores son Flix Etxeberra Balerdi, Iaki Karrera e Hilario Murua (Universidad del Pas Vasco); 3) El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes, del que son autoras Amelia Barqun, Nerea Alzola, Monika Madinabeitia y Ane Urizar (Mondragn Unibertsitatea); 4) Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa), artculo cuya autora corresponde a Azucena Ochoa Cervantes (Universidad Autnoma de Quertaro: Mxico) y Salvador Peir i Gregori (Universidad de Alicante); y 5) Metacognicin y competencia de aprender a aprender en Educacin Infantil: una propuesta para facilitar la inclusin, de Mara Consuelo Siz Manzanares (Universidad de Burgos), Valle Flores-Lucas y Jos Mara Romn (ambos de la Universidad de Valladolid). En el tercer bloque, Mujeres y educacin: escenarios de ayer y de hoy, se ofrecen tres artculos: 1) Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas, del que es autora Teresa Gonzlez Prez (Universidad de La Laguna); 2) Primeros pasos de la Escuela Normal Femenina

22 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2125

La profesin docente: escenarios, perfiles y tendencias

de Santander, 1915, del que es autora Carmen Rubalcaba Prez (Universidad de Cantabria); y 3) Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada, del que son autoras
Mara Rosa Luengo Gonzlez y Prudencia Gutirrez Esteban (Universidad de Extremadura). El cuarto bloque, Realidad, pensamiento y formacin del profesorado, est integrado por ocho artculos: 1) Definicin y contextualizacin del perfil profesional del maestro en HUEZI, del que son autoras Nerea Alzola Maiztegi, Nekane Arratibel, Arantza Mongelos Garca, Begoa Pedrosa, Karmele Prez Lizarralde y Leire Uriarte Zabala (Mondragn Unibertsitatea); 2) Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas, cuya autora corresponde a Carola Astudillo, Alcira Rivarosa y Flix Ortiz (Universidad Nacional de Ro Cuarto, Crdoba: Argentina); 3) Implicacin del alumnado en el proceso de aprender a pensar, del que son autores Juan Manuel Muoz Gonzlez y Antonio Ontoria Pea (Universidad de Crdoba); 4) Una mirada sobre el proceso de formacin del profesor como investigador en la Universidad Pblica Federal Brasilea, de Carla Cristina Dutra Brigo y Clesar Luiz Loch (Brasil); 5) El influjo educativo de los profesores en el abandono de la prctica fsico-deportiva de los adolescentes, del que son autoras Ana Ponce de Len Elizondo, Mara ngeles Valdemoros San Emeterio y Eva Sanz Arazuri (Universidad de La Rioja); 6)

Trabajando la prevencin: Habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela, cuyo autor es Carlos Salavera Bords (Universidad de Zaragoza); 7) Estilo de pensamiento del alumnado y profesorado universitario: Implicaciones educativas, cuya autora corresponde a Pedro Allueva Torres, Mara Luisa Herrero Nivela y Juan Agustn Franco Martnez (Universidad de Zaragoza); y 8) Estudio del rendimiento acadmico de los alumnos de magisterio de la Facultad de Educacin de Zaragoza, del que es autor Alfonso Heredia
Manrique (Universidad de Zaragoza). El quinto bloque, Aproximaciones didcticas, consta de tres artculos: 1) El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin, del que son autores Javier Arlegui de Pablos y Julia Ibarra Murillo (Universidad Pblica de Navarra); 2) Anlisis del andamiaje en un proceso de lectura conjunta, de Javier Gonzlez Garca (Universidad de Guanajuato: Mxico); y 3) Manuales de Historia de la Literatura o qu literatura se ensea, cuya autora corresponde a Rebeca Soler Costa y Pablo Lorente Muoz (Universidad de Zaragoza). El sexto bloque, Tendencias y desafos en estimulacin multisensorial y en psicomotricidad, contiene los cuatro ltimos artculos de este volumen: 1) Psicomotricidad: Qu formacin dicen poseer los profesores de Educacin Infantil y Educacin Especial de la provincia de Huelva?, del que son autoras Delia Martn Domnguez y Sara Rodrguez Snchez (Universidad de Huelva); 2) Psicomotricidad y Arteterapia, cuyas autoras son Gabriela Araujo Caixeta (UFMG. Belo Horizonte: Brasil) y Gisella N. Gabeln Madueo (Centro de Formacin Educativa Djalo Ser. Lima: Per),); 3) La integracin sensorial en el aula multisensorial y de relajacin: Estudio de dos casos, del que son autores Alfonso Lzaro Lzaro, Silvia Blasco Casorrn y Ana Lagranja Fabra (Colegio Pblico de Educacin Especial Gloria Fuertes de Andorra, Teruel); y 4) El cuaderno de bitcora y la formacin de los

psicomotricistas. Sobre cmo fomentar el encuentro entre la cultura acadmica y la cultura experiencial, del que son autores Jos Emilio Palomero Pescador, Pablo Palomero Fernndez y Mara
Rosario Fernndez Domnguez (Universidad de Zaragoza).

Tesis doctorales
Tras los artculos, el presente nmero ofrece un resumen de cuatro tesis doctorales, todas ellas muy recientes: 1) Las aportaciones de Jess Gmez y Ramn Flecha a las teoras y prcticas dialgicas (1965-2006), cuya autora es Elisenda Giner i Gota [Tesis defendida en la Escuela Universitaria de Educacin de Segovia (Universidad de Valladolid), noviembre de 2010)]; 2) Burnout en docentes: una aproximacin a la situacin de profesores de escuelas primarias pblicas en Mxico, cuya autora es Ericka Ileana Escalante Izeta (Universidad de Granada, junio 2010); 3) Habilidades comunicativas y trastornos formales del pensamiento en personas con esquizofrenia, cuyo autor es Carlos Salavera Bords (Universidad de Zaragoza, febrero 2010); y 4) La madre en el cine del New Deal, cuya autora es Ana Lanuza Avello (Universidad CEU San Pablo, marzo 2010).

Recensiones bibliogrficas
El ltimo apartado del presente volumen esta conformado por seis recensiones bibliogrficas: 1) Isabel Cantn Mayo (Coordinadora) (1999). Narraciones de la escuela. Barcelona: Davinci, Coleccin

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2125

23

Pablo Palomero Fernndez

Relatos. El autor de la recensin es Antonio Bautista Garca-Vera, maestro y profesor de la Universidad Complutense de Madrid; 2) Mara ngeles Rebollo Cataln (2006). Gnero e interculturalidad: educar para la igualdad. Madrid: La Muralla. La autora de la recensin es Luisa Vega Caro, profesora de la Universidad de Sevilla; 3) Lorenzo Garca Areito, Marta Ruiz Corbell y Miriam Garca Blanco (2009). Claves para la educacin. Actores, agentes y escenarios en la sociedad actual. Madrid: Narcea. La autora de la recensin es Concepcin Monge Crespo, profesora de la Universidad Nacional de Educacin a Distancia; 4) Javier Ballesta Pagn (2009). Educar en tiempos revueltos (crnicas sobre la realidad educativa) Barcelona: Gra. El autor de la recensin es Enrique Garca Pascual, profesor de la Universidad de Zaragoza; 5) Salvador Peir i Gregori (2005). Indisciplina y violencia escolar. Alicante: Instituto Alicantino de Cultura Juan Gil Albert. La autora de la recensin es Rosario Beresaluce Dez, profesora de la Universidad de Alicante; 5) Carmen Sanchidrin y Julio Ruiz Berrio (coordinadores) (2010). Historia y perspectiva actual de la educacin infantil. Barcelona: Gra. La autora de la recensin es Mara Rosa Domnguez Cabrejas, profesora de la Universidad de Zaragoza; y 6) Carmen Garca, Laura Ruiz, Ldia Puigvert y Lourdes Ru (2009). Hipatia de Alejandra. Un equipo plural de cientficas desvela la verdad sobre la primera mujer de ciencia. Barcelona: Hipatia. La autora de la recensin es Cristina Pulido, profesora de la Universidad de Barcelona.

REIFOP 2010
Con este nmero culminamos 2010, un ao especialmente productivo para la Revista electrnica Interunivesitaria de Formacin del Profesorado, cuya visibilidad internacional e ndice de impacto ha mejorado sustancialmente a lo largo del mismo. En primer lugar, la REIFOP ha logrado ocupar el puesto nmero cuatro (sobre un total de 196 revistas) en DICE, el ndice de Difusin y Calidad Editorial de las Revistas Espaolas de Humanidades y Ciencias Sociales y Jurdicas (ANECA). Adems, ha consolidado su situacin en LATINDEX (Mxico) o DOAJ (Suecia), y ha sido evaluada favorablemente por otras bases de datos, que la han incorporado a su acerbo, como es el caso de REDALYC (Mxico), FUENTE ACADMICA PREMIER (Estados Unidos), LIvBRE (Brasil), EREVISTAS (Espaa) o MIAR (Espaa), en cuyo ndice de Difusin Secundaria est valorada actualmente con 6,477 puntos. En segundo lugar, en los cuatro nmeros publicados en 2010, incluido el presente, han publicado en la REIFOP autores pertenecientes a 61 instituciones de un total de 13 pases: Arabia Saud, Argentina, Blgica, Brasil, Espaa, Estados Unidos, Francia, Mxico, Per, Polonia, Portugal, Reino Unido y Venezuela. De entre tales instituciones, 52 son universidades: Alicante, Almera, Autnoma de Barcelona, Autnoma de Quertaro (Mxico), Barcelona, Burgos, Camilo Jos Cela, Cantabria, Complutense de Madrid, Crdoba, Ecole Normale du Brabant Wallon (Nueva Lovaina, Blgica), Extremadura, Granada, Guanajuato (Mxico), Huelva, Jan, Jaume I de Castelln, King Faisal University (Arabia Saud), La Laguna, La Rioja, Len, Mlaga, Mondragn Unibertsitatea, Murcia, Nacional de Ro Cuarto (Crdoba, Argentina), Oviedo, Pas Vasco, Politcnica de Valencia, Porto (Portugal), Pblica de Navarra, Ramn Llull (Barcelona), Sevilla, Tufts University (USA), Universidad de Beira Interior (Covilh, Portugal), Universidad de Estado de Ro de Janeiro (Brasil), Universidad de las Amricas Puebla (Mxico), Universidad de Navarra, Universidad de Oriente (Cuman, Venezuela), Universidad Nacional de Educacin a Distancia (UNED), Universidad Nacional de La Plata (Argentina), Universidad Pblica Federal Brasilea (Brasil), Universidad San Pablo CEU, Universidade do Minho (Portugal), University Johns Hopkins (Baltimore, USA), University of Connecticut (USA), University of London (Reino Unido), University of Nottingham (Reino Unido), Univesity of Szczecin (Polonia), Valencia, Valladolid, Yale University (USA) y, finalmente, Universidad de Zaragoza. Por otra parte, en los nmeros citados han participado tambin otros acadmicos y profesionales pertenecientes a diferentes instituciones espaolas y extranjeras: Center for Talentec Youth (Johns Hopkins University, Estados Unidos), Centro de Formacin Educativa Djalo Ser (Lima, Per), UFMG (Belo Horizonte, Brasil), Colegio Pblico de Educacin Especial Gloria Fuertes de Andorra (Teruel), Escuela de Sahn (Villanova, Huesca), FAPA Francisco Giner de los Ros (Vallecas, Madrid), IES Jimena Menndez Pidal de Fuenlabrada (Madrid), IES Rosario Acua (Gijn) y, por ltimo, Laboratorio de Investigacin Brigitte Frybourg (Pars, Francia). Por ltimo, la web de la AUFOP ha experimentado durante 2010 un notable incremento de visitas en lnea, incremento que afecta a ambas revistas, la impresa y la electrnica. Como ya se ha remarcado en el editorial de este nmero, la citada website ha pasado de las 34.608 visitas recibidas en 2008, a las 407.195 alcanzadas en los primeros once meses de 2010. Seguidamente reflejamos algunos

24 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2125

La profesin docente: escenarios, perfiles y tendencias

datos relativos a las descargas recibidas por la revista electrnica (REIFOP). Precisamos previamente que la website de la AUFOP tiene previstos diferentes formatos para descargar los artculos alojados en ella. As, es posible descargar el pdf individual de cada uno de los artculos, o tambin se puede descargar el pdf completo de cada uno de los nmeros alojados en la misma. En este sentido resaltamos que los datos que se ofrecen a continuacin hacen referencia a esta ltima opcin, de manera que lo que en ellos se refleja es el volumen de descargas que han tenido los pdf completos de cada uno de los ocho nmeros de la REIFOP publicados entre abril de 2009 y octubre de 2010. Tambin se deja constancia de la fecha en que fue publicado cada nmero y del periodo temporal al que hacen referencia, en cada caso, las descargas.
NMERO 28, VOLUMEN 12 (1) 29, VOLUMEN 12 (2) 30, VOLUMEN 12 (3) 31, VOLUMEN 12 (4) 32, VOLUMEN 13 (1) 33, VOLUMEN 13 (2) 34, VOLUMEN 13 (3) TOTAL DESCARGAS FECHA PUBLICACIN ABRIL 2009 AGOSTO 2009 OCTUBRE 2009 DICIEMBRE 2009 ABRIL 2010 AGOSTO 2010 OCTUBRE 2010 PERIODO CONSULTADO 1 ENERO A 30 NOVIEMBRE 2010 1 ENERO A 30 NOVIEMBRE 2010 1 ENERO A 30 NOVIEMBRE 2010 1 ENERO A 30 NOVIEMBRE 2010 1 ABRIL A 30 NOVIEMBRE 2010 1 AGOSTO A 30 NOVIEMBRE 2010 1 OCTUBRE A 30 NOVIEMBRE 2010 DESCARGAS 26.796 35.716 2.810 11.560 54.659 15.522 8.139 155.202

Algunos datos sobre el volumen de descargas que recibe la REIFOP en aufop.com

A las 155.202 descargas que acabamos de resear, que son las recibidas por los ocho ltimos nmeros de la REIFOP a lo largo de los once ltimos meses, hay que sumar las que reciben a diario los pdf individuales de cada uno de los artculos alojados en la website de la AUFOP. Y a estas ltimas habra que aadir, tambin, las descargas que, previsiblemente, se estarn produciendo a travs de las diferentes bases de datos y repositorios en que estn alojadas a texto completo la RIFOP y la REIFOP.

Otra investigacin es posible: un nuevo proyecto de la REIFOP


Finalmente, aprovechamos la presentacin del presente volumen para anunciar que la Asociacin Universitaria de Formacin del Profesorado (AUFOP) acord en su ltima Asamblea General Anual Ordinaria, celebrada en Mlaga el pasado da 10 de noviembre de 2010 (en el contexto del Congreso Profe10. Reinventar la profesin docente), publicar en la REIFOP, a partir de 2012 y con periodicidad anual, un nmero dedicado a Otra investigacin es posible. Con ello la REIFOP trata de incrementar mediante el volumen de artculos cuyo fondo inspirador sea la justicia, los Derechos Humanos, el comportamiento tico, la igualdad social, la libertad responsable, la nodiscriminacin y el desarrollo econmico, social y medioambiental sostenible Se pretende con ello proporcionar nuevas herramientas para la formacin de una mentalidad docente e investigadora capaz de cambiar las estructuras de una sociedad que est marcada por la violencia sistmica y estructural; ofrecer instrumentos que abran caminos a otra universidad es posible, a otra docencia es posible, a otra investigacin es posible, o otra gestin universitaria es posible, a otra escuela es posible, a otro mundo es posible

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2125

25

PROFESIN DOCENTE Y CALIDAD DE LA EDUCACIN

REFERENCIA: Garca Garca, Emilio (2010). Competencias ticas del profesor y calidad de la educacin. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Competencias ticas del profesor y calidad de la educacin


EmilioGARCAGARCA
Correspondencia: EmilioGarcaGarca Correoselectrnicos: emiliog@filos.ucm.es garmi@cop.es Telfono: +34913943117 Direccinpostal: Dpto.PsicologaBsicaII ProcesosCognitivos FacultaddePsicologa UniversidadComplutense CampusdeSomosaguas 28223PozuelodeAlarcn Madrid Recibido:2dejuniode2010 Aceptado:18deoctubrede2010

RESUMEN
En este trabajo reflexionamos sobre la profesin de profesor,susdemandasyexigenciasylasrespuestasaellas. La profesin de profesor exige conocimientos y competencias de alto nivel y en continua actualizacin. Caracterizamoslasexigenciasdelprofesorencincombitos: conocer,hacer,querer,conviviryser,quesecorresponden con las dimensiones que ha de tener la educacin del alumno en la sociedad actual. Consideramos las competencias ticas del profesor como fundamentales. El desarrollopersonaldelosalumnosesundesarrollointegral que comprende desarrollo cognitivo, emocional y moral. Parapropiciartaldesarrolloenlosalumnosserequiereque el profesor cuide especialmente su propio desarrollo personal, cognitivo, afectivo y moral. El equilibrio emocional,bienestarpsicolgico,satisfaccinycompromiso con la profesin son condiciones necesarias para una prcticaprofesionaldecalidad.

PALABRAS CLAVE: Profesor, Competencias, Responsabilidad moral, Bienestar, Satisfaccin con la profesin.

The teachers ethical competences and quality education


ABSTRACT
In this article we reflect on the teaching profession, on the teachers requests and demands and how theycanbemet.Theteacherprofessionrequirestohaveahighcommandofknowledgeandskillsand tokeepcontinuallyupdated.Wecharacterizetherequirementsofteachersinfiveareas:toknow,todo, to want, to live together and to be, which correspond with the dimensions that the education of students must have in the present society. We consider the teachers ethical competences to be essential.Thestudentspersonalfulldevelopmententailscognitive,emotionalandmoraldevelopment. Topromotesuchdevelopmentinstudentsitisnecessaryforteacherstopayspecialattentiontotheir own personal, cognitive, emotional and moral development. Emotional balance, psychological well being,satisfactionandcommitmenttotheprofessionarenecessaryconditionsforqualityprofessional practice.

KEY WORDS: Teacher,Competences,Moralresponsibility,Wellbeing,Professionalsatisfaction.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

29

Emilio Garca Garca

Introduccin y antecedentes
Los profesores pertenecen a una categora profesional muy heterognea. Los profesores de Educacin Infantil, Primaria, Secundaria, Universidad, Adultos o Educacin Especial presentan diferencias en formacin, reclutamiento, salarios, reconocimiento social y autonoma profesional. Por otra parte, se constatan diferencias en los profesores segn pases, nivel de desarrollo y culturas. Pero la profesin de profesor tambin conlleva unas caractersticas propias y diferenciales. El profesor ejerce su profesin normalmente durante muchos aos, ms de treinta en muchos casos. Durante un periodo tan dilatado, ocurren muchos acontecimientos en su vida y en su entorno. En su ciclo vital se acumulan experiencias, se amplan conocimientos, se modifican actitudes y valores. En su entorno ocurren cambios cientficos, tecnolgicos, econmicos, sociales y culturales que alteran radicalmente las demandas al sistema educativo y a su funcin profesional. A la vez, los alumnos presentan caractersticas diferenciales y cambiantes en nivel econmico y cultural de la familia, capacidades mentales, motivaciones e intereses. La profesin de profesor exige dominar un conjunto de conocimientos y competencias; que ha de aprender en instituciones superiores de formacin universitaria; que requiere continua formacin y actualizacin de conocimientos y tcnicas; que ha de poner en prctica segn principios ticos; para responder a una necesidad personal y social de primer orden, como es la educacin.

Profesin de profesor
Desde posturas crticas, sociolgicas y pedaggicas, se han cuestionado las reivindicaciones profesionalizadoras de los profesores por cuanto conllevan intereses personales y sectoriales elitistas y burocrticos, que seran incompatibles con los ideales democrticos de solidaridad, autonoma y difusin del saber (BURBULES & DESMORE, 1992). Tambin Apple (1986; 1989) denuncia los intereses que operan bajo la reivindicacin de una tecnificacin de la enseanza. Pero sera un error identificar profesionalizacin con tecnificacin de los procesos educativos, pues cabe entender la profesin como desarrollo de una cultura profesional que avance en niveles de formacin, autonoma, responsabilidad, compromiso social y personal en el trabajo (FERNNDEZ PREZ, 1988; ORTEGA & VALERA, 1991; GARCA GARCA, 1996; 2006). Podemos diferenciar dos tendencias de anlisis en la profesionalizacin del docente: la que argumenta que reforzar la profesin conlleva tecnificacin, burocracia, elitismo y control social; y la que, por el contrario, defiende un concepto de profesin histricamente contextualizado, crtico y democrtico, y propone avanzar en el desarrollo de una nueva cultura profesional para una educacin de calidad. El concepto neoliberal de profesin puede superarse por una acepcin ms social, democrtica y crtica. La reivindicacin de la profesionalidad por parte de los profesores no puede quedar limitada a aspectos tcnicos de la funcin docente, sino que se ha de plantear un desarrollo profesional ms amplio, una nueva cultura profesional que propicie espacios de reflexin, de crtica sobre las funciones de la educacin, modelo de sociedad y proyecto de hombre, procesos de formacin, condiciones laborales y variables del proceso enseanzaaprendizaje, teniendo como objetivo el profesor investigador su prctica profesional (HOYLE, 1974; STENHOUSSE, 1982, 1987; GIROUX, 1987; KEMMIS, 1988; SCHON, 1992; IMBERNON, 1994). Diversos informes han sealado como caractersticas del buen profesor: Compromiso con la profesin. La implicacin personal, emocional y moral en el quehacer es condicin determinante para la buena valoracin por los alumnos y el xito en la tarea. Afectividad con los alumnos. Un comportamiento afectivo hacia los alumnos, con empata, optimismo, estima y apoyo, son cualidades valoradas muy positivamente. Conocimiento de la materia que ensea y empleo de tcnicas didcticas adecuadas. Saber lo que se ensea y ensearlo bien. Combinar metodologas variadas, partiendo de las caractersticas diferenciales de los alumnos y del grupo. Trabajo colaborativo en grupo de profesores. El trabajo en grupo es altamente valorado, aunque no tan practicado. Analizar las experiencias y dificultades en sesiones formales y de

30 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

claustro, pero tambin en conversaciones de pasillo y recreo, es requisito para mejorar las competencias del profesor. Pensamiento reflexivo y crtico. Reflexionar en la prctica y sobre su prctica, a efectos de poner en juego nuevas hiptesis, contextualizar y desarrollar teoras, adoptar nuevas metodologas y estrategias didcticas. Motivacin por la calidad. Los buenos profesores se comprometen con la innovacin y la calidad en los centros, procurando proyectos compartidos, liderazgos eficaces, apertura al contexto comunitario (HARGREAVES, 1992, 1996; MARCHESI & MARTIN, 2000).

Las exigencias de la profesin docente se pueden identificar en cinco mbitos:

Conocer: conjunto estructurado de conocimientos sobre el mundo natural y sociocultural.


Las disciplinas del currculo. Competencias cognitivas.

Hacer: conjunto de procedimientos y estrategias. Competencias procedimentales. Querer: motivacin, compromiso, esfuerzo. Competencias afectivas. Convivir: capacidad para trabajar y relacionarse con compaeros y alumnos. Competencias comunicativas. Ser: desarrollo del profesor como persona. Responsabilidad tica ante los alumnos, familias y sociedad. Competencias personales.

Las competencias que han de desarrollar los profesores en estos mbitos se corresponden precisamente con las demandas a la educacin de los alumnos en nuestra sociedad. La educacin tiene planteadas exigencias mltiples, crecientes, complejas y hasta contradictorias en la sociedad actual. Se requiere transmitir, masiva y eficazmente, un volumen cada vez mayor de conocimientos, que genera y requiere la sociedad cognitiva. Se exige ofrecer criterios y orientaciones para no perderse entre cantidades ingentes de informaciones, ms o menos superficiales y efmeras, que invaden los espacios pblicos y privados, para mantener el rumbo en proyectos de desarrollo personal y social. La educacin debe proporcionar las cartas nuticas en un mundo complejo y en permanente agitacin, al mismo tiempo la brjula para poder navegar por l y el ancla para detenerse, anticipar y valorar rutas a seguir. En la sociedad del conocimiento el aprendizaje no se circunscribe a un determinado espacio como las instituciones educativas: se exige aprender en todos los contextos. Por otra parte, el aprendizaje no puede quedar limitado a un determinado periodo temporal en el ciclo vital de la persona. No se puede ya vivir de las rentas de conocimientos adquiridos en los aos de formacin. Los continuos cambios en todos los niveles conllevan nuevas demandas profesionales y nuevas exigencias personales. Es obligado aprender a lo largo de toda la vida de la persona. La enseanzaaprendizaje en la Universidad debe capacitar a las personas para ese aprendizaje permanente. En la sociedad del conocimiento, cada persona ha de asimilar una base de conocimientos rigurosos y estrategias eficaces; tiene que saber qu pensar y cmo actuar ante las situaciones relevantes a lo largo de la vida; hacerlo desde criterios razonables y susceptibles de crtica; ser sensible a las exigencias cambiantes de los contextos; desarrollar el pensamiento reflexivo, crtico y creativo. La enseanzaaprendizaje para la comprensin, como gran reto para nuestro tiempo, se ha de construir sobre los siguientes pilares: A) aprender a conocer, B) aprender a querer y sentir, C) aprender a hacer, D) aprender a convivir, E) aprender a ser, F) aprender sobre el conocer, el querer, el sentir. (DELORS, 1996; GARCA GARCA, 2009). A) APRENDER A CONOCER. Conocimiento es un trmino con un contenido semntico muy amplio. Hace referencia a: los conocimientos comunes que las personas tenemos sobre el mundo y que utilizamos en nuestra vida cotidiana; los conocimientos disciplinares sobre distintos mbitos de la realidad natural y sociocultural que conforman las distintas ciencias y saberes; los conocimientos sobre la propia identidad personal; los conocimientos sobre el conocimiento mismo o metacognicin. Conocer requiere asimilar informacin, tener memorias y operar con ellas, realizar procesos, ejercitar procedimientos o estrategias para sacar el mejor partido a lo que se conoce, conocer continuamente ms, resolver problemas, tomar decisiones. Pero conocer tambin requiere motivacin, esfuerzo, compromiso, constancia en un proyecto formativo de desarrollo personal y social. Aprender a conocer es una exigencia para responder a las demandas prcticas y profesionales de la sociedad cognitiva; pero tambin es condicin imprescindible para desarrollarse con ms plenitud

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

31

Emilio Garca Garca

como persona, ejercitar las capacidades humanas, disfrutar del saber, dar sentido a la vida. Aprender a conocer supone ejercitar todas las capacidades de la mente: los procesos de atencin, percepcin, memoria, razonamiento, pensamiento crtico, creatividad, resolucin de problemas, lenguaje, motivacin, afectividad. La sociedad del conocimiento actual (sociedad de la imagen es caracterizacin ms propia) est sesgada hacia un tipo de informacin, la icnica, las imgenes, lo que si bien conlleva oportunidades, tambin entraa serios riesgos. Las informaciones en imgenes, con su rapidez, inmediatez, variedad, novedad, atractivo, plantean unas exigencias de procesamiento de informacin mental diferentes de la informacin lingstica, propias del texto y discurso. Los formatos multimedia requieren un tipo de atencin, concentracin, planificacin, esfuerzo distinto del procesamiento de textos, ms significativo y profundo. Manejar el mando a distancia de la TV, o el buscador de pginas web en el ordenador, es tarea muy distinta a enfrentarse y enfrascarse con la lectura de un libro. La hegemona de mensajes icnicos en la sociedad de la informacin puede obstaculizar, paradjicamente, el desarrollo mental de las personas, el pensamiento elaborado, significativo, crtico, creativo, que requiere precisamente la sociedad del conocimiento (GARDNER, 2000; HARDGREAVES, 2003) B) APRENDER A QUERER Y SENTIR. La voluntad, el esfuerzo, el compromiso son imprescindibles para alcanzar los proyectos de desarrollo personal y comunitario. El aprendizaje continuo que conlleva la sociedad cognitiva exige comprometerse activamente con proyectos formativos personales que requieren constancia, esfuerzo, renuncias. Ms de un 80% de la poblacin adulta considera clave la formacin, pero solamente menos de un 25% elabora planes de formacin personal y se implican en ellos. Desear, querer, amar lo que se hace es condicin obligada para alcanzar buenos resultados. Las motivaciones pueden ser ms externas, como el deseo de reconocimiento, prestigio social, recompensas monetarias, etc.; o ms internas como el deseo de saber, de realizar bien el trabajo, de superarse, etc. Los seres humanos estamos motivados, interna y externamente, en distintas proporciones segn circunstancias. Es preferible que la motivacin tenga origen ms interno, puesto que las fuentes externas tienden a ser ms pasajeras. Las personas automotivadas internamente mantienen los niveles altos, an cuando las recompensas externas disminuyan o desaparezcan. Una proporcionada combinacin de motivacin externa e interna es deseable. Cada persona ha de comprometerse con su propia formacin. Ha de querer aprender de forma independiente y autnoma en contextos cambiantes. Ha de querer ser competente para evaluar y tomar decisiones sobre qu, cundo, cmo necesita aprender y dnde obtener los recursos precisos. El inters y motivacin resultan claves para un aprendizaje eficaz. Cuando el conocimiento resulta relevante y significativo para la persona, tanto intelectual como afectivamente, es asimilado de forma ms fcil, duradera y eficaz (CSIKSZENTMIHALYI, 1998; SELIGMAN, 1999). C) APRENDER A HACER. El curriculum escolar ha puesto tradicionalmente nfasis, cuando no exclusividad, en transmitir conocimientos, prestando menos atencin a los procedimientos, las prcticas, los modos de hacer. Pero el saber hacer presenta unas demandas especiales en la sociedad actual. Ya no se trata de especializacin profesional, de preparar para una tarea definida y un trabajo profesional estable en el tiempo. Hoy se requiere un continuo aprender a hacer, una adaptabilidad a los contextos tan cambiantes. En la nueva economa, el trabajo est en un proceso que podemos calificar de desmaterializacin. Cada vez tiene menos que ver con la materia como ocurra en sociedades agrarias (cultivar la tierra) o industriales (fabricar objetos), y ms con el conocimiento, la comunicacin, el asesoramiento, planificacin, supervisin, relaciones interpersonales, etc. Aprender a hacer no es aprender prcticas rutinarias, ms propias de la formacin profesional del pasado. La nueva economa exige nuevas competencias. Las tareas industriales en cadena, fragmentadas y repetitivas, estn dando paso a colectivos de trabajo, grupos de proyecto, satisfaccin del cliente, calidad total. Los empleados ya no son annimos e intercambiables y las tareas se personalizan. Junto a la formacin profesional y calificacin tcnica se requieren otras competencias como la capacidad de iniciativa, proyecto personal y compromiso, aptitud para trabajar en grupo, disposicin a asumir riesgos, afrontar y resolver conflictos, planificar, tomar decisiones y evaluar procesos y resultados, introducir innovaciones y mejoras. D) APRENDER A CONVIVIR. Aprender a convivir en los diferentes y simultneos espacios en los que transcurre nuestra vida: nivel familiar, escolar, laboral, sociocultural, es quiz lo ms urgente e importante. En la sociedad globalizada y de la informacin, somos observadores impotentes de quienes

32 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

generan y mantienen los conflictos y la violencia. Los modelos violentos en la familia, escuela, empresa, medios de comunicacin de masas, estn alcanzando cotas alarmantes. El derecho a la paz se declara prioritario al comenzar el siglo XXI, como condicin bsica para el desarrollo y bienestar personal y social. El descubrimiento, reconocimiento y respeto del otro se logra en paralelo a la conformacin de la propia identidad personal. Es objetivo prioritario de la educacin desarrollar la propia identidad a la vez que comprender y valorar la personalidad de los dems. Si la familia, escuela, trabajo, medios de masas fomentan actitudes de respeto, tolerancia se estn previniendo comportamientos violentos. Aprender a convivir es objetivo prioritario en nuestra sociedad, cada vez ms multicultural. La inmigracin plantea cuestiones de carcter tico y poltico, de respeto a los valores y cultura de las minoras, a la vez que exigencias de aceptacin e integracin en la cultura mayoritaria. Pero especialmente exige respuestas educativas apropiadas para los hijos de los inmigrantes y compromete a los profesores, sus valores, actitudes, metodologas y prcticas. Aprender a convivir no es un conocimiento meramente declarativo, sino tambin y sobre todo procedimental. Es decir, se adquiere practicndolo y exige tiempo y condiciones adecuadas. El pensamiento crtico y el comportamiento responsable y solidario slo se alcanzan con una metodologa de enseanzaaprendizaje consonante. La educacin tiene una doble misin: mostrar la complejidad y diversidad de la especie humana y, la vez, las semejanzas e interdependencia entre todos los seres humanos. Todas las personas compartimos una estructura mental, unos universales cognitivos, emocionales, lingsticos, segn ponen en evidencia las ciencias cognitivas (MARINA, 2004). E) APRENDER A SER. Ante el siglo XXI, el desafo de la educacin no es tanto preparar a las nuevas generaciones para vivir en una sociedad determinada, sino dotar a cada persona de competencias y criterios que le permitan comprender el mundo cambiante que le rodea y comportarse solidaria y responsablemente. Ms que nunca, la funcin esencial de la educacin es proporcionar a todos los seres humanos la libertad de pensamiento, sentimiento, imaginacin y creatividad que necesitan para dar sentido a su vida y alcanzar las cotas ms altas posibles de bienestar y felicidad. La educacin es un viaje interior desde el nacer hasta el morir. El desarrollo del ser humano se ha de dar en todas las potencialidades personales, intelectuales, efectivas, morales, estticas, sociales, etc.; en todos los contextos, de familia, trabajo, ocio, etc.; y a lo largo de todas las etapas del ciclo vital. Tal concepto de educacin cuestiona la distincin tradicional entre educacin bsica y educacin permanente o de adultos, entendida sta como nivelacin, perfeccionamiento, promocin o reconversin profesional. La meta deseable de dar ms aos a la vida y ms vida a los aos conlleva una disponibilidad educativa constante, tanto si se trata de brindar nuevas posibilidades educativas, perfeccionar o ampliar la formacin profesional, como de satisfacer el deseo de saber, de belleza, de superacin personal y autorrealizacin. La autoestima, la autoeficacia y experiencias de control sobre el medio, el optimismo, la solidaridad conllevan una vida ms feliz (BANDURA, 1999; SELIGMAN, 1998, 1999). F) APRENDER SOBRE EL CONOCER, QUERER Y SENTIR (TEORA DE LA MENTE). Resulta cuando menos extrao que las personas tengan que conocer tantas cosas sobre el mundo natural y sociocultural (matemticas, fsica, qumica, biologa, historia, sociologa, economa, etc.) y apenas reciban conocimientos sobre s mismos, sobre sus pensamientos y sentimientos, sobre su mente y la mente de los dems, cuando por otra parte estn muy interesados. En las relaciones interpersonales continuamente interpretamos el comportamiento del otro, suponiendo que tiene estados mentales, como opiniones, creencias, deseos, intenciones, intereses, sentimientos. Cuando alguien hace algo pensamos que tal conducta se debe a determinados pensamientos, sentimientos o deseos que tiene en su cabeza. Los seres humanos tenemos una teora de las mentes ajenas que nos permite naturalmente atribuir estados mentales a los dems y a nosotros mismos. Somos animales mentalistas. Esta capacidad cognitivasocial del ser humano resulta clave para comprender la comunicacin interpersonal y la interaccin social en las situaciones educativas (WHITEN, 1991; RIVIERE & NEZ, 1996; GMEZ, 2007; GARCA GARCA, 2001, 2008; JACOBONI, 2009). Los conocimientos, las teoras que de la mente se tengan no es una cuestin meramente terica, sino de extraordinaria relevancia prctica, especialmente en aquellas profesiones (las ms en nuestra sociedad de conocimientos y servicios) que tienen que ver con otras personas y sus comportamientos, y por tanto sus pensamientos, sentimientos y motivaciones. Profesores, psiclogos, pedagogos, socilogos,

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

33

Emilio Garca Garca

antroplogos, trabajadores sociales, etc. perciben, enjuician, valoran y actan en su prctica profesional desde la teora de la mente, que ms o menos explcitamente sostienen. La teora de la mente constituye en la actualidad un dominio de investigacin en el que confluyen diversas ciencias cognitivas, y que est proporcionando resultados sorprendentes y de extraordinaria relevancia terica y aplicada. La mente, entendida como un sistema de representaciones, conocimientos e inferencias, merece el calificativo de teora (Teora de la Mente) puesto que no es directamente observable y sirve para predecir y modificar el comportamiento. En cierta medida se puede comparar con los conceptos y teoras que los cientficos emplean para explicar, predecir y modificar la realidad que estudian. Las teoras de los cientficos tampoco son observables. Atribuir mente a otro es una actividad terica, pues no podemos observar su mente, pero a partir de esa atribucin interpretamos sus pensamientos y sentimientos y podemos actuar con l adecuadamente. El cerebro dispone de redes neurales especializadas que nos permiten crear ingeniosas hiptesis sobre cmo opera la mente de otras personas. A partir de estas hiptesis anticipamos y predecimos con acierto las conductas de los dems. Esta capacidad de mentalizacin con una base neuronal determinada se considera de carcter modular, similar a la capacidad lingstica, numrica o espacial. Se han caracterizado estas capacidades bsicas como conocimientos nucleares, que subyacen a todo cuanto aprendemos a lo largo de la vida y nos identifican como miembros de una especie. Son universales cognitivos con los que venimos al mundo, y se basan en mdulos o sistemas neuronales, congnitamente dispuestos para formar representaciones mentales de los objetos, las personas, el lenguaje, las matemticas y las relaciones espaciales (DEHAENE, 1998; PINKER, 2000, 2002; CHOMSKY, 2003; SPELKE, 2005). La Teora de la Mente o la capacidad mentalista es condicin necesaria en los procesos de enseanzaaprendizaje. En la enseanza tenemos un objetivo: cambiar la mente del otro, sus pensamientos, sentimientos y comportamientos; procuramos transmitir algo que consideramos valioso y de modo que el alumno lo pueda asimilar. Y para ello el profesor tiene que ponerse en la mente del alumno, inferir su nivel de conocimientos, sus preocupaciones e intereses, suponer lo que el alumno ya sabe, y lo que quiz desee saber. En la enseanza ponemos en juego un conjunto de estrategias para lograr una comunicacin eficaz: queremos llamar la atencin del alumno en nuestro mensaje, porque lo consideramos importante; utilizamos variados recursos para hacerlo de forma interesante; sobre la marcha continuamente hacemos inferencias sobre si entienden e interesa; introducimos modificaciones en el curso de la accin para mejorarla; nos sentimos ms o menos satisfechos con lo realizado. La capacidad para interpretar adecuadamente la mente del alumno y actuar en consecuencia resulta esencial en la tarea de profesor.

Exigencias conflictivas y competencias demandadas


La educacin en la sociedad actual est en el centro de las polmicas. No hay el deseado consenso en ninguno de los componentes del currculo: Para qu educar? Los fines y metas de la educacin; Qu ensearaprender? Los contenidos curriculares, extensin, profundidad; Cmo ensear aprender? Aspectos metodolgicos y didcticos; Para qu y cmo evaluar? Los objetivos, criterios y procedimientos de la evaluacin. El debate permanente, ms o menos tenso segn circunstancias, de la educacin y sus funciones, conlleva el cuestionamiento del status y funcin del profesor, la consideracin social del mismo, la autoestima personal, la desvaloracin de las competencias profesionales. La profesin docente est profundamente afectada por los cambios cientficos, tecnolgicos, econmicos, sociales, polticos y culturales habidos en la sociedad. Las crticas a la educacin y a la funcin del profesor son una expresin de la puesta en cuestin de la sociedad y cultura contempornea. A la escuela se le exige hoy demandas encontradas y crecientes por parte de los alumnos, las familias, las fuerzas sociales, la administracin. El profesor se encuentra en el centro del conflicto ante exigencias cada vez mayores y conflictivas, hasta el punto de vivir situacin de alto riesgo, con consecuencias para su salud. Ha de ser transmisor y a la vez crtico de la cultura ante las nuevas generaciones. Ha de ensear a pensar, a decidir, a disfrutar del ocio, a cuidar de la salud, a respetar el medio natural y el patrimonio sociocultural, a ser solidario con los dems, y tantas demandas como deficiencias y conflictos surgen en la sociedad. Se le pide integrar en la sociedad al alumno como miembro comprometido y responsable, pero se le presenta una sociedad en continua crisis econmicosocial, con paro, competitividad, injusticia y marginacin. Se le pide una relacin personal con el alumno, un trabajo en equipo, y a la vez que promueva la calidad, la excelencia, la evaluacin individualizada y competitiva. Se pretende un profesor agente compensador de las

34 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

desigualdades sociales y de las deficiencias personales, al integrar a alumnos con necesidades educativas especiales en una escuela inclusiva, y al mismo tiempo se le demanda nfasis en los aprendizajes de contenidos disciplinares. No resulta fcil armonizar los valores de integracin, igualdad de oportunidades y equidad con las exigencias de eficacia, eficiencia, calidad y excelencia. En los ltimos aos, la investigacin y publicaciones en educacin han puesto especial nfasis en el concepto de competencia. Podemos caracterizar las competencias como el conjunto de habilidades y destrezas necesarias para realizar un trabajo, en un contexto laboral determinado. La identificacin de las competencias en la formacin y seleccin de profesionales se extendi al mbito educativo, tanto de profesores como de alumnos. As el diseo y desarrollo de las reformas de planes de estudio, desde la Educacin Infantil hasta la Universidad, est pivotando en la actualidad sobre el concepto de competencia. La OCDE entiende las competencias como las capacidades para responder a demandas complejas y llevar a cabo tareas diversas de forma adecuada, supone una combinacin de habilidades prcticas, conocimientos, motivacin, valores, actitudes, emociones y otros componentes sociales y de comportamiento que se movilizan conjuntamente para lograr una accin eficaz. Sobre los nuevos retos educativos en el Espacio Europeo de Educacin Superior se han publicado interesantes monogrficos en la Revista Interuniversitaria de Formacin de Profesorado (RIFOP, 2003, 2004, 2006, 2008). Los estudios y publicaciones y la legislacin de la OCDE, la Unin Europea, UNESCO y Organizaciones Iberoamericanas proponen las competencias como componente nuclear de los procesos de aprendizaje de los alumnos, la formacin del profesor, diseo de los currculos y evaluacin de la calidad de las instituciones. Hasta el extremo que se llegan a utilizar las competencias como frmula mgica para resolver todo tipo de problemas. En Espaa estamos inmersos en esta dinmica, desde la reformas en los niveles ms bsicos (Ley Orgnica de la Educacin), hasta el diseo de las nuevas titulaciones universitarias en el marco del Espacio Europeo de Educacin Superior (TUNING, 2003; TTULO DE GRADO MAGISTERIO, 2005; TUNING AMRICA LATINA, 20042007; UNESCO, 2009; CINDA, 2009). El Proyecto Tuning se ha elaborado con una metodologa basada en cuatro ejes: 1. Competencias genricas; 2. Competencias especficas; 3. Papel del sistema ECTS en el currculo; 4. La funcin del aprendizaje, la docencia, la evaluacin y el rendimiento en relacin con el aseguramiento y evaluacin de la calidad. El objetivo ms general del Proyecto Tuning es servir de plataforma para el intercambio de experiencias y conocimientos entre pases e instituciones de educacin superior, con el fin de facilitar una mayor transparencia de las estructuras educativas, impulsando la innovacin y la calidad. El Proyecto TuningAmrica Latina (2004/2007) tambin procura y promueve la bsqueda de puntos comunes de referencia, centrndose en las competencias. Tuning busca impulsar consensos a escala regional sobre la manera como se entienden los ttulos, desde el punto de vista de las competencias que los poseedores de dichos ttulos seran capaces de alcanzar. El Informe Tuning (2003) diferencia tres grandes mbitos de competencias o destrezas: a) conocer o comprender: el conocimiento terico de un campo acadmico, la capacidad de conocer y comprender; b) saber cmo actuar: la aplicacin practica y operativa del conocimiento a ciertas situaciones; c) saber cmo ser: los valores como parte integrante de la forma de percibir a los otros y vivir en un contexto social. Las competencias representan una combinacin de atributos (con respecto al conocimiento y sus aplicaciones, aptitudes, destrezas y responsabilidades) que describen el nivel o grado de suficiencia con que una persona es capaz de desempear un trabajo. El concepto de competencia hace referencia a las capacidades, aptitudes, destrezas, recursos que permiten a una persona realizar una accin, una tarea o un producto. Poseer una competencia significa que una persona, al manifestar una cierta capacidad o destreza al desempear una tarea, puede demostrar que la realiza de manera tal que permita evaluar el grado de realizacin de la misma. Las competencias se sitan en un continuo y cada persona puede dominar unas u otras (ARGUELLES, 1997; LEVYLEBOYER, 2000). El Proyecto Tuning analiza dos conjuntos de competencias, las genricas y las especficas. Las competencias especficas se relacionan con cada rea temtica y resultan claves para cada titulacin universitaria, ya que estn especficamente relacionadas con el conocimiento concreto de un rea temtica. Son pues las competencias relacionadas con las disciplinas acadmicas y son las que confieren identidad y consistencia a cualquier programa. Las competencias genricas son las que se consideran que cualquier estudiante universitario debe adquirir por el hecho de pasar por una Universidad. Son aquellas que cualquier titulacin debe proporcionar, tales como capacidad de aprender, de anlisis y sntesis, etc. El Proyecto Tuning limita el estudio a 30 competencias genricas clasificadas en tres grupos:

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

35

Emilio Garca Garca

a) Competencias instrumentales, que incluyen destrezas cognitivas, como la capacidad de comprender y manipular ideas y pensamientos; capacidades metodolgicas como tomar decisiones y resolver problemas: capacidades tecnolgicas como la capacidad de manejar ordenadores; y capacidad lingstica, como comunicacin oral y escrita o conocimiento de una lengua. b) Competencias interpersonales: capacidades individuales relativas a la capacidad de expresar los propios sentimientos, habilidades crticas y de autocrtica. Destrezas sociales relacionadas con las relaciones interpersonales, la capacidad de trabajar en equipo, el compromiso social y tico. Estas competencias facilitan la interaccin y cooperacin social. c) Competencias sistmicas: son las destrezas y habilidades que conciernen a los sistemas como totalidad. Suponen una combinacin de la comprensin, la sensibilidad y el conocimiento que permiten al individuo ver cmo las partes de un todo se relacionan y agrupan. Estas capacidades incluyen la habilidad de planificar cambios para mejorar e innovar los sistemas. Las competencias sistmicas requieren como base la adquisicin previa de competencias instrumentales e interpersonales. Las competencias no deben quedar acotadas a las demandas econmicas y sociales del momento, sino que se ha de promover la reflexin crtica sobre lo dado, y las alternativas de mejora. La Universidad tiene como dimensin esencial la crtica de la cultura y la propuesta razonada y razonable de proyectos alternativos. Los estudiantes exigen cualificaciones idneas para el mercado laboral, pero la Universidad no puede quedar reducida a satisfacer las demandas del mercado y los intereses de grupos sociales y profesionales. El Proyecto Tuning ha consultado a graduados, empleadores y acadmicos respecto a las competencias genricas requeridas en la sociedad del conocimiento, y es de destacar los acuerdos y tambin las discrepancias en las ponderaciones de unos y otros, como se puede visualizar en la tabla 1. Hay que notar que en lneas generales se valoran como competencias ms importantes: la capacidad de anlisis y sntesis: el puesto 1 de 30 para los graduados, 3 de 30 para los empleadores y 2 de 17 para los profesores; la capacidad de aprender: el puesto 3 de 30 para los graduados, 1 de 30 para los empleadores y 3 de 17 para los profesores; la capacidad de resolver problemas: el puesto 2 de 30 para los graduados y 4 de 30 para los empleadores; la capacidad para aplicar conocimientos en la prctica; la capacidad para adaptarse a nuevas situaciones; la preocupacin por la calidad; las habilidades de gestin de la informacin; la capacidad para trabajar de forma autnoma; y el trabajo en equipo. En el otro extremo, entre las competencias menos valoradas estn: conocimientos de culturas y costumbres de otros pases: el puesto 30 de 30 para los graduados, 30 de 30 para los empleadores; apreciacin de la diversidad y multiculturalidad: el puesto 29 de 30 para los graduados, 28 de 30 para los empleadores y 17 de 17 para los profesores; habilidad para trabajar en un contexto internacional: el puesto 26 de 30 para los graduados y 27 de 30 para los empleadores; liderazgo: el puesto 27 de 30 para los graduados y 25 de 30 para los empleadores; habilidades de investigacin: el puesto 25 de 30 para los graduados, 29 de 30 para los empleadores y 11 de 17 para los profesores; y conocimiento de una segunda lengua: el puesto 24 de 30 para los graduados y 26 de 30 para los empleadores. Destacamos la baja valoracin que merece el compromiso tico: el puesto 28 de 30 para los graduados, el 22 de 30 para los empleadores y 13 de 17 para los profesores. La discrepancia en las apreciaciones entre los tres grupos (acadmicos, graduados y empleadores) especialmente est en la competencia de conocimientos generales bsicos, que para graduados y empleadores est entre los niveles 20 y 21, mientras que para los acadmicos aparece en primer lugar. Las competencias en la computacin son consideradas ms importantes por los graduados, el puesto 7 de 30, menos por los empleadores y profesores, 17 y 16. Las destrezas interpersonales, en general tienden a ser clasificadas ms bajas por los acadmicos que por los graduados y empleadores. La mayora de las competencias que aparecen en la posicin ms alta de la escala son las instrumentales y las sistmicas.

36 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

COMPETENCIAS GENRICAS del estudiante universitario Capacidad de anlisis y sntesis Planificacin y gestin del tiempo INSTRUMENTALES Conocimientos generales sobre el rea de estudio Conocimientos bsicos de la profesin Comunicacin oral y escrita en la propia lengua Conocimiento de una segunda lengua Habilidades bsicas de manejo de ordenador Habilidades de gestin de la informacin Resolucin de problemas Toma de decisiones Capacidad crtica y autocrtica INTERPERSONALES Trabajo en equipo Habilidades interpersonales Capacidad de trabajar en equipo interdisciplinario Capacidad para comunicarse con personas no expertas Apreciacin de diversidad y multiculturalidad Habilidad de trabajar en un contexto internacional Compromiso tico Capacidad de aplicar conocimientos en la prctica Habilidades de investigacin Capacidad de aprender Capacidad para adaptarse a nuevas situaciones SISTEMICAS Capacidad para generar nuevas ideas. Creatividad Liderazgo Conocimiento de culturas y costumbres de otros pases Habilidad para trabajar de forma autnoma Diseo y gestin de proyectos Iniciativa y espritu emprendedor Preocupacin por la calidad Motivacin de logro

Orden de importancia Graduados 1/30 10/30 20/30 19/30 12/30 24/30 7/30 5/30 2/30 15/30 17/30 14/30 9/30 21/30 18/30 29/30 26/30 28/30 6/30 25/30 3/30 8/30 16/30 27/30 30/30 4/30 23/30 22/30 11/30 13/30 Empleadores 3/30 13/30 21730 23/30 11/30 26/30 17/30 8/30 4/30 15/30 16/30 6/30 9/30 18/30 20/30 28/30 27/30 22/30 2/30 29/30 1/30 7/30 10/30 25/30 30/30 12/30 24/30 19/30 5/30 14/30 16/17 12/17 6/17 14/17 10/17 17/17 13/17 5/17 11/17 3/17 7/17 4/17 Profesores 2/17 1/17 8/17 9717

TABLA 1. Competencias Genricas del estudiante universitario. Valoracin por titulados, empleadores y profesores universitarios.

Equilibrio emocional y responsabilidad moral


En los procesos de reforma de la educacin, es muy frecuente concentrar inters y recursos en reformar los planes de estudio, entendiendo por tal las asignaturas a impartir en el currculo, los programas y la seleccin de los contenidos, dada la acumulacin progresiva de los conocimientos. Pero en los procesos de enseanzaaprendizaje, adems de los contenidos, no es menos importante la forma de ensearlos y aprenderlos, los procedimientos y la metodologa. Estas formas de aprender son estrechamente dependientes de las formas de evaluar. Este saber cmo o conocimiento procedimental es tan necesario cmo el saber qu o conocimiento declarativo, especialmente en la vida profesional y personal. Los profesores dedicamos gran parte de nuestro tiempo y energa a ampliar nuestros conocimientos de la asignatura para estar al da, a preparar las clases. Cada curso procuramos mejorar los materiales, esquemas, grficos, problemas, incluso organizamos seminarios, grupos de discusin, sesiones interactivas, estudios de casos, etc. Procuramos suscitar y mantener la atencin e inters de

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

37

Emilio Garca Garca

nuestros alumnos en la clase, lamentamos que tras tanta inversin en tiempo y recursos a la tarea docente los resultados sean tan limitados. Seguimos instalados en los supuestos tradicionales de que basta con ensear bien los contenidos para que el alumno los aprenda. Pero el alumno aprende cuando la informacin le interesa, es significativa cognitiva y emocionalmente, conecta con preocupaciones personales o profesionales, con las demandas de la realidad fuera del aula, y se compromete con su propio proceso de formacin. Las competencias para un aprendizaje autnomo y continuo a lo largo de la vida es un tipo de aprendizaje procedimental que exige prctica y no slo clases magistrales de conocimiento declarativo. El objetivo prioritario de la educacin debe ser capacitar a sus alumnos para el mayor desarrollo personal y ello requiere conocimientos, sentimientos y comportamientos responsables y solidarios. Los conocimientos y procedimientos, las memorias declarativas y procedimentales que un profesor tiene sobre su especialidad no se transfiere a la mente de sus alumnos con solo explicarlas en clase, aunque sea de la forma ms atractiva y estimulante imaginable. El estudiante aprender si asimila los conocimientos, los hace suyos, los integra, los experimenta relevantes en su vida personal y profesional, los utiliza para identificar y resolver problemas. La profesin de profesor exige, segn hemos comentado, conocimientos de distintas ciencias y saberes, adems de un dominio en habilidades y tcnicas para ensear lo que se sabe. Pero ser profesor requiere unas competencias o disposiciones ms bsicas o fundamentales: valores, actitudes y aptitudes necesarias para potenciar el desarrollo personal de los alumnos. Y el desarrollo personal de los alumnos es un desarrollo integral, por cuanto comprende un desarrollo moral, adems de desarrollo cognitivo, afectivo y social. Para propiciar tal desarrollo en los alumnos es preciso que el profesor cuide especialmente su desarrollo personal, su equilibrio emocional y su integridad moral (CARR, 2005). No hay acuerdo en los investigadores en cuanto a la calificacin como competencias de estas disposiciones bsicas del profesor. Para unos, el desarrollo personal, equilibrio emocional y responsabilidad moral son las competencias fundamentales de los profesores, sobre las que se articulan todas las dems competencias. Desde otros planteamientos se opta por considerarlas como disposiciones bsicas, rasgos de carcter y personalidad, absolutamente prioritarias en el buen profesor, pero que no se deben considerar estrictamente como competencias (MARCHESI, 2007). Procurar el propio equilibrio emocional, bienestar, la satisfaccin con la profesin, incluso la felicidad, es condicin vital para el profesor. Hemos comentado pginas atrs lo difcil que puede resultar, dadas las condiciones conflictivas del ejercicio profesional y las mltiples causas de malestar para el docente. Pero si el profesor est comprometido en promover el desarrollo personal de los alumnos, ello implica tener presentes todas las dimensiones de su mente: cognitivas, emocionales y morales; es decir, el desarrollo mental y bienestar y del alumno. Tales metas solo se pueden plantear desde las mismas vivencias en el profesor. Si bien como ciudadanos tenemos derecho a verlo todo de color negro, como profesores, como educadores no nos queda ms remedio que ser optimistas. La enseanza presupone el optimismo tal y como la natacin exige un medio lquido para ejercitarse. Quien no quiera mojarse debe abandonar la natacin; quien sienta repugnancia hacia el optimismo, que deje la enseanza. Porque educar es creer en la perfectibilidad humana, en la capacidad innata de aprender y en el deseo de saber que la anima, que hay cosas como valores, smbolos, tcnicas, hechos que pueden ser sabidos y que merecen serlo, que los hombres podemos mejorarnos unos a otros por medio del conocimiento. De todas estas creencias optimistas puede uno muy bien descreer en privado, pero en cuanto intenta educar o entender en qu consiste la educacin, no queda ms remedio que aceptarlas. Con verdadero pesimismo puede escribirse contra la educacin, pero el optimismo es imprescindible para estudiarla y ejercerla (SAVATER, 1997). El objetivo principal de la educacin es promover el desarrollo personal de los alumnos, en todas sus capacidades mentales: cognitivas, afectivas, morales y sociales, en la confianza y expectativa optimista de conseguir, adems de vidas personales ms realizadas, una sociedad cada vez ms justa, solidaria y feliz. Estas metas educativas requieren necesariamente valores y actitudes personales en el profesor: satisfaccin con su quehacer, equilibrio emocional, autonoma intelectual, compromiso moral. El compromiso del profesor, su responsabilidad fundamental, est en disponer y proporcionar a todos sus alumnos los recursos y oportunidades ms idneas para que puedan asimilar los diversos tipos de aprendizajes, consciente de que el propio alumno es el responsable principal de su propia formacin. Cuando hablamos de proporcionar para todos sus alumnos las mejores condiciones y oportunidades queremos resaltar justamente la disponibilidad para todos y cada uno de los alumnos: los que van bien con los aprendizajes, y aquellos que presentan dificultades y necesitan de apoyos

38 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

especiales, bien por discapacidad mental, trastorno de conducta, dificultades de aprendizaje o estn ms desprotegidos y vulnerables en contextos familiares de riesgo o pertenecen a minoras culturales, como los inmigrantes. Cuando mencionamos los diversos tipos de aprendizajes nos referimos a los aprendizajes de los conocimientos propios de las diferentes materias y reas disciplinares; pero tambin a los aprendizajes de procedimientos y estrategias; los aprendizajes para la convivencia, para el desarrollo personal, cognitivo, afectivo, moral y social; los aprendizajes para desarrollar la autonoma y la autodisciplina y el equilibrio emocional. Lo que anteriormente sintetizamos como: aprender a conocer, querer, sentir, hacer, convivir, ser, y aprender sobre el conocer, querer y sentir. Ciertamente el profesor no tiene en exclusiva la responsabilidad de la educacin y aprendizajes de los alumnos. Est el mismo alumno con su responsabilidad ante la propia formacin, la familia, la escuela y las administraciones. Pero esta responsabilidad compartida no puede ser la excusa para que el profesor no asuma su responsabilidad intransferible y se instale en sistemas de atribucin distorsionados, segn los cuales se apropia de todos los xitos, atribuyendo los fracasos a agentes externos. La complejidad de la funcin docente supone un gran esfuerzo continuado, una alta inversin de recursos mentales y personales que difcilmente se ven compensados con incentivos razonables. De ah el profesor quemado, estresado, deprimido. Es preciso que el profesor se cuide a s mismo si quiere ser agente para el desarrollo de otras personas. El ajuste personal, equilibrio emocional, bienestar, son condiciones personales necesarias para una buena prctica profesional. Sentirse comprometido con un proyecto personal que se estima valioso, verse con recursos y competencias para afrontarlo, valorar logros y xitos razonables en su quehacer, son componentes de la vivencia de bienestar y hasta de felicidad, que en cierta medida y en determinados tiempos, al menos, han de estar presentes en la profesin docente. Se pueden diferenciar tres tipos de orientaciones laborales: un trabajo, una carrera y una vocacin. Un trabajo sirve para cobrar un sueldo a final de mes y es un medio para lograr otros fines. No se espera de l otro tipo de compensacin. Una carrera implica una inversin profesional ms profunda; si bien conlleva retribucin econmica, tambin implica otros incentivos y gratificaciones como estima y consideracin social, prestigio, poder. La vocacin es un compromiso apasionado con el trabajo por su vala. Las personas con vocacin consideran que su labor contribuye al bien general, algo que transciende al individuo. Tradicionalmente se ha reservado tal calificacin para profesiones como la religin, medicina, derecho y la educacin. Pero cualquier trabajo puede convertirse en una vocacin, y cualquier vocacin en un trabajo. Promover estados mentales de bienestar y felicidad es el propsito de la Psicologa Positiva, que se orienta a desarrollar las potencialidades y fortalezas humanas que nos permiten aprender, disfrutar, ser alegres, generosos, solidarios, optimistas. Seligman finaliza su libro sobre la autentica felicidad afirmando que una vida plena y significativa consiste en experimentar emociones positivas respecto al pasado y al futuro, disfrutar de los sentimientos positivos procedentes de los placeres, obtener numerosas gratificaciones de nuestras fortalezas caractersticas y utilizar stas al servicio de algo ms elevado que nosotros mismos para encontrar as un sentido a la existencia (CSIKSZENTMIHALYI, 1998; SELIGMAN, 2003). Un buen profesor, un profesor competente ha de disfrutar de una relativa satisfaccin con y en su profesin. No es posible aspirar a una educacin de calidad sin un estado de razonable bienestar personal. Estas vivencias y sentimientos positivos de equilibrio, de flujo, de felicidad dependen de mltiples variables intra y extraprofesionales. Juegan un papel crtico las experiencias vividas en otros contextos como el familiar, econmico, social, amistad, ocio; los proyectos de vida, los valores y metas; la personalidad del profesor. Est tambin el momento en su ciclo vital y profesional, desde los aos de antigedad hasta las condiciones de salud. En ocasiones las emociones negativas, las frustraciones acumuladas, los fracasos y desilusiones, tanto en la vida profesional como en la personal, apenas obstaculizan la razonable satisfaccin en la actividad docente; como si el profesor hubiera sido capaz de elaborar una coraza protectora ante las condiciones tan adversas, y pudiera desarrollar una adaptacin positiva a pesar del contexto de riesgo en el que se desenvuelve. El profesor sigue animoso, comprometido. Otros profesores, por el contrario, se desaniman, se desmoralizan, se vienen abajo, incapaces de afrontar con expectativas de xito las condiciones conflictivas de su quehacer profesional. Tambin en estos casos las variables extra profesionales estn muy presentes.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

39

Emilio Garca Garca

Conclusin
En nuestra sociedad, en tiempos de agobios y crisis, pararse a pensar, a reflexionar, es un buen procedimiento para desarrollar estrategias protectoras que posibiliten mantener el nimo y la moral en la tarea de educar. As mismo, mantener las relaciones positivas con amigos y compaeros; implicarse en proyectos de formacin, innovacin e investigacin, al menos en algunas etapas de nuestra vida; cuidar la propia salud y bienestar frente a riesgos y amenazas varias; descubrir algunos momentos de plenitud en nuestra vida, tambin en la profesional, es el mejor seguro contra la apata y el malestar, y condicin necesaria para aspirar a una educacin de calidad, que promueva el desarrollo personal de nuestros alumnos en una sociedad cada vez ms justa, libre y feliz.

Referencias bibliogrficas
APPLE, M. (1986). Ideologa y curriculum. Madrid: Akal. APPLE, M. (1989). Maestro y textos. Madrid: Paidos. ARGUELLES, A. (1997). Formacin basada en competencias laborales. Mexico: Limusa. BANDURA, A. (1999) Autoeficacia. Cmo afrontamos los cambios en la sociedad actual. Bilbao: Desclee de Brouwer. BURBULES, N. & DESMORE, R (1992). Los limites de la profesionalizacin de la docencia. Educacin y Sociedad 11, 6773. CARR, D. (2005). El sentido de la educacin. Una introduccin a la filosofa y teora de la educacin y de la enseanza. Barcelona: Grao. CHOMSKY, N. (2003). On nature and language. Cambridge: University Press. CINDA (2009) Diseo curricular basado en competencias y aseguramiento de la calidad. Santiago de Chile. En http://aula.virtual.ucv.cl/aula_virtual/cinda/cdlibros/ CSIKSZENTMIHALYI, M. (1998). Aprender a fluir. Barcelona: Kairs. DEHAENE, S. (1998). The number sense. How the mind creates mathematics. London: Penguin. DELORS, J. (1996). La educacin encierra un tesoro. Madrid: Santillana. FERNNDEZ PREZ, M. (1988). La profesionalizacin del docente. Madrid: Escuela Espaola. GARCA GARCA, E. (1996). Estrs, profesin docente y personalidad del docente. Ansiedad y Estrs. 2 (2 3), 245260. GARCA GARCA, E. (2001). Mente y cerebro. Madrid: Sntesis. GARCA GARCA, E. (2006). Las competencias del profesor en la sociedad del conocimiento. En R. MEJA (Coord.), Educacin, Globalizacin y Desarrollo Humano. Santo Domingo, RD: Buho, 109151. GARCIA GARCIA, E. (2008). Neuropsicologa y educacin. De las Neuronas Espejo a la Teoria de la Mente. Revista de Psicologa y Educacin, 3 (1), 6989. GARCA GARCA, E. (2009). Identidad profesional y responsabilidad moral del profesor. En M. MACEIRAS & R. MEJA (coord.). Investigacin e innovacin. Salamanca: San Esteban, 3168. GARDNER, H. (2000). La educacin de la mente y el conocimiento de las disciplinas. Barcelona: Paidos. GIROUX, H. (1987). La formacin del profesorado y la ideologa del control social. Revista de Educacin. 284, 5376. GMEZ, C. (2007). El desarrollo de la mente en los simios, los monos y los nios. Madrid: Morata. HARGREAVES, A. (1996). Profesorado, cultura y posmodernidad. Madrid: Morata. HARGREAVES, A. (2003). Teaching in the knowledge society. Berkshire: Open University Press. HARGREAVES, A. & FULLAN, M. (1992). Understanding teacher development. Londres: Casell. HOYLE, E. (1974). Professionality, professionalism and control in teaching. London Educatonal Review. 3, 1219.

40 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

Competencias ticas del profesor y calidad de la educacin

IMBERNON, F. (1994). La formacin y el desarrollo profesional del profesor. Barcelona: Grao. JACOBONI, M. (2009). Las neuronas espejo. Buenos Aires: Katz. KEMMIS, S. (1988). El curriculum ms all de la teora de la reproduccin. Madrid: Morata. LEVYLEBOYER, C. (2000). Gestin de competencias. Barcelona: Gestin. MARCHESI, A. (2007). Sobre el bienestar de los docentes. Madrid: Alianza. MARCHESI, A. & MARTIN, E. (2000). Calidad de la enseanza en tiempos de cambio. Madrid: Alianza. MARINA, J. A. (2004). Aprender a vivir. Barcelona: Ariel. ORTEGA, F. & VARELA, A. (1991). La profesin de maestro. Madrid: CIDE. PINKER, S. (2000). Como trabaja la mente. Barcelona: Destino. PINKER, S. (2002). The blank Slate. New York: Viking. RIFOP (2003). El reto del Espacio Europeo de Educacin Superior. Revista Interuniversitaria de formacin del Profesorado 49 (18,1). RIFOP (2004). La universidad de la convergencia. Una mirada crtica. Revista Interuniversitaria de formacin del Profesorado. 51 (18,3). RIFOP (2006). Los nuevos retos metodolgicos y educativos de la universidad de la convergencia. Revista Interuniversitaria de formacin del Profesorado 57 (20,3). RIFOP (2008). La tutora universitaria en el marco de la convergencia. Revista Interuniversitaria de formacin del Profesorado 61 (22,1). RIVIERE, A. & NEZ, M. (1996). La mirada mental. Buenos Aires: Aique. SAVATER, F. (1997). El valor de educar. Barcelona: Ariel. SCHON, D. (1992). La formacin de profesionales reflexivos. Madrid: PaidosMEC. SELIGMAN, M. (1998). Aprenda optimismo. Barcelona: Grijalbo. SELIGMAN, M. (1999). Nios optimistas. Barcelona: Grijalbo. SELIGMAN, M. (2003). La autntica felicidad. Barcelona: Vergara. SPELKE, E. ET AL. (2005). Number sense in human infants. Developmental Science, 8, 88102. STENHOUSE, L. (1982). Investigacin y desarrollo del curriculum. Madrid: Morata. STENHOUSE, L. (1987). La investigacin como base de la enseanza. Madrid: Morata. TITULO DE GRADO MAGISTERIO. LIBRO BLANCO (2005). Madrid: ANECA. TUNING EDUCATIONAL STRUCTURES IN EUROPE (2003). Informe final. Fase I. Bilbao: Universidad de Deusto. TUNING AMRICA LATINA (20042007). Reflexiones y perspectivas de la Educacin Superior en Amrica Latina, Informe final del Proyecto Tuning Amrica Latina 20042007. Bilbao: Universidad de DeustoUniversidad de Groningen. UNESCO (2009). World Conference on Higher Education. The New Dynamics of Higher Education and Research for Social Change and Development. Paris: Unesco, En: http://www.unesco.org/ education/WCHE2009/comunicado_es.pdf. WHITEN, A. (1991). Natural Theories of Mind. Oxford: Blackwell.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 2941

41

REFERENCIA: Larrosa Martnez, Faustino (2010). Vocacin docente versus profesin docente en las organizaciones educativas. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmm aa):)

Vocacin docente versus profesin docente en las organizaciones educativas


FaustinoLARROSAMARTNEZ

Correspondencia: FaustinoLarrosaMartnez Correoelectrnico: faustino.larrosa@ua.es Telfono: 636441183 Direccinpostal: UniversidaddeAlicante DepartamentodePsicologa EvolutivayDidctica RamblaMndezNez48,8D 03002Alicante Recibido:18dediciembrede2009 Aceptado:18deoctubrede2010

RESUMEN
El trabajo que presentamos, circunscrito a la formacin de los futuros maestros, indaga el sentido de la vocacin y profesin docentes en el seno de las organizaciones educativas,enelcontextodelasociedaddelconocimientoy enplenaconvergenciaeuropea.Partimosdelanlisisdelos elementos que han influido y estn influyendo en la situacin profesional del profesorado: la tradicin, las transformacionessociales,losavancesdelainvestigaciny las necesidades de los maestros. A continuacin se estudia la evolucin de la actividad docente como vocacin y se examinan las notas propias de la actividad docente como profesin. Concluimos afirmando que la enseanza es una profesinconvocacinenunambientedepluralismotico ymoral.

PALABRAS CLAVE: Profesin docente, Formacin de profesores,Condicionesdetrabajodelprofesor.

Teaching vocation versus teaching profession in educational organisations


ABSTRACT
Thispaperontrainingprospectiveteachersinvestigatesthemeaningofteachingvocationandteaching professionwithineducationalorganisations,inthecontextoftheknowledgesocietyandinthemidstof European convergence. The elements that have influenced and still influence teachers professional situations are analysed: tradition, social transformation, advances in research and teachers current needs. Then how teaching has evolved as a vocation is studied and the nature and characteristics of teaching as a profession are examined. We conclude that teaching is a vocational profession in an environmentofethicalandmoralpluralism.

KEY WORDS: Teachingprofession,Teachertraining,Teachers'workingconditions.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

43

Faustino Larrosa Martnez

Introduccin
Tradicionalmente la vocacin ha estado indisolublemente unida al maestro y el ensear se ha considerado un arte. Estas dos ideas, que gozaron de unanimidad durante mucho tiempo y que permanecen todava en la mente de muchas personas, han evolucionado obligatoriamente con los cambios sociales. En el estudio de la vocacin docente versus profesin se entremezclan dialcticamente elementos que han influido y estn influyendo en el quehacer profesional del profesorado: la tradicin, las transformaciones sociales, los avances de la investigacin y las necesidades del profesorado. El tema no podemos considerarlo menor en la formacin del profesorado porque ha sido ampliamente tratado en todas las pocas. Hoy tiene un inters especial por las condiciones estructurales que actualmente afectan a la enseanza universitaria y a la organizacin de los centros educativos: implantacin de nuevos planes de estudio para el ejercicio de la profesin de Maestro en el Espacio Europeo de Educacin Superior, la cultura profesional que se gesta al compartir obligaciones y derechos educativos con otras instancias y agentes, la evolucin de las escuelas hacia organizaciones comprometidas con el aprendizaje (BOLVAR, 2000) y la irrupcin de la sociedad del conocimiento o del aprendizaje del pensar, del aprender y de la innovacin (HARGREAVES, 2003). Esta coyuntura nos obliga a reflexionar acerca del mensaje que transmitimos a los futuros docentes sobre el valor de la vocacin y la profesin en el nuevo escenario de competencias profesionales, entre las que destacamos: Comprender la funcin, posibilidades y lmites de la educacin en la sociedad actual... (rdenes ECI/3854/2007 y ECI/3857/2007). Con esta investigacin pretendemos: a) b) Estudiar la evolucin del concepto vocacin y los rasgos distintivos de la profesin docente. Conocer el sentido que tienen la vocacin y la profesin en las organizaciones educativas que aprenden en el marco de la sociedad del conocimiento y la convergencia europea.

Son muchos los que subrayan la importancia de la vocacin en cualquier actividad profesional, tanto por razones de un mayor rendimiento en el trabajo como para evitar fracasos personales en el desempeo. Creen que la vocacin determina las personas ms adecuadas para una profesin y que existe la profesin ms conveniente para cada persona. Del mismo modo, para acceder a una profesin se deben poseer unas cualidades o aptitudes previas y en la eleccin de un trabajo hay que tener en cuenta la vocacin. Slo se es un verdadero profesional cuando se tiene vocacin (GICHURE, 1995: 210). En el caso de la enseanza es evidente que se necesitan determinadas competencias para desempearla con correccin y que no todas las personas estn capacitadas para ejercer estas funciones. Garca Garrido (1999: 436) resalta que no todo el mundo sirve para esta profesin, en contra de lo que tan a menudo se cree; hace falta tener el perfil personal adecuado. Aunque, ciertamente, tendramos que aadir que el perfil docente demandado est al alcance de todos los que deseen dedicarse al magisterio con voluntad, conocimiento y desempeo tico. Y aunque la vocacin influya en el rendimiento y satisfaccin laboral, no puede deducirse que su ausencia sea la causa directa del fracaso de la escuela, porque en el sistema educativo existen otros factores ms influyentes en los aprendizajes deficientes, la insatisfaccin o el absentismo escolar. Adems no slo se nace con vocacin, sino que hasta se puede perder cuando se idealiza desmesuradamente la docencia. Marchesi Ullastres & Daz Fouz (2007) analizan las opiniones de los futuros docentes de Primaria y Secundaria. En la definicin de la enseanza, el 43,9% considera que es una profesin (en primer lugar) y el 2,.4% un arte (en segundo lugar). En dicho estudio, el 90,2% de los encuestados afirma que para ser docente hace falta tener vocacin (los docentes en activo son el 90,7%). Marchesi (2007: 52) presenta los resultados de una encuesta que refleja los cambios que se producen a lo largo de la vida profesional de un docente. En la opcin Quise ser maestro o profesor porque tena vocacin, las respuestas de acuerdo o muy de acuerdo siguen la siguiente evolucin segn los aos de experiencia: menos de 3 aos =49,4%; entre 3 y 10=44,4%; entre 10 y 20=37,7%; entre 20 y 30=34,2% y ms de 30 de experiencia =38,2%. Sin embargo, en esta misma encuesta es llamativo que la tendencia se invierta cuando se pregunta Un buen profesor debe comportarse en la vida de acuerdo con los valores que ensea a los alumnos. Las respuestas de acuerdo o muy de acuerdo contrasta con la anterior: menos de 3 aos de experiencia =58,4%; entre 3 y 10=63%; entre 10 y 20=66,4%; entre 20 y 30=70,8% y ms de 30=79,5%. En el I Seminario Iberoamericano sobre el desarrollo profesional de los docentes, Leoncio Fernndez (2008) present el estudio La situacin de los profesores noveles 2008, referidos a Educacin Infantil, Primaria, Secundaria, centros pblicos y centros privadosconcertados, del que

44 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

Vocacin docente versus profesin docente en las organizaciones educativas

extraemos algunos datos que interesan a nuestro trabajo. El grado de acuerdo de los docentes con la afirmacin Los nuevos profesores no tienen la vocacin de antes correlaciona con la antigedad docente. Con menos de 4 aos de experiencia, estn de acuerdo o muy de acuerdo el de 10% del profesorado y en desacuerdo o muy en desacuerdo el 70,8%; entre 11 y 20 aos el 17% est de acuerdo y el 50,4% en desacuerdo, y con ms de 30 aos de experiencia el 28,5% de los docentes est de acuerdo y el 33% en desacuerdo. En relacin con el grado de satisfaccin actual de los docentes con respecto al inicio de su trabajo, los datos totales nos informan que estn igual de satisfecho el 27,7 %; mucho o algo menos satisfechos el 31,3%, y algo o mucho ms satisfechos el 40,1%. El grado de satisfaccin segn los aos de experiencia es el siguiente: con menos de 4 aos estn algo o mucho ms satisfechos el 50,1% de los docentes; entre 11 y 20 aos el 38,7%, y los que tienen ms de 30 aos de experiencia slo el 24,7% estn algo o mucho ms satisfechos. Sin embargo, cuando se pregunta Perd la ilusin con la que llegu a la enseanza slo el 7,5% est de acuerdo o muy de acuerdo, mientras que el 84% estn en desacuerdo o muy en desacuerdo (FERNNDEZ, 2008). Un estudio sobre los profesores de EGB, FP y BUP en 1992, promovido y financiado por el Gobierno de Aragn, determina que dos de cada tres profesores se dedican a la docencia porque era la profesin que les gustaba, pero slo el 55,4% de los profesores de EGB con amplia experiencia volveran a elegir esta actividad. El 28% en EGB iniciaron su profesin ilusionados, pero pasado un tiempo mostraron un cierto desencanto. Este desencanto es mayor en los centro pblicos que en los privados (PALACIN & BLANCO, 1993: 4148). Por los argumentos expuestos, no son pocos los que se han cuestionado que la vocacin sea un requisito indispensable para ser un buen profesor, y entre ellos se da una gran diversidad al encarar el quehacer educativo. Para unos es vocacin, ayuda, asistencia; para otros trabajo remunerado, una profesin ms; y para todos hacer bien el trabajo como aspiracin global compatibilizando las opciones. En opinin de Cobo Suero (2001: 128) cabe establecer diferencias entre el docente profesional y el docente vocacional en el modo de sentirse realizados. El primero se satisface con el deber cumplido, cuando consigue los fines de la actividad profesional, mientras que el segundo aadir a lo anterior la satisfaccin de haberse realizado profesionalmente. Sin pretender ensombrecer el mrito que supone ser un profesional vocacional, s diremos que este atributo ha perdido fuerza con el paso del tiempo por diversas razones que podramos sintetizar como: el uso controvertido, cuando no oportunista, que se ha hecho y la propia evolucin social que ha transformado las escuelas en organizaciones abiertas. En efecto, hemos pasado de un paisaje escolar sembrado de escuelas unitarias a principios de los aos sesenta (el sesenta por ciento de los centros escolares eran escuelas unitarias dirigidas por un maestro o maestra) a la complejidad de los centros en el momento actual, y de una tica individual a la tica del buen hacer en la organizacin, donde se adquiere una nueva cultura profesional. Estos sucesos, junto a la reestructuracin del mundo laboral, han cambiado conceptos profesionales como la vocacin, que inevitablemente deja de tener la eficacia que se le atribua en la formacin del alumnado. Ahora los docentes comparten obligaciones con otras instancias y agentes que adquieren nuevas responsabilidades y competencias en los resultados finales. Dez Hochleitner (1998: 9) considera que, en el futuro, la tarea docente se transformar en una tarea de toda la sociedad.

La vocacin en la actividad docente


La enseanza escolar, dirigida inicialmente a la educacin de las minoras selectas que en el futuro tendran responsabilidades de gobierno, siempre ha estado mediatizada por cuestiones religiosas, polticas, sociales, ideolgicas y econmicas. En un momento en el que exista consenso en lo que era una buena educacin, los fines y las propias funciones del profesorado determinaron la necesidad de disponer de docentes con una vocacin ligada a la religin catlica y controlada por eclesisticos. En ocasiones, la vocacin se una a la eficacia y a un tipo de vida ejemplar de moralidad irreprochable. Ensear a los dems es una obra de misericordia y no se entenda que alguien se dedicara a la enseanza sin sentir la necesidad de ayudar a otros. La vocacin como llamada tiene en esta poca un sentido de servicio a los dems, de dedicacin espiritual y alude a un tipo de docente sumiso, adaptativo y desinteresado por los bienes materiales. En este sentido son elocuentes las palabras de Gil de Zrate (1855: 307):

El carcter del maestro de escuela debe ser tan santo como el del mismo cura prroco. Si ste da el pasto espiritual, slo es despus que aquel ha formado el corazn y el entendimiento de la humilde criatura que se pone a sus pies para recibirlo. El primer sacerdote para el nio es el maestro: no es la iglesia, sino la
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

45

Faustino Larrosa Martnez

escuela, donde se le ensea a conocer a Dios, donde se le instruye en los misterios y preceptos de la religin, y donde aprende las oraciones que va despus a repetir en el templo.
Esta idea permaneci en los regeneracionistas espaoles de finales de siglo XIX. Francisco Giner de los Ros, uno de los fundadores de la Institucin Libre de Enseanza, consideraba que la Escuela Normal y el Seminario eran las dos grandes instituciones fundamentales de nuestra educacin y equiparaba el maestro con el sacerdocio, las dos ms grandes energas educadoras de la vida presente (GINER DE LOS ROS 1887: 19):

El maestro como el sacerdocio con el que tantos puntos de contacto tiene, sobre todo en los pueblos modernos, donde a veces comparte con l, a veces casi por completo ha absorbido el ministerio de la enseanza pblica exige en primer trmino hombres bien equilibrados, de temperamento ideal, de amor a todas las cosas grandes, de inteligencia desarrollada, de gustos sencillos y nobles, de costumbres puras, sanos de espritu y de cuerpo, y dignos en pensamiento, palabra, obra y hasta maneras, de servir a la sagrada causa cuya prosecucin se les confa.
Aunque el carcter religioso del maestro se mantuvo en la mayora de los docentes durante muchos aos, Altamira (1923: 6980), desde una ptica ms laica que convive con la apostlica, consideraba que la docencia era la profesin que ms vocacin necesitaba, pero una vocacin asistida por la satisfaccin que produce la actividad. Significaba tener fe en el esfuerzo para comunicar al alumno el entusiasmo necesario para rendir en su trabajo, moralidad para cumplir con la funcin profesional, saber cumplir con los deberes y actuar segn los derechos que le corresponda. A continuacin aada que, a veces, las faltas de los individuos no eran responsables ellos mismos, porque el decaimiento o la prdida de la vocacin naca en ocasiones de las carencias del medio, de una cooperacin insuficiente o de la falta de motivacin para desarrollar sus facultades personales. El concepto vocacin iba evolucionando y adquiriendo significados nuevos en los distintos momentos histricos de la educacin y en la legislacin pedaggica. Tras el breve parntesis de la II Repblica vendra la Ley de Educacin Primaria de 17 de julio de 1945, en la que al maestro le corresponda Estimar su vocacin como un servicio debido a Dios y a la Patria (art. 56. Tercero). La Ley de 1964, que reformaba la enseanza primaria, consideraba que el Maestro Ha de ser persona de

vocacin clara, de ejemplar conducta moral y social y ha de poseer la preparacin profesional competente y el ttulo que le acredite igualmente para el ejercicio de su profesin (art. 56). En el
actual periodo democrtico, con una interpretacin diametralmente opuesta al carcter tradicional estudiado y en consonancia con Altamira, se sigue insistiendo en la necesidad de vocacin. Las mismas leyes educativas en vigor parecen declinarse por un profesorado vocacional (LARROSA & JIMNEZ, 2006) y las conclusiones del Seminario La LOE y sus docentes: derechos y deberes (2006) insisten en la necesidad de que los docentes han de ser educadores con vocacin personal y profesional Sin embargo, en el mbito y dominio de los propios docentes nunca ha existido oposicin entre vocacin y profesin: las exigencias de una mayor vocacin siempre han procedido de las instituciones. El poder dominante ha sido el ms interesado en fomentar la vocacin como instrumento para controlar al que enseaba, lo qu enseaba y cmo lo enseaba, y para suplir carencias materiales y formales necesarias para el desempeo profesional. Este componente vocacional ha colmado, por lo tanto, las exigencias oficiales; pero la necesidad de una competente preparacin profesional, junto a unas mejores condiciones para el desarrollo adecuado de su trabajo, nunca se han separado de la vocacin y han dimanado en todos los tiempos de los mismos que practicaban el noble arte de ensear. La divergencia entre los administradores que planifican las tareas educativas y el profesorado encargado de llevarlas al aula ha sido evidente a lo largo de la historia social de la educacin. Desde el punto de vista de las transformaciones sociales, el cambio operado en el concepto de vocacin se evidencia en el incremento de las exigencias de la familia y de la sociedad con el profesorado, demandando nuevas funciones y una mayor calidad en los procesos de enseanza aprendizaje. Incluso en ocasiones se exige al profesorado que resuelva problemas para los que no tiene solucin porque le faltan medios, no est suficientemente preparado o en realidad son competencias de otras instituciones. En el caso de algunos padres, pretenden pasar de la participacin en la gestin de los centros a la intervencin en aspectos curriculares, que son privativos de los profesionales docentes. Esta situacin conflictiva se agrava porque en esta fase de renovacin profunda no ha habido consenso entre los dirigentes polticos en lo que debe ser una buena educacin, produciendo desorientacin en el profesorado y en la misma sociedad. En consecuencia, no se puede utilizar la vocacin para solicitar

46 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

Vocacin docente versus profesin docente en las organizaciones educativas

servicios que no corresponden al profesorado, declinar determinadas responsabilidades en los docentes ni acusarlos de falta de vocacin si no se consiguen los fines perseguidos. Los nuevos escenarios reclaman resituar la funcin docente con diferentes formas, responsabilidades, consideraciones y una puesta a punto de los componentes de la comunidad educativa a travs de los instrumentos organizativos que el sistema educativo ofrece (proyecto educativo de centro, programacin general anual, proyectos curriculares, programa de convivencia) y otros inditos que faciliten la tarea. Estos cambios tambin exigen del profesorado nuevas competencias que le permitan abordar la multiplicidad de situaciones no previsibles que diariamente se le presentan en el desarrollo de sus funciones y la toma de decisiones con autonoma. Los cambios que se estn

produciendo en la sociedad inciden en la demanda de una redefinicin del trabajo del profesor y seguramente de la profesin docente, de su formacin y de su desarrollo profesional (MARCELO GARCA,
2006: 20). En cualquier caso, se comprueba que la vocacin no suple la preparacin profesional que hoy necesitan los docentes, lo que planteara el falso dilema de qu es ms importante: la vocacin o la formacin. Los avances de determinadas investigaciones educativas proponen lneas de actuacin docente que no tienen aplicacin prctica en el contexto de nuestros centros educativos, porque el desarrollo de la investigacin no va paralelo a la formacin del profesorado, la dotacin de los centros, la organizacin del alumnado ni al desarrollo tecnolgico que necesitaran (enseanza individualizada, promocin y recuperacin automticas, grupos heterogneos). Cuando las teoras resultantes de estos avances son plasmadas en boletines oficiales, a modo de pedagoga legal sin experimentar, propician fines educativos que generan nuevas necesidades en el profesorado. Las reformas educativas, que pretenden recoger las aspiraciones de la sociedad, demandan nuevos fines, metodologas avanzadas, actualizacin en los nuevos conocimientos y herramientas que obligan a un reciclaje permanente para adaptarse a las nuevas exigencias, trastocando el equilibrio docente. Como consecuencia de los requerimientos que no tienen la adecuada respuesta resolutoria por parte del profesorado, el trabajo se transforma en fuente de conflictividad continua que incrementa el desprestigio docente ante la sociedad. Para superar esta incidencia no es suficiente con la vocacin, porque adems hace falta formacin en estrategias de afrontamiento y control de situaciones estresantes. Por otro lado, las propuestas de las incesantes reformas educativas, especialmente desde la Ley General de Educacin de 1970, han exigido del profesorado adaptaciones continuas para cumplir con sus principios o para adaptarlos al contexto donde desarrolla su trabajo, creando un panorama de confusin o de divorcio entre lo exigible y lo otorgable. Sin embargo, debemos resaltar que este conglomerado de desaciertos siempre ha sido censurado en primer lugar por los propios docentes, que han sido los primeros en detectar las dificultades del sistema y conocer la solucin a los problemas escolares, aunque su opinin rara vez ha sido escuchada.

La actividad docente como profesin


En lo que se refiere a la actividad docente como profesin diremos que hay quien pone en duda que lo sea, en todo caso slo tendra la consideracin de semiprofesin (BOURDONCLE, 1991). De hecho, los docentes no pudieron adscribirse ni a los gremios ni a las profesiones liberales, aunque s participaran de aspectos de ambas organizaciones pertenecientes ya a tiempos pasados. El orden gremial desapareci hace aos y las mismas profesiones liberales han visto reducido el ejercicio individual en beneficio de las organizaciones (COBO SUERO, 2001: 23). La propia evolucin de la sociedad ha hecho coincidir, con grandes matices, el ejercicio profesional de los docentes y el de los liberales en el marco de las organizaciones institucionales y empresariales. Con el desarrollo de la sociedad el ejercicio liberal de la profesin se reduce y se ampla la profesin docente, que participa ms en la produccin de bienes y servicios. Esta integracin o acercamiento diferenciado es mayor en la sociedad del conocimiento, donde las organizaciones cobran un mayor protagonismo. Podemos afirmar que la enseanza como profesin es relativamente reciente, porque una profesin se acredita por la poblacin que atiende y la educacin escolarizada no se generaliz ostensiblemente hasta bien entrado el siglo XIX. La vocacin como componente indiscutible hasta no hace muchos aos ha dado paso a otro concepto ms actualizado como el de profesional o profesin. Pero este cambio viene forzado porque la insistencia en la vocacin no resolva los problemas de la enseanza, ya que olvidaba las necesidades materiales y formativas que tena el profesorado. Hoy nadie duda que el ensear es una profesin, aunque el peso de la tradicin sigue estando presente. Incluso desde otros contextos forneos nos alertan de los peligros de desprofesionalizacin docente por la extendida aplicacin de modelos empresariales regulados con normas minuciosas que representan la
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

47

Faustino Larrosa Martnez

anttesis de una profesionalidad autntica. La mercantilizacin de la educacin y la creciente regulacin administrativa contribuyen a la desprofesionalizacin docente (HARGREAVES, 1998: 183). Ahora bien, la profesin de ensear es una profesin asimilable al resto de profesiones? Podramos contestar que es una profesin asimilable a las profesiones que tienen los padres del alumnado, pero que difiere en elementos fundamentales como la materia que trabaja, los roles asumidos, los contextos donde se desarrolla, los fines que persigue y los medios empleados. A Gervilla Castillo (1998: 84) le parece lgico y justificado que se sustituya el trmino vocacin por el de profesin, pero se pregunta si este cambio obedece a criterios educativos y es beneficioso para la educacin, y explica las razones del cambio de vocacin a profesin: 1. 2. 3. 4. 5. La tendencia de la sociedad hacia la profesionalizacin frente a la vocacin. Las infravaloradas connotaciones religiosas de la vocacin. La consideracin de la vocacin como algo arcaico en una sociedad tecnolgicamente avanzada. La mayor valoracin de la necesidad econmica de la profesin frente al altruismo y desinters econmico de la vocacin. La defensa de los intereses laborales y profesionales que se oponen a una vocacin asociada generalmente a la espiritualidad y servicio incondicional.

Para Martnez Bonaf (1995: 27) la docencia es un trabajo, lo que significa la asimilacin a otras actividades profesionales con sus condiciones laborales y de produccin, as como la separacin de la actividad vocacional de tipo asistencial. Se trata de una actividad profesional realizada a cambio de un salario, de acuerdo con unas condiciones laborales aceptadas o un contrato con el empresario, sea pblico o privado, para la consecucin de unos fines, como en cualquier proceso laboral. La diferencia con otras profesiones es que aqu trabajamos con personas, por lo que se espera para la consecucin de los fines o produccin (trabajo productivo) una mayor coordinacin entre todos los responsables de conseguir el fin, o producto final, que es la buena educacin o formacin del alumnado dentro del sistema productivo. Pero, adems, el desarrollo de la actuacin docente est muy condicionado por la normativa del empresario que decide previamente cmo debe realizarse el trabajo: a veces se le forma independientemente de las condiciones, se le seala los fines y se le dice cmo debe realizar su trabajo. Una nota aadida de que es un trabajo ms que una vocacin. Si entendemos el trabajo como el esfuerzo humano aplicado a la produccin de riqueza, no cabe duda que la docencia es una profesin. En esta lnea, Rivas Flores (2000: 145) apunta que entender la actividad del docente como trabajo nos remite a las condiciones laborales y de produccin en que tiene lugar y se aleja, por tanto, de la tradicional comprensin de la actividad docente como un servicio, una actitud de entrega.... Hablar de trabajo es hablar de los procesos sociales que intervienen en la actividad laboral, un intercambio entre una actividad que desempea una persona cualificada y un salario con las condiciones que exige el que contrata. Pero comportarse como profesional docente en la sociedad del conocimiento supone tambin mantener un compromiso permanente con el aprendizaje. Igualmente, en el siglo XXI, la participacin en el propio desarrollo durante la carrera profesional es un requisito bsico para reconocer a una persona como profesional (DAY, 2005: 252). Otro punto de vista interesante es el que nos presenta Cortina. Para esta autora, las morales que slo se han preocupado del altruismo olvidndose de las necesidades de autoestima que tienen las personas han procedido en contra de la naturaleza de las personas. Incluso afirma que sin autoestima es imposible estimar al otro (CORTINA ORTS, 1993: 179). Ciertamente, la educacin tiene mucho que ver con la facilitacin de autoestima. Pere Darder (2009: 194) considera que cuando ms se consolida la autoestima, ms capaz soy de acercarme y acoger al otro. Finalizamos este epgrafe declarando que un profesional docente contrae la responsabilidad de adquirir unas competencias profesionales que le preparen para desarrollar su tarea con calidad, conociendo sus deberes y derechos. Quiz en su origen la enseanza no fue una verdadera profesin, pero actualmente mantiene todas las notas propias de las profesiones (CARR & KEMMIS, 1988; ALTAREJOS, 1998; GERVILLA, 1998; COBO, 2001): a) Requiere una formacin especfica que habilita para la prctica legal de la profesin autorizada por la autoridad acadmica competente, que evita el intrusismo profesional y que permite acceder al libre mercado de contratacin.

48 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

Vocacin docente versus profesin docente en las organizaciones educativas

b)

La existencia de una normativa que regula las funciones y la actuacin del profesorado para un eficaz desempeo de las actividades profesionales, un cdigo tico que obliga al profesional y a sus clientes y un control sobre la realizacin profesional para mantener la calidad del servicio. La cultura profesional forma parte de un saber sobre la profesin: entender su prctica, conocer los elementos ticos y el cdigo deontolgico con la finalidad de proteger la buena imagen de la profesin, no perder credibilidad al ejercer sus funciones, preservar a sus profesionales ante la sociedad y protegerla del intrusismo o presiones de los dems. En este sentido destacaremos la autonoma para actuar sin el control directo de los no profesionales. Comporta un beneficio social porque toda la sociedad puede beneficiarse directa o indirectamente del ejercicio profesional. El ejercicio de la profesin permite el sustento y el desarrollo pleno de su vida individual, familiar y social.

c)

d) e)

Conclusiones
Terminaremos concluyendo que la actividad docente es una profesin con vocacin, una profesin de valores como afirma Esteve (2009: 26). Hay que sealar que la enseanza y el aprendizaje cobran otra dimensin profesional en las organizaciones y en la sociedad del conocimiento. Aunque con frecuencia se hayan intercambiado los trminos y prevalezca la profesionalidad, en sta se incluye el vocacionalismo o compromiso personal para actuar como profesional, conociendo las exigencias de la tarea, sus conocimientos especficos, actuando ticamente y con la capacitacin adquirida a travs de la prctica, que va unida al porqu y al cmo. La asistencia a los dems y la preparacin profesional del docente no son excluyentes, sino equilibradamente necesarias donde no es suficiente con el querer. Si antes la vocacin necesitaba de la profesionalidad, ahora la profesionalidad precisa vocacin. La idea general es que para la enseanza se requiere una cierta vocacin, pero reconvertida y actualizada a los parmetros que corresponde a un ambiente de pluralismo tico y moral. Las condiciones del ejercicio profesional docente para obtener plena satisfaccin seran: a) Vocacin (inclinacin natural para dedicarse a la actividad profesional de ensear con entusiasmo, compromiso y confianza en el poder de la educacin, dedicacin especial y de servicio hacia los dems). Competencia (formacin profesional cientfica y tcnica adecuada que le haga competente en todo momento en el ejercicio de la profesin). Actitud (de apertura, servicio a la comunidad y trabajo en equipos flexibles). Dedicacin (suficiente a la profesin procurando tener cualificados sus saberes). Conocimiento de los deberes y derechos ticos (que puede asumir como compromiso moral y exigir a los dems).

b) c) d) e)

Referencias bibliogrficas
ALTAMIRA CREVEA, R. (1923). Ideario pedaggico. Madrid: Reus. ALTAREJOS, F. (1998). La docencia como profesin asistencial. En F. ALTAREJOS, J. A. IBEZMARTN, J. A. JORDN & G. JOVER, tica docente. Barcelona: Ariel, 2150. BOLIVAR, A. (2000). Los centros educativos como organizaciones que aprenden. Promesas y realidades. Madrid : La Muralla. BOURDONCLE, R. (1991). La professionnalisation des enseiggnants: analyses sociologiques anglaises et amricaines. Revue Franaise de Pdagoge, 94, 7391. CARR, W. & KEMMIS, S. (1988). Teora crtica de la enseanza. Barcelona: Martnez Roca. CTEDRA UNESCO DE GESTIN Y POLTICA UNIVERSITARIA (2006). Seminario la LOE y sus docentes: derechos y deberes. <http://209.85.229.132/search?q=cache:0kIT9nMHwQJ:gestion.universia.es/ noticia.jsp%3FidNoticia%3D3119%26title%3DCONCLUSIONESSEMINARIO%27LALOESUS

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

49

Faustino Larrosa Martnez

DOCENTESDERECHOSDEBERES%27%26idSeccion%3D6+Seminario+la+LOE+y+sus+docente s:+derechos+y+deberes&cd=6&hl=es&ct=clnk&gl=es> [Fecha de consulta: 8/octubre/ 2008]. COBO SUERO, J. M. (2001). tica profesional en ciencias humanas y sociales. Madrid: Huerga y Fierro. CORTINA ORTS, A. (1993). tica aplicada y democracia radical. Madrid: Tecnos. DARDER, P. (2009). La funcin indispensable de las emociones en la formacin personal y en la educacin. En M. DE PUELLES BENTEZ (Coord.), Profesin y vocacin docente: presente y futuro. Madrid: Biblioteca Nueva, 187199. DAY, C. (2005). Formar docentes. Madrid: Narcea. DEZ HOCHLEITNER, R. (1999). Documento bsico de trabajo. En VV. AA., Aprender para el futuro. Nuevo marco de la tarea docente. Documentos de un debate. Madrid: Fundacin Santillana, 9 26. ESTEVE, J. M. (2009). La formacin de profesores: bases tericas para el desarrollo de programas de formacin inicial. Revista de Educacin, 350, 1529. ESTEVE, J. M. (2004). La tercera revolucin educativa. La educacin en la sociedad del conocimiento. Barcelona: Paids. ESPAA, ORDEN ECI/3854/2007, de 27 de diciembre, por la que se establecen los requisitos para la verificacin de los ttulos universitarios oficiales que habiliten para el ejercicio de la profesin de Maestro en Educacin Infantil (BOE de 29 de diciembre). ESPAA, ORDEN ECI/3857/2007, de 27 de diciembre, por la que se establecen los requisitos para la verificacin de los ttulos universitarios oficiales que habiliten para el ejercicio de la profesin de Maestro en Educacin Primaria (BOE de 29 de diciembre). FERNNDEZ, L. (2008). La situacin de los profesores noveles. I Seminario Iberoamericano sobre el desarrollo profesional de los docentes. <HTTP://WWW.FUNDACIONSM.COM/VER_GALERIA_ENLACES. ASPX?&ID=15839>. [Fecha de consulta: 2/septiembre/2009]. GARCA GARRIDO, J. L. (1999). El profesor del siglo XXI. Bordn, 51 (4), 435447. GERVILLA CASTILLO, E. (1998). Educar hoy: profesin contra vocacin. Bordn, 50 (1), 8390. GICHURE, C. W. (1995). La tica de la profesin docente. Estudio introductorio a la deontologa de la educacin. Pamplona: Eunsa. GIL DE ZRATE, A. (1855). De la instruccin pblica en Espaa. Madrid: Imprenta del colegio de sordo mudos. GINER DE LOS ROS, F. (1887). Notas pedaggicas. Boletn de la Institucin Libre de Enseanza, 239, 1820. HARGREAVES, A. (1998). Padres y profesionales docentes: una agenda educativa posmoderna. En VV. AA., Aprender para el futuro. Nuevo marco de la tarea docente. Documentos de un debate. Madrid: Fundacin Santillana, 181188. HARGREAVES, A. (2003). Ensear en la sociedad del conocimiento. Barcelona: Octaedro. LARROSA MARTNEZ, F. & JIMNEZ ALEGRE, M. D. (eds.) (2006). Anlisis de la profesin docente. Alicante: CAM. MARCHESI ULLASTRES, A. (2007). Sobre el bienestar de los docentes. Competencias, emociones y valores. Madrid: Alianza. MARCHESI ULLASTRES, A. & DAZ FOUZ, T. (2007). Las emociones y los valores del profesorado. Cuadernos Fundacin SM, 5. <http://www.fundacionsm.com/ver_noticia.aspx?id=10377>. [Fecha de consulta: 2/septiembre/2009]. MARCELO GARCA, C. (2006). Los profesores como trabajadores del conocimiento. Certidumbres y desafos para una formacin a lo largo de la vida. En F. LARROSA MARTNEZ & M. D. JIMNEZ ALEGRE (eds.), Anlisis de la profesin docente. Alicante: CAM, 1543. MARTNEZ BONAF, J. (1995). El profesorado en el tercer milenio. Cuadernos de Pedagoga, 240, 23 28.

50 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

Vocacin docente versus profesin docente en las organizaciones educativas

PALACIN GIL, E. & BLANCO LORENTE, F. (1993). Profesin docente, reforma y transferencias: Visin del profesorado. Zaragoza: ICE de la Universidad de Zaragoza. RIVAS FLORES, J. I. (2000). El trabajo de los docentes. En J. I. RIVAS FLORES (coord.), Profesorado y reforma: un cambio en las prcticas de los docentes? Mlaga: Aljibe, 139153.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 4351

51

REFERENCIA: Caballero, Presentacin A. (2010). Propuestas de solucin para los problemas educativos de hoy. REIFOP, 13 (4). (Enlace web: http://www.aufop.com - Consultada en fecha (dd-mm-aa):)

Propuestas de solucin para los problemas educativos de hoy


PresentacinA.CABALLEROGARCA

Correspondencia: PresentacinA.CaballeroGarca Correoelectrnico: pcaballero@ucjc.edu Telfono:+34918153131 Fax:+34918609336 Direccinpostal: UniversidadCamiloJosCela CastillodeAlarcn,49 VillafrancadelCastillo 28692Madrid Recibido:26deabrilde2010 Aceptado:18deoctubrede2010

RESUMEN
Este artculo hace un breve anlisis de los efectos de los resultados espaoles en el ltimo Informe PISA como factoresdeterminantesdelcambioeducativoenEspaa.Se proponen soluciones a los problemas educativos de hoy a partirdeunanlisisdelaspropuestasyplanteamientosque han salido publicados en prensa escrita en los dos ltimos aos. El fin ltimo es propiciar actitudes de reflexin e iniciativas innovadoras, que nos lleven a una accin educativa ms eficaz que mejore nuestros resultados en el futuro,ynosencamineaesadeseadacalidadeducativayde excelencia.

PALABRAS CLAVE: PISA, Cambio Educativo, Soluciones


Educativas,Innovacin,CalidadEducativa.

Innovative solutions to current educational problems


ABSTRACT
This article briefly analyses the effects of the Spanish results in the last PISA Report as determining factorsfortheeducationalchangeinSpain.Solutionstothecurrenteducationalproblemsareproposed fromananalysisoftheargumentsandapproachesthathavebeenpublishedinthewrittenpressinthe lasttwoyears.Theultimatepurposeistopromotereflexiveattitudesandinnovativeinitiativesthatlead ustoamoreeffectiveeducationalaction,whichwillimproveourresultsinthefuture,drivingustothe desirededucationalqualityandeducationalexcellence.

KEY WORDS: PISA,EducationalChange,EducationalSolutions,Innovation,EducationalQuality.

PISA, factor determinante del cambio educativo en Espaa


Pese a los complacientes mensajes de nuestras autoridades educativas ministeriales (estamos cerca de la media y en el lugar que nos corresponde), el informe PISA (Programa Internacional para la Evaluacin de Estudiantes) correspondiente al ao 2006, que evala cada tres aos a ms de cuatrocientos mil jvenes de 15 aos, entre ellos veinte mil espaoles, deja muy maltrecho el rendimiento de los escolares espaoles en comprensin lectora y matemticas. Los conocimientos cientficos de los estudiantes continan estancados (R. N., 2007). En todos estos mbitos nuestros alumnos estn por debajo de la media de los pases que pertenecen a la Organizacin para la Cooperacin y el Desarrollo Econmico (OCDE) (SANZ, 2007). Existe desigualdad de conocimientos
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

53

Presentacin A. Garca Caballero

entre comunidades autnomas, una Espaa con distintas velocidades en materia educativa (PASTOR, 2007). Hay quien opina que la Ley Orgnica de Educacin (LOE, 2006) arrastra las consecuencias de la Ley de Ordenacin General del Sistema Educativo (LOGSE, 1990) y reincide en los mismos errores (R. N., 2007; SANZ, 2007): insuficiente inversin en educacin (un 1,1% menos que la media de los pases de la OCDE); falta de medios para controles de nivel, programas de refuerzo escolar; promocin automtica de los alumnos sin tener en cuenta los niveles de conocimiento (pueden pasar de curso con suspensos); supresin de las pruebas extraordinarias de recuperacin; medidas ineficaces para compensar deficiencias en materias como lectura y escritura o resolucin de problemas, que quedan todava en un segundo plano; tampoco se aborda de manera eficaz el absentismo escolar y la indisciplina en las aulas. A estos aspectos de la legislacin vigente, otros aaden tres obstculos ms en el camino hacia la calidad de la enseanza: la heterogeneidad del alumnado a causa de la inmigracin, el auge de las nuevas tecnologas como elemento de dispersin y el cambio en el modelo familiar, con hegemona creciente del monoparentalismo, que ve el colegio como una guardera y una manera de desentenderse del progreso educativo de los hijos (BUSTOS, 2008). Desde otros mbitos, se habla del endeble gasto educativo, la cada vez ms complicada situacin laboral de nuestros docentes o sobre las causas por las que nuestros escolares acreditan un deficiente dominio en comprensin lectora o matemticas (CAMPOS, 2007). Los ndices de lectura entre los espaoles siguen siendo bajos y las estadsticas coinciden en que, a medida que se van haciendo mayores, nuestros nios y adolescentes se alejan de los libros, seducidos por el encanto de los medios audiovisuales. Las elevadas tasas de abandono escolar prematuro y de fracaso en la ESO, combinadas con una amplia oferta para jvenes de trabajos de escasa cualificacin y con salarios bajos, han sido el caldo de cultivo de una tendencia absentista en la sociedad espaola por lo que respecta a la educacin. La perspectiva de maestros y escolares no es precisamente coincidente cuando se les pregunta su opinin al respecto (ANSORENA, 2007). Los docentes consideran que la educacin ha ido a peor en los ltimos tiempos. As lo explica lvaro Marchesi, autor del informe Las emociones y los valores del profesorado, editado por la Fundacin SM. El profesorado no tiene la credibilidad de antao y reconoce que no est bien valorado ni por la sociedad ni por los poderes educativos. Tampoco se siente suficientemente apoyado por la familia. En situaciones de conflicto, hasta las familias le faltan al respeto. Frente a esto, los alumnos espaoles no parecen observar las mismas deficiencias (FERNNDEZ, 2007). La actitud de los escolares actuales se hace cada vez menos crtica con el sistema educativo. Segn los datos que se desprenden de un estudio patrocinado por la Fundacin Hogar del Empleado (FUHEM), que lleva por ttulo Opinin de los alumnos sobre la calidad de la educacin, el 93,4% de ellos cree que su familia se ocupa mucho o bastante por sus estudios; el 61,5% se considera mejor preparado que sus padres; y el 77% cree que las enseanzas recibidas en la escuela le sern de utilidad en el futuro. Algunos explican los malos resultados argumentando que, en general, tenemos un sistema que crea individuos pasivos que terminan mal conviviendo con los dems sin ms ambicin que la de ir tirando (SEGARRA, 2008). Nos hemos centrado ms en divulgar conocimientos y cubrir el plan de estudios que toca que en que el individuo aprenda, crezca y descubra por mismo las cosas. Nos hemos instalado en la cultura de lo cmodo y de lo que nos viene dado; la cultura del esfuerzo cero. Todos estos aspectos promueven la necesidad de cambios en el sistema educativo espaol y en las metodologas de trabajo de los profesores. Tendremos que superar las deficiencias de polticas educativas anteriores para adaptarnos a las nuevas demandas del siglo XXI. Habr que adoptar medidas drsticas si queremos salir de la mediocridad en la evaluacin de ciencias y de la bochornosa bajada en comprensin lectora (FEITO, 2007). Es necesario salir de la pasividad perversa que nos atenaza y concienciarnos de que mejorar es posible (SEGARRA, 2008), dejando a un lado tendencias partidistas (AGUILERA, 2007). Necesitamos soluciones para que el prximo muestreo global, PISA 2009, no suponga otro varapalo para el sistema educativo espaol (PRADES, 2007). Pero este planteamiento no puede quedarse anclado en la idea de que Espaa es el problema y Europa la solucin, como afirma Feito (2007). Los finlandeses han conseguido crear un magnfico sistema educativo para Finlandia pero nosotros no somos finlandeses (LURI, 2008). PISA no da modelos

54 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

sino referencias. Un modelo trasplantado a otro sitio no funciona (CRUZ, 2007). Deberemos mirar el contexto internacional y reflexionar sobre sus aciertos para encontrar referencias que, al final, nos lleven a soluciones nuestras, adaptadas a nuestra cultura e idiosincrasia, y que encaminen nuestra existencia futura hacia la calidad y la excelencia.

El modelo finlands. Caractersticas de uno de los mejores sistemas

educativos del mundo


El colegio finlands no es un colegio al uso y no precisamente por sus instalaciones, modestas y donde sorprende encontrar un taller de carpintera o de trabajos textiles. Nada ms sobrepasar la puerta se respira un ambiente de relax y tranquilidad poco habitual en un centro en plena jornada lectiva. Por uno de los pasillos se escucha la msica de un piano y, dentro de las aulas, sorprende la disciplina y el orden con el que los escolares, atentos a la profesora, levantan la mano para colaborar activamente en la clase. Robles, Barrios & Caballero (2006) resumen los principales rasgos del modelo finlands, de acuerdo a cuatro criterios bsicos: profesorado, familia, objetivos educativos y organizacin escolar.
A) EL PROFESORADO: PIEDRA ANGULAR DEL XITO FINLANDS Extraordinario y riguroso proceso de seleccin y formacin. Alto prestigio y reconocimiento social de la profesin. Los ms competentes se sitan en los primeros cursos. Menos horas lectivas en Primaria y Secundaria, y ms en Bachillerato. Jornada laboral completa o parcial. Tiene la mxima responsabilidad de los resultados en la educacin. B) LA FAMILIA: IMPLICACIN ACTIVA Participacin real de los padres en actividades concretas de la vida del centro, de carcter pedaggico, extracurricular y de apoyo. Los padres asumen la principal y primera responsabilidad en la educacin de los hijos. En los hogares finlandeses, el inters por la cultura es elevado. C) SISTEMA EDUCATIVO: SABE DNDE MIRAR Educacin de excelencia, con una alta cohesin social. Fracaso escolar mnimo (0,4%). Sistema educativo eficiente, no slo eficaz. Dominio fundamental de competencias lingsticas. Proceso lector sustentado sobre tres principios: la familia, la escuela y las estructuras socioculturales de apoyo. Valoracin de la capacidad para pensar y estudiar muy por encima de la memorstica. Predominio de los valores de responsabilidad y la disciplina. Consideracin de la familia como la primera responsable de la educacin de los hijos. Garanta de compatibilidad de la vida laboral y familiar por parte del Estado. Importantes apoyos socioculturales: excelentes redes de bibliotecas. En televisin y cine se emiten pelculas y dibujos animados en la lengua original con subttulos, lo que obliga a leer la propia lengua y/o a entender otra. D) ORGANIZACIN ESCOLAR: COHERENCIA PEDAGGICA Sistema educativo: obligatorio hasta los 16 aos, con predominio de una metodologa individualizada por proyectos y con una evaluacin por contratos, que concede mucha importancia a la responsabilidad personal del alumno. Se procura que los nios estudien en un mismo edificio para un mayor control y seguimiento. El 75% del currculum es obligado. El resto lo disea el colegio con la participacin de estudiantes y familias. Libertad para organizar la actividad del aula. Los libros de texto son editados por empresas privadas en colaboracin con la Junta Nacional de Evaluacin para el control de los contenidos impartidos.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

55

Presentacin A. Garca Caballero

N medio de alumnos por clase: 20 en Primaria y 15 en Secundaria. Los colegios tienen un nmero total de alumnos bajo con respecto a otros pases (en torno a 300 alumnos). Buenas instalaciones y equipamiento. Jornada escolar del alumno: alrededor de siete horas de clase y una media de 30 minutos para hacer los deberes. Dominio temprano y progresivo de la lengua. Sistema educativo bilinge enfocado al aprendizaje de idiomas (un mnimo de tres y un mximo de cuatro: finlands, sueco, ingls, francs). Programas de Matemticas y Ciencias con carcter muy prctico y experimental. Pruebas de control de conocimientos: una prueba comn a la finalizacin del Bachillerato, con cuestiones sobre tres idiomas adems de otras materias. Apoyo inmediato y especfico a los alumnos que flaquean. Monitoras de alumnos. Los problemas de aprendizaje se tratan inmediatamente. Los ordenadores e Internet son herramientas de uso diario en las aulas. Se prima la solidaridad frente a la competitividad.

Cuando nos acercamos a conocer las recetas de su xito, nos sorprende conocer que no hay misterios (GUZMN, 2007):

Mayor inversin. El PIB que Finlandia gasta en educacin duplica al de Espaa Profesores formados, reconocidos y respetados. El profesor finlands invierte seis aos en su preparacin; pasa por unos procesos de seleccin muy exigentes antes de su incorporacin a la escuela; est mejor remunerado gana el doble que en Espaa; y goza de mayor consideracin social su autoridad es reconocida y respetada, y ello evita la conflictividad y mejora el rendimiento acadmico). Colaboracin familiar: los padres tienen buen nivel educativo y participan de forma peridica en la formacin de sus hijos y en la dinmica del centro. La comunicacin diaria por email para hablar de los hijos es habitual. Ratios de 15 alumnos por aula y refuerzos para los alumnos ms rezagados, seguimiento
continuo, clases de apoyo y, por supuesto,

La filosofa pedaggica que impregna sus planes de estudio, que fomenta que los nios aprendan desde muy pequeos a valerse por s mismos. El sistema finlands es muy exigente con el rendimiento acadmico, con el comportamiento y los buenos modales de sus alumnos.

Los pequeos finlandeses estn en las guarderas hasta los 6 aos y comienzan el colegio a los 7, edad en la que suelen aprender a leer. El sistema escolariza nios de diferentes edades segn sus capacidades y madurez, a partir de una prueba psicolgica, de manera que algunos pueden iniciar antes o despus su vida acadmica (FERNNDEZ VALLEJO, 2008). El sistema educativo finlands persigue que los alumnos aprendan a aprender. Los estudiantes se evalan a s mismos y a sus profesores, y el desarrollo social y afectivo forma parte de los requisitos educativos. El uso de la informtica tambin es una parte central de la vida escolar. La destreza en el manejo informtico se aprende al mismo tiempo que las materias del currculum. Otro de los secretos de su xito es la libertad que tiene para aplicar los contenidos. Finlandia opt por un sistema educativo comprehensivo e integrador y no segregacionista. Como el finlands, otros sistemas educativos nrdicos, el alemn o el britnico apuestan por una educacin individualizada. El proyecto educativo se dirige a conseguir el mayor desarrollo posible de la personalidad del alumno durante su permanencia en el colegio, desde el punto de vista social, cultural e intelectual. El colegio ensea a aprender a aprender. Hay que conseguir que el alumno investigue, el profesor debe guiarle y hacer funciones de coaching, buscar sus habilidades personales y facilitarle el camino para que las desarrolle; pero para eso hay que tener la mente abierta y abrir nuevas puertas al aprendizaje. En este tipo de centros las prcticas son fundamentales. La clase magistral ha desaparecido y se ponen en prctica otros enfoques para ensear, adaptados a las nuevas tecnologas, y con formas ms atractivas y motivadoras de aprender, especialmente en materias que pueden resultar ms ridas. Los nios aprenden jugando. La ratio es de cuatro a siete nios por maestro. Los nios estn agrupados por edades y se mueven por las aulas con gran libertad. Solo hay que respetar tres normas: no molestar al compaero, escuchar a los dems cuando hablan y dejar cada cosa en su sitio. De esta manera, los

56 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

alumnos aprenden a comportarse en grupo. La clave del xito est, pues, en el proyecto educativo. Sin l los recursos sobran.

Soluciones a los problemas educativos de hoy


Los resultados de PISA revelan la necesidad de incrementar los recursos que globalmente se dedican a la educacin (PRADES, 2007), mediante un acuerdo financiero entre el Gobierno central y las comunidades autnomas que, entre otras mejoras, permita combatir los actuales desequilibrios interterritoriales (CAMPOS, 2007). Los sindicatos educativos demandan, adems, la necesidad de un pacto de estado por la educacin (AGUILERA, 2007; GONZLEZ, 2007). La inversin educativa es importante pero no lo es todo. El xito educativo no consiste en invertir ms, sino en gestionar mejor ese dinero (AUNIN, 2007b; SNCHEZ DE LA NIETA, 2007). Se precisa mayor autonoma de los centros escolares, que necesitan una identidad propia y capacidad para adaptarse al tipo de alumnos que reciben (CABRERA, 2007). Los directores apenas tienen competencias sobre el profesorado. Se limitan a hacer tareas de gestin (administrativa, generalmente) y a refrendar las decisiones asamblearias del claustro de profesores o a asumir las que han adoptado la mayora (CASABELLA, 2007a). La profesionalizacin de la direccin escolar (hacia un polo ms pedaggico que administrativo) sigue pendiente (ROBLES ET AL., 2006). En cuanto al profesorado, las sugerencias apuntan hacia una mayor calidad y a que es imprescindible que se le dote de un estatuto especfico que establezca sus condiciones laborales y una carrera profesional capaz de incentivar su cada vez ms difcil trabajo en los centros (CAMPOS, 2007). Elegir a los mejores para convertirlos en profesores, conseguir que sean muy buenos dando clase y que todos y cada uno de los alumnos, del mejor al peor, tengan una educacin excelente y que no se quede nadie (o el menor nmero posible) por el camino, son los puntos en comn que se han encontrado entre los sistemas educativos que han obtenido mejores resultados en el Informe PISA de la OCDE (AUNIN, 2007a). Junto a la importancia del docente, el Informe McKinsey (2007) seala como claves del xito de los sistemas educativos: la atencin individualizada; la ratio alumnos/clase (bajar el nmero de alumnos por clase de 23 a 15 mejora los resultados); y la compensacin de dificultades sociales y econmicas de los alumnos, marcando unos mnimos educativos altos, dando recursos a las escuelas que lo hacen peor y prestando apoyo temprano a quienes presentan alguna dificultad en sus aprendizajes. En la misma lnea, Pedr (2007) afirma que los pases que consiguen mejores resultados, tanto en trminos de rendimiento escolar como de equidad, acreditan polticas educativas sostenidas en tres frentes: el desdoblamiento de grupos para reducir el tamao de las clases; la personalizacin de la enseanza; y una mayor inversin en Educacin Infantil. Tambin se hace necesaria una mayor implicacin de la familia en la tarea formativa que se desarrolla en la escuela. Casabella (2007a) seala que cada vez hay ms padres que delegan en la escuela la labor de educar a los hijos. Llegan incluso a mostrarse exigentes, hasta el punto de ignorar su responsabilidad educativa. Justifican la indisciplina de sus hijos, la alientan y desautorizan a sus profesores. Renuncian a marcar lmites y a enfrentarse a sus hijos, comprometiendo a la escuela. Tampoco se interesan por el funcionamiento de los centros. La educacin, sin embargo, es tarea de todos; una tarea de responsabilidades compartidas. El estatus socioeconmico y cultural de los padres es otro factor a tener en cuenta porque predispone al xito escolar de los alumnos (J. A. A., 2007; SANZ, 2007). Por lo que respecta a las deficiencias en lectura, el Informe PIRIS (Estudio Internacional de Progreso en Comprensin Lectora) correspondiente a 2006 sita a Espaa cuarto peor pas de Europa en comprensin lectora de nios de 10 aos (ASENJO, 2007). Tres de cada diez alumnos de cuarto de Primaria no entienden bien lo que leen. Las nias superan en 17 puntos a los nios en rendimiento lector; y el nivel cultural de las familias ejerce un efecto positivo, no as la prctica frecuente de la lectura en voz alta. Es preciso, por tanto, localizar los posibles fallos en el sistema educativo, sobre todo en las primeras etapas de la escolarizacin, y aplicar las medidas adecuadas para superarlos (CAMPOS, 2007). Deberemos trabajar para desarrollar la capacidad para entender, usar y analizar textos en nuestros alumnos (AUNIN, 2007b). Tendramos que poner menos nfasis en la sintaxis y el anlisis gramatical y ms en leer y escribir (S. T., 2007); menos memoria y ms comprensin y atencin a lo que se lee (VIDAL, 2007). Tambin hay que dar prioridad al uso de la lengua como instrumento de comunicacin (ALBERT, 2007) y a la formacin de buenos hbitos lectores.
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

57

Presentacin A. Garca Caballero

La educacin matemtica tambin tiene repercusiones importantes en la cultura de la sociedad, en la cultura cientfica y en la formacin de ciudadanos crticos y responsables. Hoy se tiene conciencia de que el aprendizaje de la materia, como tantos otros, tiene que durar toda la vida (ROYO, 2007). La falta de formacin del profesorado en didctica de las matemticas es en buena medida responsable de los bajos rendimientos en esta asignatura (CASABELLA, 2007b). Para superar las deficiencias en matemticas, los profesores reclaman ms horas y cambios pedaggicos para mejorar el nivel (BELTRN, 2007). La enseanza de las ciencias se da a travs de clases magistrales, transmisin y copia. Hay mucho nfasis en la repeticin. Es aburrido y los estudiantes pierden el inters. Los profesores de matemticas son cada vez ms conscientes de que no se las puede ensear como antao. Es imprescindible hacer estas asignaturas ms atractivas (AUNIN, 2007c). Un enfoque nuevo de la docencia de las matemticas tiene que anteponer el desarrollo de la capacidad de razonamiento como instrumento necesario para la toma de decisiones ante problemas surgidos de la vida cotidiana. Menos lgebra y geometra y ms clculo aplicado a la vida cotidiana (VIDAL, 2007). Se tiene la necesidad de que los alumnos de la enseanza obligatoria realicen aprendizajes reflexivos, funcionales y significativos que no son posibles con la aplicacin de metodologas puramente transmisivas (AUNIN, 2007c). El reto est en motivar a los alumnos para que descubran lo apasionante de esta ciencia (PREZ, 2007). Y todo ello, a travs de todo tipo de estrategias: uso de documentales, recursos digitales, blogs, resolucin colectiva de problemas, etc. Para ver las matemticas con menos temor recomiendan presentar la asignatura como algo til y prximo a los intereses cotidianos. La informtica, los mviles, la fotografa digital,, todo est plagado de matemticas. Detrs de cada resultado y de cada teorema hay personas que lo han elaborado, con sus rostros, sus historias Presentrselas a los estudiantes es otra manera de hacer esta ciencia ms cercana y mostrar su rostro ms humano. Para quienes han propuesto como solucin aumentar el nmero de horas de enseanza en las materias instrumentales en las que somos deficientes, las evidencias empricas demuestran que no existe una relacin lineal entre el volumen de horas de enseanza y los resultados escolares. Es fcil encontrar numerosos casos de pases como Finlandia, Japn, Corea o Alemania donde el volumen total de horas de enseanza es inferior al que se imparte en nuestro pas y, aun as, los resultados son muy superiores. El incremento de las horas de enseanza por s solo no implicara un aumento del nivel; se necesitara una mejor didctica y ms preparacin de base (PEDR, 2007). Otros opinan que con el estmulo adecuado puede superarse el fracaso escolar. Los problemas no son tanto de capacidad como de hbitos de estudio (que deben adquirirse en Primaria), motivacin, falta de coordinacin de los padres con el centro escolar o la ausencia de una estrategia pedaggica adecuada (JANER, 2008). El compromiso de hoy gira en torno a que lo importante no es ya transmitir, sino educar; despertar el inters para querer saber ms, ms que cumplir con lo que est mandado; y valorar la cultura del esfuerzo por encima de la pasividad y la apata (SEGARRA, 2008). La llegada de los ordenadores, Internet y otras tecnologas a las aulas (pizarra digital, tablets PC, etc.) no ha hecho que cambie el modelo de enseanza (MONGE, 2008). Las Tecnologas de la Informacin y la Comunicacin (TIC) son un recurso infrautilizado en Primaria, Secundaria y Bachillerato (GRAU, 2008). Nuestro mundo ha cambiado a consecuencia de la tecnologa y, la escuela, no lo ha hecho. A pesar de que durante los ltimos 100 aos han aparecido la radio, la televisin, los ordenadores e Internet, la escuela sigue basada en una tecnologa muy concreta: la palabra impresa (MONGE, 2008). Los centros educativos se estn convirtiendo en almacenes de ordenadores, que se emplean para familiarizar a los nios con los rudimentos de la informtica y como soporte de materiales educativos, pero raramente se les utiliza como instrumentos al servicio de la didctica y el aprendizaje, ni como alternativa a los medios clsicos de aprendizaje como es el libro (CASABELLA, 2007a). El 90% de los profesores tiene ordenador para prepararse las clases, pero solo el 20% lo aplica en el aula, y lo hace centrndose en la ofimtica y sin aprovechar todas las posibilidades que le ofrecen las TIC (SEGURA, 2008). La velocidad vertiginosa a la que aprenden los alumnos, nativos en el mundo tecnolgico, choca con la realidad que estn viviendo sus profesores: han nacido en el siglo XX, estudiaron con los mtodos del siglo XIX y estn intentando ensear a las generaciones del siglo XXI. El desfase es brutal (MONGE, 2008).

58 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

Los profesores son conscientes de sus posibilidades pedaggicas y hacen un gran esfuerzo por adaptarse. Necesitan ser formados en el uso de las nuevas tecnologas desde el principio de su preparacin y tambin de forma permanente. La idea del docente transmisor de cultura ahora no vale. Con las tecnologas de la informacin, los alumnos tienen otras fuentes educativas alternativas, pueden crearse entornos educativos ms ricos y se eliminan las barreras espaciotemporales entre docentes y estudiantes (CASTILLO, 2008). El profesor tiene que vencer el miedo al nuevo modelo educativo que se le demanda, encauzar positivamente el uso tecnolgico y asumir un rol de facilitador del aprendizaje; ensear a manejar fuentes, contrastarlas; fomentar en sus alumnos capacidades de anlisissntesis y contribuir al desarrollo de un espritu crtico (MONGE, 2008). El reto es transformar la metodologa educativa para aprovechar todo lo que permite la Red y el resto de TIC (SEGURA, 2008). Para mejorar el rendimiento acadmico es imprescindible combinar Internet con las buenas prcticas de los profesores. Cuando se da este binomio se producen mejoras

tremendas en el aprendizaje y se consigue que el alumno construya conocimiento a partir de la informacin (MARQUS, 2008).
Respecto a los idiomas, el gobierno espaol pretende adecuar las enseanzas impartidas en los centros educativos al marco comn europeo de referencia (RUEDA, 2008). El MCER es un proyecto que pretende lograr esa poltica lingstica convergente en la Unin Europea. Sin embargo, profesores, estudiantes y sindicatos intentan detener esta reforma porque se sienten en desventaja con los sistemas europeos. Tendremos que ser ms competitivos en este aspecto y trabajar por aumentar y mejorar nuestra diversidad lingstica. Las iniciativas de cambio y las propuestas de solucin para la mejora educativa en las diferentes comunidades autnomas espaolas no se han hecho esperar. La Comunidad Valenciana est tomando conciencia de la problemtica existente en las aulas espaolas y apuesta por la calidad, llevando a cabo numerosas iniciativas para intentar mejorar (J. M., 2008). Entre estas medidas se encuentran la construccin de colegios nuevos, la mejora de la situacin laboral y social del profesorado, y el reforzamiento de su autoridad; polticas de reconocimiento e incentivos para centro, el profesor y los alumnos; propuestas para conseguir una mayor implicacin de las familias en la educacin, entre otras. Contra el fracaso escolar, el modelo valenciano potencia tanto la atencin a la diversidad del alumnado como la integracin (R. V., 2007). Se han puesto en marcha tres programas para adaptar la metodologa didctica a las caractersticas y necesidades de cada alumno: el de diversificacin curricular, el de adaptacin curricular en grupo y el de garanta social. Tambin convoca premios para fomentar la educacin en valores, la educacin vial y la ambiental; potencia el dominio de una lengua extranjera, adems de las dos autctonas (trilingismo); incentiva la innovacin educativa en la prctica docente; promociona la formacin del profesorado en interculturalidad, planes de convivencia (Previ) y de resolucin de conflictos; propicia la elaboracin de planes pedaggicos que potencian evaluaciones diagnsticas para detectar carencias del alumnado, etc. El objetivo es lograr la calidad total en la institucin educativa y construir un sistema educativo eficaz. En Catalua, la Primaria y la Secundaria han vuelto a las notas del insuficiente al sobresaliente para fomentar la cultura del esfuerzo, tener elementos de juicio ms potentes y solventes para combatir el fracaso escolar, y con el fin de que los padres puedan conocer con ms detalle la evolucin acadmica de sus hijos (CASABELLA, 2007b). Tambin se han tomado medidas enfocadas a mejorar la coordinacin entre la etapa de Primaria y la Secundaria, lograr una mayor implicacin de los padres en el proceso de aprendizaje de sus hijos, reforzar y recuperar los aprendizajes en Educacin Secundaria, incentivar el establecimiento de planes individualizados de evaluacin para alumnos tanto especialmente dotados como con mayor dificultad para aprender. Estos son solo dos de los muchos ejemplos de los efectos que la inercia del cambio est propiciando en nuestro pas. Ni mejores ni peores. El tiempo explicar la efectividad de estas actuaciones. Frente a los problemas escolares, mejor la accin que la pasividad. Revisemos y despus actuemos en virtud de los resultados, teniendo como meta ltima la mejora. Llegados a este punto, hacemos nuestras las palabras de Yolanda Espa (2007): nadie puede llevarse a engao y creer que las medidas que adoptemos en la escuela sern la solucin a los problemas que arrastramos. No todo es culpa de la escuela, afirma Csar Coll, estamos ante un problema social. Ser un deber de toda la sociedad, de la familia y de la escuela, motivar a los nios para que estudien y fomentar el placer por aprender que nos har ms competentes y competitivos en el mundo global que ahora nos toca vivir. En la misma lnea, Bolvar (2007), Pedrero (2007) y Muoz

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

59

Presentacin A. Garca Caballero

(2007) manifiestan que la mejora de la educacin depende no slo de la escuela y sus profesores, sino del conjunto de la sociedad y muy especialmente, insiste Bolvar, del apoyo y cooperacin de las familias; importa particularmente la valoracin social de la escuela y de la educacin. La mejora de la educacin ha de convertirse para todos en una cuestin de primer orden. En el entorno internacional, las soluciones que adoptan los pases para mejorar sus resultados son variadas, pero hay tres tendencias globales claras (BOONE & ANSORENA, 2006): invertir ms dinero en educacin, especialmente en tecnologas de la informacin; enseanza individualizada; y tendencia a otorgar a una mayor autonoma a los centros escolares y reducir el uniformismo de la educacin.

Claves del cambio educativo: iniciativas punteras e innovadoras para el aula


Las claves para la transformacin educativa que necesitamos estarn en las respuestas que demos a los siguientes interrogantes: Qu hay que transmitir a nuestros alumnos y a nuestros hijos para que se desenvuelvan en la vida del maana? Cmo tendremos que transmitirlo? De qu manera evaluarlo? Cmo contribuir a los procesos de mejora continua y superarnos para ser ms competitivos a nivel nacional e internacional? En poltica educativa, unos (socialistas) hablan de igualdad de oportunidades, flexibilidad, integracin y apoyo al alumno; otros (los populares) hacen suya la bandera del trabajo, la cultura del esfuerzo y la disciplina. El sentir general es que se nos ofrecen ms reformas y los mismos problemas (bajo nivel de los alumnos y abandono prematuro de los estudios). Son necesarias medidas urgentes que palien nuestros dficits. No es muy positivo para el sistema educativo que las leyes cambien cada cuatro aos o cada vez que el gobierno cambia de siglas (BENITO, 2008). La OCDE viene insistiendo desde hace aos en la importancia de la investigacin educativa para informar el proceso de toma de decisiones polticas (PEDR, 2007). Pases como Inglaterra, Nueva Zelanda, Dinamarca o Suiza estn dando pasos ejemplares en este sentido. As, cuando han debatido cmo mejorar la calidad de la enseanza han recurrido a los resultados de la investigacin educativa. Esta podra ser una propuesta a considerar para Espaa. Con todo este ambiente en el que pocos se sienten satisfechos con su sistema educativo, se est produciendo un boom en Europa de formatos de educacin elitista que prometen carreras brillantes. El objetivo de la pedagoga es preparar a los nios para la vida (MEHLHORN, 2008). Hasta ahora, esto era algo relativamente fcil porque se saba cul era el futuro. Pero hoy no sabemos ni siquiera cmo ser en veinte aos. El panorama ha cambiado. Conviene, entonces, que los chicos elijan un mbito profesional que realmente les interese. De este modo, potencian mejor sus aptitudes y cualidades y asumen mejor los cambios del futuro (HARTMANN, 2008). Aunque se haya incrementado la importancia de algunas asignaturas como los idiomas, lo crucial es despertar la curiosidad y el inters de los alumnos, y formar en competencias reales que mejoren su insercin laboral en el futuro. Para esto es crucial el acercamiento de la institucin escolar a su entorno ms inmediato, en lo social, lo cultural, y lo laboral. Observatorios sociales, de empleo, de cultura, etc., en la escuela podran cumplir esta funcin de seguimiento. Lo que cuenta hoy es si los alumnos pueden aplicar los conocimientos adquiridos en nuevos escenarios, si tienen motivacin y capacidad suficientes para crear nuevos conocimientos, para explicar fenmenos cientficos y dibujar conclusiones basadas en evidencias. Tambin necesitarn estar atentos a cmo la ciencia y la tecnologa configuran nuestro entorno material, intelectual y cultural (SCHLEICHER, 2007). El fin ltimo es formar ciudadanos preparados en lo cientfico y en lo humano, con criterio propio, seguros de s mismos, atrevidos y con ganas de emprender (SEGARRA, 2008). La educacin oscila siempre entre el cario y la disciplina, la confianza y el control. Bernhard Bueb (2007) afirma que el arte de educar consiste en encontrar el punto medio. El principal objetivo de la educacin es dar a nuestros alumnos seguridad en s mismos para que puedan emprender su camino con independencia. Los nios necesitan emociones y experiencias desde edades tempranas (MEHLHORN, 2008). Adems de los contenidos habituales, en los colegios hay que ensear msica, danza, pintura, teatro, ajedrez, al igual que asignaturas que les inciten a descubrir, inventar e investigar.

60 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

A los nios hay que transmitirles apertura de mente, flexibilidad, capacidad para relacionarse con los dems de forma eficaz, autonoma, pero tambin aprendizaje de la interdependencia y aptitud para trabajar con los dems, habilidades comunicativas en el idioma materno y al menos una o dos lenguas extranjeras. Tambin son claves el pensamiento crtico, la alfabetizacin informtica (sin caer en el consumo ilimitado sino en el uso controlado de las nuevas tecnologas), la formacin acadmica adecuada al nivel de capacidad del alumno, la valoracin del esfuerzo y la perseverancia, la atencin a la diversidad y la multiculturalidad, entre otros aspectos (PALACIOS, 2008). Hay que resolver el problema endmico de unas clases demasiado expositivas en las que no se fomenta la expresin oral, ni la exposicin en pblico, el debate, los argumentos, que los alumnos busquen informacin, la interpreten y compartan con sus compaeros (GUARRO, 2007). La tendencia pedaggica actual apunta hacia aprendizajes activos, por descubrimiento, significativos, constructivos, que conllevan metodologas didcticas activas, investigativas en las que el profesor no plantea soluciones sino problemas de investigacin que el alumno ha de resolver a partir de los conocimientos que tiene o debe ir adquiriendo (de lengua, matemticas, biologa, historia) para dar la respuesta adecuada. El alumno desempea un papel activo e investiga con la gua de su profesor; se convierte en un joven indagador, pensador, crtico y reflexivo. El centro educativo se concibe como un espacio abierto al entorno, del que toma y al que da. Ejemplos de este tipo de experiencias los encontramos en el CSIC en la escuela y el Modelo Didctico Investigativo de la Red IRES; todos ellos demuestran que es posible ensear y aprender de otra manera diferente a la tradicional e incentivando la actitud investigadora. Dificultades con las que nos podemos encontrar al implantar esta iniciativa (SEVILLANO, 2008): Falta de formacin del profesorado; Actitudes de resistencia al cambio (a veces nuestros proyectos chocan contra estructuras organizativas e inercias que datan del siglo XIX; no todos los profesores quieren cambiar; si todos estn contentos, para qu cambiar). (MARTNEZ, 2008). La administracin debera ser ms flexible y permitir a los centros que lo deseen que se organicen de manera diferente; Hay que formar a las familias; La sociedad est cambiando. El sistema educativo tambin tiene que cambiar para atender a las nuevas demandas.

Otros reclamos (SEVILLANO, 2008):

Con respecto al consumo de televisin y videojuegos, cada vez se habla ms de la necesidad de control en el uso de las tecnologas. Por culpa de la televisin y de las nuevas tecnologas, afirma Palacios (2008), los nios duermen muy poco y son menos activos (en sus juegos, en sus contactos sociales y en sus relaciones familiares) de lo que debieran. Spitzer (2008) seala que varios estudios demuestran claramente que estos medios reducen la capacidad intelectual de los chicos de 12 aos. El consumo ilimitado de nuevas tecnologas perjudica el rendimiento escolar y las posibilidades de formacin de los chicos (PFEIFFER, 2008). Jugar significa experimentar, actuar, sentir. Reivindicar la pedagoga del juego sera otra propuesta interesante que retomamos de Spitzer y otros defensores del aprendizaje mediante el juego. Quien ve mucho la televisin, afirma Spitzer (2008), aprende pasividad; quien juega durante horas ante el ordenador, aprende agresividad. Por el contrario, jugando con otros chicos en la calle o en los clsicos juegos de mesa, el nio aprende a moverse y a relacionarse con los dems. El debate puede ser otra estrategia didctica a propiciar. Ventajas: contribuye al desarrollo de las habilidades comunicativas de los alumnos; incentiva su actitud investigadora; promueve en el aula escenarios deliberativos en los que intercambiar opiniones informadas; propicia la lectura orientada; crea un pblico lector consumidor de libros (ms all del libro de texto y la cultura de los apuntes) y de mtodo sistemtico para la localizacin y uso de fuentes de informacin; tambin aumenta la utilizacin de la biblioteca en la escuela; entre otras cosas. Razones todas estas suficientes como para justificar su aplicacin en el aula. Somos diferentes y aprendemos de forma diferente. Con este lema y aludiendo a razones cientficas, estn surgiendo tendencias que fomentan y defienden una educacin separada en funcin del sexo. Los resultados de investigaciones recientes demuestran el planteamiento de que en clases

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

61

Presentacin A. Garca Caballero

separadas aumenta el rendimiento y mejora la disciplina (CALVO, 2008). Los potenciales beneficios pedaggicos de separar a nios y nias en las clases empiezan a ganar cada vez ms adeptos. Esta opcin, tanto por motivos biolgicos como sociales, est cubriendo cada vez ms terreno en la educacin internacional (ANSORENA, 2008) y llega a Espaa como un modelo educativo alternativo y posible solucin a nuestros problemas de fracaso escolar. El modelo pedaggico de personalizacin por sexos est teniendo buenos resultados en Estados Unidos, Australia, Canad y Japn. Ms cerca, en Europa, est surgiendo una corriente que apuesta por la educacin pblica diferenciada, especialmente en pases como Alemania, Reino Unido, Francia o Suecia. Se est aplicando como uno de los remedios contra el alto fracaso escolar reflejado en los ltimos informes PISA. Se propugna como postura educativa moderna y progresista (SOLANES, 2009). En Espaa, varias comunidades autnomas estn estudiando este sistema; no hay colegios pblicos personalizados por sexos; slo 130 privados o concertados (COBO, 2008). Mara Calvo, presidenta para Espaa de la European Association for SingleSex Education, sostiene que la escuela diferenciada no es la solucin completa al problema del fracaso, hay que tener

en cuenta la crisis de la familia y otros aspectos; an as, defiende que es una alternativa absolutamente legal, con encaje en la LOE; y la alternativa de futuro y de progreso. La educacin
diferenciada se est abriendo paso como alternativa al modelo estndar de coeducacin o educacin mixta (SNCHEZVALLEJO, 2008). Aunque no es ni mucho menos la nica solucin del fracaso escolar en Espaa, s puede ser un paso hacia una enseanza de calidad (SOLANES, 2009). Las aulas de acogida, iniciativa que empez a surgir a finales de los aos 60 en Montreal, que posteriormente se ha extendido a la mayora de los pases occidentales que acogen alumnado extranjero, y actualmente se est desarrollando en Catalua, se estn revelando como una eficaz estrategia de cohesin social, de integracin en la escuela y atencin a la diversidad (VILA, 2007). Constituyen un recurso humano y material que, en el marco de la organizacin escolar, apoya lingsticamente a todo el alumnado, bien en el aula ordinaria, bien en un espacio especficamente dedicado a ello, en el que durante una hora y media al da el alumnado extranjero trabaja especficamente aspectos relacionados con la lengua de la escuela. En estas aulas de bienvenida, profesores especializados en diversidades reinventan el aula y la escuela cada da para ajustarse a las necesidades educativas de todos sus alumnos. Su quehacer diario tambin puede ser un modelo a seguir. El nuevo modelo pedaggico que proponemos tampoco puede quedarse al margen de las nuevas tecnologas. Los expertos predicen que en cinco aos el 70% de las aulas espaolas tendr conexin a Internet (CASTILLO, 2008). A travs de la tecnologa los alumnos abren sus mentes a otros mundos; aprenden a investigar y encontrar soluciones a las cosas que les ataen y les interesan. Los entornos de aprendizaje se enriquecen, y las escuelas se convierten en aulas sin muros. Los profesores juegan un papel fundamental en todo este proceso. No pueden dar la espalda al progreso tecnolgico, tienen que actualizar su formacin y contribuir a que el uso de estas nuevas herramientas pedaggicas sea positivo y con orientacin de futuro. PISA deja claro que las competencias cientficas brillan por su ausencia entre los estudiantes espaoles. Acercar la ciencia a los escolares desde edades tempranas constituye otra asignatura pendiente del sistema educativo (ASENJO, 2008). La metodologa cientfica como alternativa didctica permite a los alumnos aprender sobre acontecimientos cotidianos, aprovechando su curiosidad natural y utilizando la observacin y la experimentacin como herramientas bsicas para la adquisicin de un conocimiento basado en el descubrimiento. La Universidad no es ajena a estos cambios educativos que estamos viviendo y propiciando y, en pleno proceso de convergencia europea, tiene que abordar sus estudios de grado y posgrado en consonancia con el Espacio Europeo de Educacin Superior. La tendencia es hacia una formacin en competencias profesionales que capacite al egresado para su incorporacin al mercado laboral con ciertas garantas de xito y eficacia. Gabilondo (2008) afirma que lo importante es que el ttulo universitario muestre la capacidad de aprendizaje del que lo posea y asegure su insercin laboral. En este camino hacia el cambio y la innovacin educativa se est defendiendo la idea de que tenemos que apartarnos del academicismo de antao hacia posturas menos tericas y ms prcticas. Pero, si bien esto es necesario, en la huida del academicismo podemos correr el riesgo de caer en un excesivo pragmatismo. Llegados a este punto, consideramos como Alejandro Llano (2007) que tanto el pragmatismo como el emotivismo son tendencias culturales y ticas que revelan planteamientos antropolgicos insuficientes. El utilitarismo resulta muy poco prctico, porque se agota en rendimientos inmediatos y no abre perspectivas de largo recorrido.

62 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

Defendemos una formacin universitaria equilibrada y exigente, en la que no se tenga miedo al esfuerzo, y en la que el objetivo inmediato sea la mejora y la calidad educativas, como manera de competir y estar a una altura educativa comparable con la de los mejores del mundo. En esta lnea, y siendo conscientes de que en la formacin del universitario es fundamental insertar ms prcticas en los estudios, Gabilondo (2008) cree que una formacin integral, que incluya adems de conocimientos otras competencias, puede ser la clave para mejorar la insercin laboral de los universitarios. La OCDE est preparando una evaluacin internacional para comparar las capacidades de los universitarios que estn a punto de terminar su carrera, qu saben hacer con los conocimientos adquiridos (AUNIN, 2008). La idea es hacer una prueba escrita que mida el pensamiento crtico y las capacidades de resolucin de problemas necesarios para tener xito acadmicamente y en el mundo laboral, adems de las cuestiones concretas sobre el rea de conocimiento que se est estudiando. Todo ello teniendo en cuenta el contexto histrico, lingstico y cultural, y las diferencias existentes entre el currculum de los diferentes pases, la duracin de los estudios y las tasas de acceso. Tenemos una nueva oportunidad de mejora, porque la estrategia de Lisboa para 2010 marca unos objetivos, que son acabar con el fracaso escolar y aumentar el acceso a carreras tcnicas. Despus de una seria reflexin sobre las causas del problema, llega ya el momento de la accin y del contraste de resultados en trminos de eficacia y eficiencia.

Referencias bibliogrficas
AGUILERA, B. (2007). Estudiar en Finlandia. ABC. Opinin. 10 de diciembre, 7. ALBERT, M. J. (2007). Se precisa atencin individualizada. El Pas. Sociedad. 5 de diciembre, 44. ANSORENA, J. (2007). El pesimismo de los profesores sobre el futuro de la educacin. Expansin. Empresas. 13 de marzo, 44. ANSORENA, J. (2008). Los chicos con las chicas?. Expansin. Poltica. 17 de marzo, 32. ASENJO, M. (2007). Espaa, cuarto pas de Europa en comprensin lectora de nios de 10 aos. ABC. Educacin. 4 de diciembre, 29. ASENJO, M. (2008). La ciencia va al colegio. ABC. Educacin. 25 de marzo, 27. AUNIN. J. A. (2007a). Buen profesor, mejor resultado. El Pas. Sociedad. 4 de diciembre, 37. AUNIN, J. A. (2007b). La educacin espaola retrocede. El Pas. Sociedad. 5 de diciembre, 40. AUNIN, J. A. (2007c). Leer ms de tres lneas sin perderse. El Pas. Sociedad. 3 de diciembre, 45. AUNIN, J. A. (2008). El huracn PISA llega a la Universidad. El Pas. Sociedad. 4 de febrero, 39. BELTRN, M. (2007). Problema matemtico por resolver. La Vanguardia. Sociedad. 30 de junio, 31 32. BENITO, R. (2008). Ms reformas y los mismos problemas. El Mundo. Educacin. 13 de febrero, 16. BOLVAR, A. (2007). Esto no es la liga de ftbol. El Pas. Sociedad. 5 de diciembre, 42. BOONE, J. & ANSORENA, J. (2006). Los primeros de la clase. Expansin. Entorno. 16 de noviembre, 44. BUEB, B. (2007). Elogio de la disciplina. Madrid: CEAC. BUSTOS, J. (2008). Ensear menos en ms tiempo. Los cuatro hndicaps de la enseanza. La Gaceta, 12 de mayo, 9. CABRERA, M. (2007). En J. CRUZ, No saber leer es peor que fumar. El Pas. Sociedad. 8 de diciembre, 3233. CALVO, M. (2008). En R. COBO, La educacin personalizada por sexos, una solucin hacia el xito escolar. La Gaceta de los negocios. Civilizacin. 23 de enero, 37. CAMPOS, J. (2007). Informe PISA, espejo de una realidad con ms sombras que luces. Pblico. Opinin, 18 de diciembre, 10. CASABELLA, J. (2007a). 100 preguntas sobre el suspenso educativo. El Peridico. El tema del da. 4 de diciembre, 27.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

63

Presentacin A. Garca Caballero

CASABELLA, J. (2007b). La primaria vuelve a medio curso a las notas del insuficiente al sobresaliente. El Peridico. El tema del da. 18 de diciembre, 23. CASTILLO, S. (2008). La pizarra digital sustituye a la tiza. El Mundo. Yo Dona. Reportaje. 15 de marzo, 124125. COBO, R. (2008). La educacin personalizada por sexos, una solucin hacia el xito escolar. La Gaceta de los negocios. Civilizacin. 23 de enero, 37. COLL, C. (2007). En Y. GONZLEZ, Un sistema educativo que no logra levantar el vuelo. Pblico. Actualidad. 4 de diciembre, 33. CONDE, L. (2008). Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. CRUZ, J. (2007). No saber leer es peor que fumar. El Pas. Sociedad. 8 de diciembre, 3233. ESPA, Y. (2007). En J. CASABELLA, La primaria vuelve a medio curso a las notas del insuficiente al sobresaliente. El Peridico. El tema del da. 18 de diciembre, 23. FERNNDEZ, T. (2007). La perspectiva demasiado optimista de los escolares. Expansin. Empresas. 13 de marzo, 44. FERNNDEZ VALLEJO, M. (2008). El modelo filands. El Diario Vasco. Portada. 18 de febrero, 6. GABILONDO, A. (2008). Es fundamental insertar ms prcticas en los estudios. Infoempleo. Especial. 2 de marzo, 4044. GONZLEZ, Y. (2007). Un sistema educativo que no logra levantar el vuelo. Pblico. Actualidad. 4 de diciembre, 33. GRAU, A. (2008). Pizarra con tizas en la era de Internet. El Pas. 8 de abril, 3031. GUARRO, A. (2007). En J. A. AUNIN, Leer ms de tres lneas sin perderse. El Pas. Sociedad. 3 de diciembre, 45. GUZMN, M. J. (2007). Los secretos de la buena educacin. El diario de Sevilla RDO, 16 de diciembre, 24. HARTMANN, M. (2008). En L. CONDE, Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. JANER, M. (2008). Triunfar en el bachillerato. La Gaceta de los negocios. Ocio. 16 de febrero, 710. J. A. A. (2007). La cultura de los padres predispone al xito escolar de los alumnos. El Pas. Sociedad. 5 de diciembre, 42. J. M. (2008). La educacin valenciana apuesta por la calidad. La Razn. Cultura. 2 de febrero, 48. LLANO, A. (2007). Educacin en Espaa. La Gaceta de los negocios. Opinin. 20 de enero, 3. LURI, G. (2008). Harto de Finlandia!. La Vanguardia. Opinin. 25 de febrero, 28. MARQUES, P. (2008). En A. GRAU, Pizarra con tizas en la era de Internet. El Pas. 8 de abril, 3031. MEHLHORN, H. G. (2008). En L. CONDE, Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. MONGE, J. (2008). En M. A. CRIADO, Internet y el ordenador no han cambiado la enseanza. Pblico. Tecnologa. 17 de marzo, 34. MUOZ, M. (2007). La educacin de los hijos. ABC. Cartas al director. 8 de diciembre, 8. PALACIOS, J. (2008). En L. CONDE, Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. PASTOR, A. (2007). En L. A. SANZ, Los alumnos espaoles son los que ms bajan de la OCDE en comprensin lectora. El Mundo. 5 de diciembre, 2021. PEDRERO, P. (2007). Toda la culpa. La Razn. 8 de diciembre, 80. PEDR, F. (2007). Polticas educativas y evidencias. La Vanguardia. Opinin. 31 de enero, 20. PREZ, A. (2007). La ciencia de la enseanza en una pgina web. El Mundo. Aula. 15 de marzo.

64 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

Propuestas de solucin para los problemas educativos de hoy

PFEIFFER, C. (2008). Los perdedores de Pisa: vctimas del consumo meditico. En L. CONDE, Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. PRADES, J. (2007). El pesimismo de los expertos. El Pas. Gente. 10 de diciembre, 44. ROBLES, E., BARRIOS, A. & CABALLERO, P. A. (2006). Estudio comparativo de los sistemas educativos lderes en la evaluacin internacional. Madrid: Universidad Camilo Jos Cela. R. N. (2007). Problemas sin respuesta. La Razn. Espaa. 17 de diciembre, 15. ROYO, P. (2007). Las matemticas como aprendizaje para la vida. La Vanguardia. Sociedad. 30 de junio, 32. RUEDA, L. G. (2008). La LOE rebaja el listn de las escuelas oficiales de idiomas. La Razn. Sociedad. 25 de febrero, 33. R. V. (2007). Contra el fracaso escolar, el modelo valenciano. La Razn. Sociedad. 12 de febrero, 34. SANZ, L. A. (2007). Los alumnos espaoles son los que ms bajan de la OCDE en comprensin lectora. El Mundo. 5 de diciembre, 2021. SNCHEZ DE LA NIETA, G. (2007). Mejorar el gasto en enseanza no siempre trae mejores resultados. La Gaceta de los Negocios. Espaa. 4 de diciembre, 10. SNCHEZVALLEJO, M. A. (2008). Nios y nias separados contra el fracaso escolar. El Pas. Opinin. 13 de febrero, 3637. SCHLEICHER, A. (2007). Espaa ha mejorado su educacin muy rpido, pero an est retrasada. El Pas. Educacin. 3 de diciembre, 46. SEGARRA, E. (2008). Quin le pone el cascabel al gato?. La Vanguardia. Opinin. 26 de febrero, 26. SEGURA, M. (2008). En A. GRAU, Pizarra con tizas en la era de Internet. El Pas. 8 de abril, 3031. SEVILLANO, E. (2008). Maestros creativos se unen en red. El Pas. Sociedad, 4 de febrero, 40. SOLANES, J. M. (2009). Educacin mixta o diferenciada?. La Gaceta. Negocios, 6 de marzo, 46. SPITZER, M. (2008). En L. CONDE, Permitir que elijan su futuro con el corazn. Cinco Das. Economa. 29 de febrero, 4445. S. T. (2007). Menos gramtica y ms leer y escribir. El Pas. Sociedad. 5 de diciembre, 44. VIDAL, E. (2007). En J. PRADES, El pesimismo de los expertos. El Pas. Gente. 10 de diciembre, 44. VILA, I. (2007). Las aulas de acogida. La Vanguardia. Opinin. 9 de diciembre, 28.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 5365

65

INCLUSIN, CONVIVENCIA Y CULTURA DE PAZ EN LAS AULAS

REFERENCIA: Francisco, Andrea & Moliner, Lidn (2010). El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (dd-mm-aa):)

El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica


AndreaFRANCISCOAMAT LidnMOLINERMIRAVET
Correspondencia: AndreaFranciscoAmat Correoelectrnico: afrancis@edu.uji.es LidnMolinerMiravet Correoelectrnico: mmoliner@edu.uji.es Telfono: 964729899 Fax: 964729264 Direccinpostalcomn: UniversidadJaumeI Fac.deCC.HumanasySociales DepartamentodeEducacin Av.deVicentSosBaynat,s/n. 12071CastellndelaPlana (Espaa) Recibido:15deabrilde2010 Aceptado:18deoctubrede2010

RESUMEN
ElAprendizajeServicio(APS)esunapropuestaquepartedel servicio voluntario a la comunidad y de la adquisicin de aprendizajesyloscombinaenunsoloproyecto.Elpresente artculo tiene como finalidad difundir la experiencia de innovacineducativadeAPSquesehadesarrolladodurante elcurso2009/2010enlaUniversitatJaumeIdeCastellnde laPlana(Espaa).Lainiciativa,quesehallevadoacabopor unequipodocenteinterdisciplinarformadoporprofesorado deMagisterio,PsicopedagogayComunicacinAudiovisual, buscaba despertar la conciencia crtica y la participacin ciudadana entre los miembros de la comunidad universitaria. PALABRAS CLAVE: Aprendizaje Servicio, Ciudadana, Transformacinsocial.

Service learning at university: a strategy in training critical citizens


ABSTRACT
Service Learning (SL) is a proposal which emerges from the volunteer service to the community and fromskillsacquisition,combiningtheminasinglearticulatedproject.Thegoalofthisarticleistodiscuss anSLinnovationexperiencewhichtookplaceintheacademicyear20092010attheUniversitatJaume I in Castell de la Plana (Spain). This initiative was implemented by an interdisciplinary teaching team formed by the academic staff in the Teaching Education, Psychopedagogy and Audiovisual
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

69

Andrea Francisco & Lidn Moliner

Communicationdegrees.Itaimstoawakencriticalawarenessandpromotecitizenparticipationamong alluniversitymembers. KEY WORDS: LearningService,Citizenship,SocialTransformation.

Introduccin
Estamos viviendo en la llamada sociedad de la informacin (APARICI, 2003; BAUMAN, 2007; CASTELLS, 2001) y nuestro sistema educativo requiere de nuevas formas de enseanzaaprendizaje que respondan a las demandas actuales. Como apunta el Informe Delors (1996), no se trata slo de aprender a conocer, sino tambin de aprender a hacer, aprender a vivir y aprender a ser. En este contexto, las universidades europeas estn culminando la configuracin de los Grados y Msters con un nuevo modelo conceptualizado como Aprendizaje Basado en Competencias, las cules son definidas por la OCDE como la combinacin de habilidades prcticas, conocimientos, motivacin, valores ticos, actitudes, emociones y otros componentes sociales que se movilizan conjuntamente para lograr una accin eficaz (HERSH ET AL., 1999). Se parte de una visin y misin de la Universidad como espacio y actor transformador de la sociedad. Se exige la presencia general de elementos educativos claves que impulsen una formacin de todos para la ciudadana global y no una oferta reducida en un campo formativo especializado (postgrado, congresos, acciones singulares) o para un grupo de profesionales especficos (GEHRING, 2008). El proceso de enseanzaaprendizaje se vuelve cada vez ms complejo y requiere de nuevas metodologas y frmulas. Una buena herramienta que se abre camino es el Aprendizaje Servicio (APS). A travs de ella se aglutina el aprendizaje de diferentes competencias bsicas o especficas, como son el trabajo en equipo interdisciplinar, las habilidades en las relaciones personales, el compromiso tico o el razonamiento crtico (ANECA, 2005). En el presente artculo desarrollaremos, en primer lugar, el significado y fundamentacin del APS para abordar, a continuacin, el proyecto llevado a cabo en la Universitat Jaume I (UJI). Finalmente, analizaremos diferentes tipos de transformaciones que se estn observando a raz de esta experienciai.

1. Fundamentos del Aprendizaje Servicio


Los dos antecedentes clave en la gestacin del APS los encontramos a partir de la corriente educativa liderada por John Dewey (1916, 1938) y William James (1984). En la dcada de los aos 20 aparecen las primeras experiencias sobre APS, y es en 1969 cuando se describe por primera vez como una tarea necesaria para el crecimiento educativo en la I Conferencia Nacional sobre Aprendizaje Servicio celebrada en EE.UU. A pesar de que han pasado casi cuarenta aos desde esta primera aproximacin y consolidacin del concepto de APS, en la actualidad se concibe como una propuesta innovadora. Se trata de una metodologa actual pero que cuenta con elementos sobradamente conocidos por todos, como son el servicio voluntario y la transmisin de conocimientos y valores. El elemento innovador consiste en vincular estrechamente servicio y aprendizaje en una sola actividad educativa bien articulada y coherente (PUIG & PALOS, 2006). Como ocurre con muchos otros fenmenos sociales y educativos, no existe una nica definicin sobre el APS. En la literatura nacional e internacional encontramos una gran cantidad de terminologas para referirnos a esta metodologa, hecho que hace ms complejo el concretar y aportar una nica definicin sobre el tema. En el cuadro que presentamos a continuacin ofrecemos algunas de las definiciones sobre el APS que muestran sus diferentes dimensiones:

70 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica

mbito Internacional El APS se traduce en proyectos pedaggicos de servicio comunitario, integrados en el currculum, en los que los estudiantes aplican, verifican y profundizan los aprendizajes aportando a la solucin de un problema comunitario, permitiendo al estudiantado descubrir, aplicar y profundizar los conceptos disciplinarios en su vnculo con situaciones reales y la resolucin de problemas concretos. El APS es una forma de educacin basada en la experiencia, en la que el aprendizaje se produce a travs de un ciclo de accin y reflexin gracias al cual los estudiantes trabajan con otros compaeros en un proceso de aplicacin de lo que han aprendido a los problemas de la comunidad y, al mismo tiempo, reflexionan sobre la experiencia de perseguir objetivos reales para la comunidad e incrementar su propia comprensin y destrezas, es decir, desarrollan de manera conexa las mltiples dimensiones humanas y cultivan la responsabilidad cvica y social. El APS es una forma de aprendizaje experiencial, una expresin de valores servicio a los dems que determina el objetivo, la naturaleza y el proceso de un intercambio social y educativo entre los estudiantes y las personas a las que ellos sirven, y entre los programas de educacin y las organizaciones comunitarias con las que ellos trabajan. mbito Nacional Lo conciben como una propuesta educativa que combina procesos de aprendizaje y de servicio a la comunidad en un solo proyecto bien articulado, en el que los participantes se forman al trabajar sobre necesidades reales del entorno con el objetivo de mejorarlo El APS es un mtodo de enseanza que enfatiza tanto el aprendizaje acadmico que se desarrolla en el aula, como la realizacin de un servicio voluntario a favor de las necesidades detectadas en la comunidad prxima. El APS se define como un servicio solidario protagonizado por los estudiantes, destinado a atender necesidades reales y efectivamente sentidas de una comunidad, planificado institucionalmente de forma integrada con el currculo, en funcin del aprendizaje de los estudiantes.

Ministerio de Educacin chileno, 2007

Eyler & Gilers, 1999

Stanton, 1990

Puig & Palos, 2007

MartnezOdra, 2007

Tapia, 2005

CUADRO 1. Definiciones APS Por su parte, Puig et al. (2009) dividen la definicin del trmino en cuatro bloques temticos que pueden ayudar a comprenderla con ms precisin: La esencia del APS: pretende sealar sus elementos ms bsicos e imprescindibles. Dar respuesta a necesidades reales de la sociedad, llevar a cabo un servicio de utilidad y obtener aprendizajes vinculados al currculo. La pedagoga del APS: pretende basarse en la experiencia real vivida por el estudiantado. Impulsar la participacin, organizar procesos de cooperacin, tomar conciencia de lo vivido y buscar el xito del proyecto, as como su reconocimiento y celebracin. El trabajo en red con la comunidad. Colaborar con otras instituciones y entidades sociales y ofrecer al estudiantado posibilidades de servicio. Las finalidades del APS: pretenden explicitar los motivos que promueven la realizacin de estos proyectos. Impulsar la educacin en valores a travs de su prctica, favorecer el

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

71

Andrea Francisco & Lidn Moliner

compromiso cvico y usar el conocimiento como una herramienta de la mejora de la calidad de vida. Para finalizar, lo que parece estar claro es que, a pesar de las innumerables definiciones, existe consenso al sealar dos componentes bsicos del APS. Por una parte, el aprendizaje eficaz y de calidad de contenidos conceptuales, procedimentales y actitudinales ligados al currculum. Por la otra, el servicio y la labor voluntaria que desemboca en la transformacin de la comunidad.

2. Construyendo ciudadana en la comunidad universitaria a travs del APS.


DEFINIENDO EL CONTEXTO DE ACTUACIN Esta iniciativa se desarroll en la Universidad Jaume I de Castelln dentro del proyecto denominado Experiencias de aprendizaje servicio con grupos interdisciplinares de educacin y comunicacin en temas de ciudadana y cultura de paz, financiado por la Unidad de Apoyo Educativo de dicha institucin. Para ello utilizamos el APS como metodologa de enseanzaaprendizaje en el seno de tres asignaturas: Educacin Cvica y Social, Discursos Audiovisuales y Cultura de Paz y Didctica General. En esta primera experiencia, llevada a cabo durante el primer semestre del curso acadmico 2009/2010, participaron un total de 162 alumnos pertenecientes a las titulaciones de Maestro, Comunicacin Audiovisual y Psicopedagoga. Pensamos que era crucial que nuestro alumnado se acercara a la realidad y prestara un servicio a la comunidad trabajando de una forma interdisciplinar y teniendo en cuenta el marco terico de las diferentes asignaturas. Por otra parte, consideramos esencial aunar dos disciplinas que tradicionalmente han estado separadas en el mbito universitario: las Ciencias de la Comunicacin y la Educacin. Si los medios de comunicacin forman parte omnipresente de nuestra vida cotidiana, y si estamos de acuerdo en que son agentes socializadores fundamentales a la hora de configurar el imaginario colectivo (APARICI, 2003, 2008; BUCKINGHAM, 2005; FERRS, 2000, 2006, 2008; JENKINS, 2008; MASTERMAN, 1993; MIRALLES, 2003; MORDUCHOWICZ, 2003, 2008; PREZ TORNERO, 2000; TYNER & LLOYD, 1995), se torna fundamental que los profesionales de ambas disciplinas puedan

enriquecerse mutuamente para afrontar los retos sociales actuales.


OBJETIVOS Y METODOLOGA Dos fueron los ejes bsicos que nos planteamos en este proyecto. Por una parte, desarrollar en el alumnado competencias bsicas como el trabajo en equipos interdisciplinares, el respeto a la diversidad o el desarrollo de habilidades comunicativas y sociales. Y por otra, promover la participacin, la ciudadana activa y la cultura de paz en la comunidad universitaria; despertando la conciencia social, la solidaridad y el compromiso con el entorno del estudiantado. La metodologa que planteamos en las asignaturas del proyecto supone un cambio radical de la funcin docente en la Universidad que coincide con la filosofa del Espacio Europeo de Educacin Superior (DE MIGUEL, 2006; ZABALA, 2006). Se trata de que el alumnado sea el centro y el elemento activo de toda la propuesta, mientras el equipo docente pasa a tener el rol de facilitador de contextos y materiales que mejoren las condiciones de aprendizaje. Para ello, los ejes centrales de la planificacin de las asignaturas fueron el trabajo autnomo (MARTNEZFERNNDEZ & RABANAQUE, 2008; ROMERO & PREZ, 2009) y las tutoras grupales (LVAREZ & GONZLEZ, 2008). Semanalmente, los equipos de trabajo tenan que elaborar una fase del proyecto (ver cuadro 2) y presentarla en la tutora con las docentes para revisar y orientar la tarea. Adems, se realizaron plenarios para reflexionar sobre algunos conceptos bsicos de la sociedad actual y una exposicin final de todos los trabajos. Por otra parte, se utiliz el Aula Virtual para publicar las guas de las asignaturas y el material bibliogrfico; para las sucesivas entregas de los trabajos, permitiendo una mayor flexibilidad y, por ltimo, como espacio de comunicacin entre los estudiantes y el equipo docente. Como hemos apuntado, el alumnado, dividido en grupos heterogneos, desarroll sus proyectos a partir de cinco fases de accin, adaptadas de las propuestas de Tapia (2006).

72 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica

Fase I. Seleccin del tema y del mbito donde prestar el servicio

Objetivos Expresar los fundamentos objetivos y el marco terico que justifica la eleccin de dicho proyecto. Diagnosticar las necesidades de junto con la entidad, delimitar los objetivos y acordar las pautas de trabajo y el calendario de acciones. Disear las estrategias y la metodologa, definir y producir los recursos necesarios para llevar a cabo la intervencin. Observar, registrar y analizar la incidencia del servicio prestado a la comunidad. Reflexionar y valorar el proyecto final y las transformaciones generadas. Elaborar un nuevo plan de accin a partir de la experiencia. CUADRO 2. Fases del APS

Temporalizacin 1 Semana

II. Contacto con el centro receptor del servicio

2 semana

III. Preparacin de la actividad, metodologa y produccin material

3 y 4 semana

IV. Aplicacin

5, 6 y 7 semana

V. Evaluacin

8 semana

LOS PROYECTOS: DE LA TEORA A LA PRCTICA En el APS se pueden plantear varios tipos de servicios: directo, indirecto, de advocacy o de investigacin (LUCAS, 2007). En este caso, todo el estudiantado eligi realizar intervenciones directas, actividades que requeran una relacin cara a cara con las personas a las que se les prestaba el servicio para transformar la realidad. Se desarrollaron 23 proyectos; cada uno de ellos buscaba trabajar un valor o temtica relacionada con la educacin cvica y se llevaba a cabo en un mbito concreto de actuacin. Concretamente, 14 grupos trabajaron en el campo de la educacin formal (realizando intervenciones educativas en centros de Infantil, Primaria y Secundaria) y 9 trabajaron en el espacio pblico (organizando campaas, cineforums y actividades en la ciudad). Las temticas que eligieron estn integradas en 4 grandes reas: los valores relacionados con la interculturalidad y el respeto a la diversidad; los relativos al cuidado del medio ambiente; los que abordan la igualdad, y los que hacen referencia a la ciudadana crtica. En las propuestas que se llevaron a cabo, se encuentran diversas campaas realizadas en la UJI. Entre ellas, la de gotas diferentes pero gotas iguales, que buscaba potenciar la diversidad personal y cultural en las aulas a travs de un blog y una accin colectiva en el gora de la universidad. Con temtica medio ambiental, se elabor una videocampaa Respeta a los animales con el objetivo de dar a conocer la labor de la protectora de animales de Castelln. En esta misma lnea, encontramos la iniciativa Lo permitiras? para concienciar sobre la importancia de recogida de los vehculos abandonados, que cont con la financiacin del Ayuntamiento de VilaReal y la cobertura del proyecto por parte de los medios de comunicacin locales. O el cortometraje No ser tolerante te afecta, que trabajaba el tema del respeto a la diversidad en la orientacin sexual y que, adems de publicarse en el blog de la campaa, fue exhibido en la UJI y en centros de Educacin Secundaria. En el espacio de la universidad tambin se llevaron a cabo sesiones de Cine forum. Por ejemplo, bajo el lema Dona publicada, dona maltractada (Mujer publicada, mujer maltratada) se organizaron unas Jornadas en torno a la violencia de las mujeres en el discurso meditico. Para el debate se cont con la red de mujeres feministas de la provincia, con el colectivo Dones de Negre (Mujeres de negro), con la Fundacin Isonoma y con diversos actores del sector audiovisual. Para la difusin de todas estas iniciativas se elaboraron carteles y flyers informativos, se recurri al servicio de comunicaciones de la UJI, se crearon blogs y se aprovecharon las redes sociales como

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

73

Andrea Francisco & Lidn Moliner

Facebook y Tuenti. Los blogs, adems, permitieron dar continuidad al proyecto ya que el material elaborado sigue a disposicin de toda la comunidad. Este uso de las nuevas tecnologas fue innovador, motivador y facilitador de la creacin de redes y la construccin colectiva del conocimiento (JENKINS, 2008). Por otra parte, para los proyectos que se realizaron en los centros educativos se elaboraron unidades didcticas sobre valores, se crearon canciones y obras de teatro, y se produjeron materiales que fueron cedidos a los centros para su utilizacin en futuras actividades. Todos estos recursos se adaptaron a los diferentes contextos y a las diversas necesidades de cada centro. Al finalizar, tras la observacin de su aplicacin, se reelaboraron las propuestas didcticas, una actividad inspirada en la metodologa de investigacinaccin que busca la mejora de la prctica educativa mediante su constante reflexin en espirales de planificacin, accin, observacin y reflexin (CARR & KEMMIS, 1988; ELLIOTT, 1990 y 1993; LATORRE, 2003; TAYLOR & BOGDAN, 1987).

3. Transformaciones del proceso de enseanzaaprendizaje


En este apartado, explicaremos los cambios que este proyecto ha generado tanto en el alumnado como en el profesorado. EN EL ESTUDIANTADO En las reflexiones realizadas en la fase de evaluacin, han valorado muy positivamente la experiencia y el aprendizaje producido. Los dos aspectos que ms han destacado de esta propuesta de APS han sido: la autonoma y la conexin con la prctica. En primer lugar, el hecho de que el alumnado pudiese escoger libremente la temtica y el mbito de trabajo, ha contribuido a una mayor motivacin y a la apropiacin del proyecto por parte de los grupos, llegando incluso a la realizacin de acciones que no eran requisito para aprobar las asignaturas. Por otra parte, el hecho de organizar las clases en torno a tutoras grupales y a trabajo autnomo no presencial, les permiti una mejor gestin del tiempo y una atencin individualizada de los proyectos por parte del equipo docente. La otra cuestin que apuntaron fue la oportunidad de aplicar sus ideas a la realidad, observando las repercusiones en el entorno y en ellos mismos. Adems, la experiencia les ayud a ser conscientes de la necesidad de adaptacin y reflexin continua a la hora de realizar cualquier accin que pretenda incidir en un entorno humano. Todo este proceso les llev a la adquisicin de una serie de competencias que estaban planteadas en los objetivos de las asignaturas. Por una parte, se gener un contexto de trabajo en equipos multidisciplinares que les dio la oportunidad de desarrollar habilidades sociales y cooperativas, como son el dilogo, la escucha activa, el consenso, la negociacin, la asertividad, la empata, el respeto, la solidaridad o el compromiso (RUIZ, 2010; PICAZO, ZORNOZA & PEIR, 2009; MENDA, 2009). Por otra parte, el alumnado tuvo que fundamentar tericamente su intervencin, lo que provoc una reflexin profunda sobre las repercusiones de la sociedad de la informacin en el momento actual. Finalmente, al tener que participar e implicarse en proyectos de transformacin de su entorno, se despert la conciencia social, la solidaridad y la responsabilidad cvica. ...EN EL PROFESORADO El equipo docente ha transformado sus prcticas educativas. Ha organizado las asignaturas situando al alumnado como eje central de la planificacin. Para ello, ha suprimido las clases magistrales y las ha sustituido por tutoras grupales, y ha cambiado los exmenes tradicionales por la evaluacin continua basada en la creacin de un proyecto grupal. Como destacan Andreu, Sanz Torrent & Serrat Sellabona (2009), esta organizacin implica un gran esfuerzo dinamizador e innovador por parte del profesorado pero se traduce en una mejora del proceso de enseanzaaprendizaje. Se genera un clima de mayor confianza con el estudiantado que permite un cambio en las relaciones entre el profesorado y el alumnado al crearse las condiciones adecuadas para un dilogo ms igualitario y sincero (AUBERT ET AL., 2009; FLECHA, 1997; FREIRE, 1988, 1997). Por otra parte, se ha iniciado un proceso de coordinacin en dos campos del conocimiento que tradicionalmente han estado separados: la Educacin y las Ciencias de la Comunicacin, generando un espacio interdisciplinar que ha enriquecido el conocimiento y la mirada del profesorado implicado. Este proceso ha provocado en el profesorado un cambio en la concepcin de los planes de estudios universitarios, entendiendo los aprendizajes de las asignaturas como parte de un todo que no est

74 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica

parcelado. En este sentido, la Universidad debera encontrar ms canales de interaccin para que el alumnado entendiera su formacin de manera integral. Del mismo modo, la iniciativa ha supuesto una oportunidad de crecimiento para el equipo docente al tener que coordinarnos, negociar y consensuar desde el planteamiento inicial hasta la evaluacin de las asignaturas. A pesar de suponer un trabajo extra, ha servido de elemento revitalizador y motivador. De hecho, el xito de estas iniciativas guarda una estrecha relacin con la creacin de equipos de trabajo que acaban construyendo redes ms amplias de colaboracin. La labor docente no debe entenderse como un camino solitario porque puede llevar al cansancio y a la frustracin; generar espacios de convivencia e intercambio favorece un mayor dinamismo, motivacin y satisfaccin profesional (PACHECO, 2008; RODRGUEZ, 2007). En definitiva, el APS es una metodologa que responde a muchos de los retos que se plantean en la sociedad actual y en el nuevo marco europeo de Educacin Superior, promoviendo una de las funciones bsicas de la Universidad: la formacin de ciudadanos crticos, activos y responsables con su entorno.

Referencias bibliogrficas
AGENCIA NACIONAL DE EVALUACIN DE LA CALIDAD Y ACREDITACIN (2005). Libro blanco para el ttulo de grado en magisterio. Madrid: ANECA. LVAREZ, P. R. & GONZLEZ, M. C. (2008). Anlisis y valoracin conceptual sobre las modalidades de tutora universitaria en el espacio europeo de Educacin superior. Revista Interuniversitaria de Formacin del Profesorado, 22(1): 4971. APARICI, R. (Coord.) (2003). Comunicacin educativa en la sociedad de la informacin. Madrid: UNED. APARICI, R. & GARCA, A. (2008). Lectura de imgenes en la era digital. Madrid: De la Torre. AUBERT, A. ET AL. (2009). Aprendizaje dialgico en la Sociedad de la Informacin. Barcelona: Hipatia. ANDREU LL., SANZ, M. & SERRAT, E. (2009). Una propuesta de renovacin metodolgica en el marco del Espacio Europeo de Enseanza Superior: los pequeos grupos de investigacin cooperativos. REIFOP, 12 (3), 111126 (Enlace web: http//www.aufop.com Consultada en fecha (3003 10). BAUMAN, Z. (2007). Vida de consumo. Madrid: Fondo de Cultura Econmica. BUCKINGHAM, D. (2005). Educacin en medios. Alfabetizacin, aprendizaje y cultura contempornea. Barcelona: Paids. CARR, W. & KEMMIS, S. (1988). Teora crtica de la enseanza. La investigacin accin en la formacin del profesorado. Barcelona: Martnez Roca. CASTELLS, M. (2001). La era de la informacin. Vol. 1. La sociedad red. Madrid: Alianza. CHILE, MINISTERIO DE EDUCACIN. (2007). Manual de Aprendizaje Servicio. Chile: Mineduc. DE MIGUEL, M. (2006). Metodologas para optimizar el aprendizaje: segundo objetivo del Espacio Europeo de Educacin Superior. Revista interuniversitaria de formacin del profesorado, 57, 7192. DELORS, J. (1996). Informe Delors. La educacin encierra un tesoro. Madrid: UNESCOSantillana. DEWEY, J. (1938). Experience and education. New York: MacMillan ELLIOTT, J. (1990). La investigacinaccin en educacin. Madrid: Morata. ELLIOTT, J. (1993). El cambio educativo desde la investigacinaccin. Madrid: Morata. EYLER, J. & GILERS, D. E. (1999). Wheres the learning in serviceleraning? San Francisco: JosseyBass. FERRS, J. (2000). Educar en una cultura del espectculo. Barcelona: Paids. FERRS, J. (Ed.) (2006). Com veure la televisi. Barcelona: Consell de lAudiovisual de Catalunya.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

75

Andrea Francisco & Lidn Moliner

FERRS, J. (2008). La educacin como industria del deseo: un nuevo estilo comunicativo. Barcelona: Gedisa. FLECHA, R. (1997). Compartiendo palabras. El aprendizaje de las personas adultas a travs del dilogo. Barcelona: Paidos. FREIRE, P. (1988). Pedagoga del oprimido. Madrid: Siglo XXI. FREIRE, P. (1997). A la sombra de ste rbol. Barcelona: El Roure. GEHRING, H. (2008). Anlisis de las competencias genricas del modelo aprendizaje basado en competencias en el diseo de las nuevas titulaciones del EEES como espacio transversal para la integracin de elementos de la educacin para el desarrollo, en Actas IV Congreso Universidad y Cooperacin al Desarrollo, Barcelona. HERSH, L., SIMONE, D., MOSER, U. & KONSTANT, J. (1999). Proyectos sobre competencias en la OCDE. Pars: OCDE. JAMES, W (1984). The moral equivalent of war. En B. WILSHIRE (Ed.) William Jamas: The essential writings. Albany, NY: State University of New York Press: 349361. JENKINS, H. (2008). Convergence culture. La cultura de la convergencia de los medios de comunicacin. Barcelona: Paids. LATORRE, A. (2003). La investigacinaccin. Conocer y cambiar la prctica educativa. Barcelona: Gra. LUCAS, S. (2007). Desarrollo de las competencias Preocupacin por la calidad y Motivacin de logro desde la docencia universitaria. Red U. Revista de Docencia Universitaria, Nmero 2. Consultado (08/04/2010) en http://www.redu.um.es/Red_U/2. MARTNEZFERNNDEZ, J. R. & RABANAQUE, S. (2008). Autorregulacin y trabajo autnomo del estudiante en una actividad de aprendizaje basada en las TIC. Anuario de Psicologa, 39(3): 311331. MARTNEZODRA, A. (2007). ServiceLearning o AprendizajeServicio. La apertura de la escuela a la comunidad local como propuesta de educacin para la ciudadana. Bordn, 59(4), 611626.

MASTERMAN, L. (1993). La enseanza de los medios de comunicacin. Madrid: La Torre.


MENDA, R. (2009). Aprendizaje y servicio solidario: una propuesta educativa para el desarrollo de la competencia ciudadana. Organizacin y Gestin Educativa, 17(2), 710. MIRALLES, R. (Coord.) (2003). Medios de comunicacin y educacin. Barcelona: Cisspraxis. MORDUCHOWICZ, R. (2003) Comunicacin, medios y educacin: un debate para la educacin en democracia. Barcelona: Octaedro. MORDUCHOWICZ, R. (2009). Los jvenes y las pantallas: nuevas formas de sociabilidad. Barcelona: Gedisa. PACHECO, J. L. (2008). Los grupos de trabajo de profesores como estrategia de mejora. Profesorado. Revista de Currculum y Formacin del profesorado, 2(1). PREZ TORNERO, J. M. (Coord.) (2000). Comunicacin y educacin en la sociedad de la informacin. Barcelona: Paids. PICAZO, C., ZORNOZA, A. & PEIR, J. M. (2009). Los procesos de participacin social y participacin orientada a la tarea y el aprendizaje como antecedentes de la cohesin grupal. Una perspectiva longitudinal. Psicothema, 21(2), 274279. PUIG, J. M. & PALOS, J. (2006). Rasgos pedaggicos del aprendizajeservicio. Cuadernos de Pedagoga, 357, 6063. PUIG, J. M. ET AL. (2009). Aprendizaje Servicio. Educacin y compromiso cvico. Barcelona: Gra. RODRGUEZ, J. M. (2007). Espacios de reflexin y de actuacin asociados al quehacer educativo del profesorado. Revista de Ciencias de la Educacin, 210, 205218. ROMERO, M. & PREZ, M. (2009). Cmo motivar a aprender en la universidad: una estrategia fundamental contra el fracaso acadmico en los nuevos modelos educativos. Revista Iberoamericana de Educacin, 51, 87105.

76 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

El Aprendizaje Servicio en la Universidad: una estrategia en la formacin de ciudadana crtica

RUIZ, J. M. (2010). Evaluacin del diseo de una asignatura por competencias, dentro del EEES, en la carrera de Pedagoga: Estudio de un caso real. Revista de Educacin, 351, 435460. STANTON, T. (1990). Service Learning: Groping toward a definition. En KENDALL ET AL., Combinig Service and Learning: A resource Book for Community and Public Service (Vol. 1), 65-67. TAPIA, M. N. (2005). La prctica solidaria como pedagoga de la ciudadana activa. Barcelona: Fundacin Jaume Bofia. TAPIA, M. N. (2006). Aprendizaje y servicio solidario en el sistema educativo y las organizaciones juveniles. Buenos Aires: Ciudad Nueva. TAYLOR, S. J. & BOGDAN, R. (1987). Introduccin a los mtodos cualitativos de investigacin. Barcelona: Paids. TYNER, K. & LLOYD, D. (1995). Aprender con los medios de comunicacin. Madrid: La Torre. ZABALA, M. A. (2006). La convergencia como oportunidad para mejorar la docencia universitaria. Revista interuniversitaria de formacin del profesorado, 57, 3770.

i Artculo adaptado de la comunicacin Construyendo ciudadana en la universidad a partir del AprendizajeServicio, presentada en el Congreso Internacional de Docencia Universitaria e Innovacin, Barcelona 2010.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 69-77

77

REFERENCIA: Etxeberra, Flix; Karrera, Iaki & Murua, Hilario (2010). Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco


FlixETXEBERRIAi IakiKARRERA HilarioMURUA
Correspondencia: FlixEtxeberraBalerdi Correoelectrnico: f.etxeberria@ehu.es Telfono: 943018250 Direccinpostal: Fac.FilosofayCCdelaEducacin DepartamentodeTeorae HistoriadelaEducacin CampusGipuzkoa Avda.deTolosa,70 20.018SanSebastin IakiKarreraJuarros Correoelectrnico: inaki.karrera@ehu.es Telfono: 943017038 E.U.deMagisterio OatiEnparantza,1 20018SanSebastin HilarioMuruaCartn Correoelectrnico: hilario.murua@ehu.es Telfono: 945013000 E.U.deMagisterio DepartamentodeTeorae HistoriadelaEducacin CampusdeAraba C/JuanIbezdeSto.Domingo,1 01006VitoriaGasteiz Recibido:17demayode2009 Aceptado:18deoctubrede2010

RESUMEN
Se examinan las respuestas de 200 docentes de Bilbao y Donostia respecto a sus propias competencias en la educacin con alumnos y alumnas inmigrantes. Afirman tenerunbuenniveldeconscienciayactitudes,perotienen menos desarrolladas las competencias relativas a conocimientos y destrezas respecto al trato con alumnado inmigrante. En relacin a su situacin personal, los educadoresas manifiestan bajos niveles de satisfaccin, expectativas y de formacin profesional, sensaciones de abandono, desproteccinydesconocimientodecmoabordarlatarea deeducarconinmigrantes. Afirman conocer la existencia de recursos y dispositivos para enfrentarse a la educacin intercultural y los valoran positivamente, aunque sean consideradoscomoinsuficientes.

PALABRAS CLAVE: Educacin Primaria, Educacin con inmigrantes,Competenciasinterculturalesdelprofesorado.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

79

Flix Etxeberra, Iaki Karrera & Hilario Murua

Intercultural competences of teachers with immigrant students in the Basque Country


ABSTRACT
Thispaperexaminestheresponsesof200teachersinBilbaoandDonostia(Spain)inregardtotheirown competencesinteachingimmigrantschoolchildren.Teacherssaythattheyhavegreatawarenessand remarkable attitudes, but they have less developed competences relating to knowledge and skills in dealingwithimmigrantstudents. Inrelationtotheirpersonalsituation,educatorsindicatelowlevelsofsatisfaction,ofexpectationsand ofprofessionaltraining,andfeelingsofabandonment,ofneglectandoflackofknowledgeonhowto addressthetaskofeducatingimmigrants. Teachers affirm that they know there are resources and mechanisms available to face intercultural educationandtheyvaluedthempositively,althoughtheyconsideredtheminsufficient.

KEY WORDS: PrimaryEducation,Educationwithimmigrants,Interculturalcompetencesofteachers.

1. Educacin intercultural
La Globalizacin nos ha recordado a todos lo plural que es la humanidad. Con ella nuestros pueblos y calles han ido poco a poco cambiando su paisaje humano: la manera de vestir, de relacionarse, de divertirse, etc. Junto con estos cambios han surgido nuevas necesidades en el mbito social y educativo. Necesidades que abarcan a toda la poblacin, a la autctona y a la inmigrante. La pluralidad cultural la podemos vivir como una amenaza a la identidad de los que ya vivamos en este o aquel territorio o, por el contrario, como oportunidad para abrirnos y enriquecernos gracias al contacto e intercambio con otras culturas. Lo que est claro es que cada una de estas opciones nos llevar a construir proyectos muy diferentes y a sufrir consecuencias completamente contrapuestas. El proyecto que definimos pretende aproximarse sin lugar a dudas a la segunda opcin. Sin embargo, no cabe olvidar la complejidad que entraa la construccin de un proyecto que propugne el reconocimiento de todas las culturas, la inclusin de todas ellas en el Proyecto Educativo y que, adems, consiga el xito escolar de todos los alumnos, inclusive en el alumnado de incorporacin tarda y tambin de aquel, que por diversos factores, enfrentan a la escuela y a la sociedad ante un reto ms ambicioso. Para algunos autores un proyecto de este calibre exige un esfuerzo cognitivo y un compromiso elevado por parte de todos los actores, en trminos de flexibilidad, de apertura, de escucha y de observacin (DE NUCHZE, 2004: 9). Somos conscientes de que son muchos los factores que confluyen en el xito de un proyecto de este calibre, nosotros hemos elegido para este trabajo un factor entre otros: el perfil del enseante. Entendido este como la pieza angular del tringulo didctico (enseante/educadoraprendizobjeto de enseanza aprendizaje). Una vez establecida la importancia que tiene el enseante y por ende su formacin tanto inicial como continua, nos fijaremos en algunos aspectos que hacen relevante la necesidad de un perfil profesional concreto. Algunos de estos aspectos nos resultarn obvios, sin embargo, otros los calificaremos de sutiles, ya que pueden atender, a primera vista, a aspectos irrelevantes para la consecucin de un proyecto educativo de esta ndole. Para delimitar el perfil del educador nos hemos fijado en las cinco normas para una pedagoga eficaz marcadas por los autores Tharp, Estrada, Dalton & Yamauchi (2000) y las hemos adecuado a nuestro objetivo que consiste en definir el perfil del educador respecto a las competencias interculturales: a) produccin conjunta de enseantes y estudiantes; b) desarrollar la lengua y la alfabetizacin en todo el currculo; c) crear significado: conectar la escuela con la vida de los estudiantes; d) ensear pensamiento complejo; e) ensear por medio de la conversacin.

80 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

He aqu algunas pinceladas respecto a cada norma: a) La produccin conjunta de enseantes y estudiantes es especialmente importante cuando el enseante y los estudiantes no pertenecen a la misma cultura. La actividad conjunta ayuda a crear un contexto comn de experiencia en la escuela misma, que es vital cuando no existe un contexto cultural compartido (THARP, ESTRADA, DALTON & YAMAUCHI, 2000: 47). Adems de la cultura de las personas existe la cultura de la institucin, siendo esta un elemento central en el sistema educativo contemporneo (AKKARI, 2000: 43). Es por ello que cuando se habla de los fundamentos culturales de la educacin, es necesario escuchar a todos los estamentos que reflexionan sobre ella. Akkari (2000) recoge en la siguiente tabla las relaciones alumno (aprendiz)enseante (educador) y que tienen una gran relevancia en la comunicacin entre el educador y los alumnos:

Culturalmente asimilacionista
Relacin jerrquica y limitada al contexto escolar El enseante construye las relaciones con cada uno de los alumnos de manera individual. El enseante anima a los alumnos a realizar

Culturalmente apropiado
Relacin fluida, transciende el contexto escolar y abarca los aspectos afectivos de relacin y cognitivos. El educador pone en marcha los nexos entre todos los alumnos y parte del postulado de la educabilidad. El enseante propugna los aprendizajes colectivos. Se incita a los alumnos a ayudarse mutuamente y a ser responsables de las adquisiciones colectivas. El educador favorece la constitucin de una

diferencias
El enseante anima a los alumnos a aprender de forma individual. El enseante organiza la competicin escolar, asegura la clasificacin de los alumnos y facilita su orientacin hacia escalafones diferenciados y jerarquizados.

comunidad de aprendices en situacin de aprendizaje


y fuera de l.

Segn se observa, existen prcticas escolares muy sutiles, sustentadas en las actividades que propugna el enseante y que pueden llevar a objetivos completamente contrapuestos. De ah la importancia de la formacin del profesorado. b) Desarrollar la lengua y la alfabetizacin en todo el currculo. Si situamos este principio dentro de un proyecto multicultural, la primera caracterstica de este encuentro es la asimetra en la comunicacin, ya que en todos los casos nos encontraremos con situaciones en las que un hablante conoce la lengua (el educador y otros alumnos) y en otros alumnos se observan dificultades o bajo nivel en dicha lengua. En estas situaciones es de gran importancia favorecer la intercomprensin en clase y fuera de ella. Para que esta pueda llevarse a cabo es necesario que ambos grupos desarrollen estrategias eficaces que les permitan ir acercndose en el desarrollo de la intercomprensin (FRANCOIS, 1990). Crear significados: conectar la escuela con la vida de los estudiantes. En las aulas multiculturales, los enseantes pueden crear experiencias compartidas mediante una instruccin basada en la actividad y orientada a problemas, unas actividades compartidas y una bsqueda atenta de oportunidades para evocar y utilizar educativamente las experiencias y los conocimientos de cada estudiante, sobretodo en el dilogo entre estudiante y enseante (THARP, ESTRADA, DALTON & YAMAUCHI, 2000: 56). Ensear pensamiento complejo. Existe un claro consenso entre los investigadores en torno al hecho de que todos los estudiantes, y quizs especialmente los estudiantes en situacin de riesgo, necesitan una educacin que sea cognitivamente estimulante; es decir que requiera pensamiento y anlisis, no solo ejercicios basados en la repeticin y memorizacin (THARP, ESTRADA, DALTON & YAMAUCHI, 2000: 56). Son conocidos los estudios y propuestas didcticas sobre la necesidad de trabajar la L2 junto con los contenidos del currculum (LAPLANTE, 2000; CARRASQUILLO & RODRIGUEZ, 2002; COELHO, 2005). Ensear por medio de la conversacin. Por medio de la conversacin, la cultura y los conocimientos del nio se revelarn con claridad y es este aspecto el que queremos resaltar en una situacin intercultural. Los supuestos, las percepciones, los valores, las creencias y

c)

d)

e)

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

81

Flix Etxeberra, Iaki Karrera & Hilario Murua

las experiencias todos los componentes subjetivos y cognitivos de la pertenencia a una cultura estarn presentes, permitiendo as que el enseante pueda corresponder a ellos para contextualizar la enseanza en la base de la experiencia del nio y para individualizar la enseanza de la misma manera que cada nio esta visualizado dentro de la cultura (THARP, ESTRADA, DALTON & YAMAUCHI, 2000: 60).

2. Escolarizacin de alumnos inmigrantes en Euskadi


ALUMNOS INMIGRANTES: DNDE Y CMO LOS ESCOLARIZAMOS? Al igual que en otras Comunidades Autnomas, el crecimiento de la poblacin inmigrante y el de los alumnos en las escuelas es constante en el Pas Vasco. Hemos pasado en solo 8 aos de 2.094 alumnos a 17.898 (GOBIERNO VASCO, 2008).
20.000 18.000 16.000 14.000 12.000 10.000 8.000 6.000 4.000 2.000 0
99-00 00-01 01-02 02-03 03-04 04-05 05-06 2006-07 2007-08

16661

17898

13.599 11.515 8.647 5.955 4.118 2.094 2.937

GRFICO. Evolucin del alumnado inmigrante en la CAPV (GOBIERNO VASCO, 2008).

Si atendemos al porcentaje que representan los alumnos de origen extranjero y teniendo en cuenta slo el alumnado de la enseanza obligatoria, el alumnado inmigrante representa el 5,6 % en la CAV, para el curso 20082009. Si comparamos el caso del Pas Vasco con otros territorios, podemos afirmar que en nuestro pas, el ndice de alumnos inmigrantes es todava pequeo. Segn el M.E.C., para el curso 20082009, la poblacin escolar de origen extranjero alcanzaba estos niveles: Madrid Navarra Catalua Espaa Euskadi Galicia 13,9 % 9,3 % 12,4 % 9,1 % 5,6 % 3,2 %

Fuente: M.E.C. 20082009.

Por lo tanto, Euskadi ocupa todava unos niveles relativamente bajos dentro del panorama de las CCAA del estado, en el puesto sexto por la cola, por encima de Extremadura, Galicia, Asturias y Andaluca.

82 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

ORIGEN DE LOS INMIGRANTES EN EUSKADI (2005) ASIA 5%

EEUU y UE 19%

LATINOAMERICA 48%

ESTE EUROPA 9% AFRICA

GRFICO. Origen del alumnado inmigrante en Euskadi (GOBIERNO VASCO, 2004).

Tal y como vemos en este grfico, entre el alumnado extranjero, el colectivo mayoritario es el procedente de Latinoamrica (48 %) abarcando casi a la mitad del alumnado inmigrante. A continuacin se encuentran los procedentes de la Unin Europea y de EEUU (19 %), en tercer lugar los de frica (17 %) y posteriormente los de Europa del Este (9 %) y de Asia (5 %).

Procedencia del alumnado extranjero en el Estado (M.E.C., 20082009).

Segn los datos del Ministerio de Educacin y Ciencia (2008), la proporcin de alumnado inmigrante en las aulas indica una mayora de origen latinoamericano (Amrica Central y del Sur), con un 45,5 % del total de los alumnos extranjeros. A continuacin se encuentra Europa, con el 29% y frica con el 19 %. Asia y Oceana suponen cerca del 5 %.

3. Investigacin emprica
A. DISEO La competencia intercultural se reconoce en la actualidad como una herramienta crucial para vivir en las sociedades plurales del s. XXI. Se entiende por competencia intercultural una forma de competencia social o de habilidad de vida aplicada a entornos y contextos caracterizados por la diversidad cultural. Es decir, se refiere a la capacidad de las personas para captar las necesidades del contexto interpersonal y adaptar su respuesta al mismo (FABIANO, ROBINSON & PORPORINO, 1991; GARRIDO & LPEZ, 1995; GOLEMAN, 1995, 1999; GOLDSTEIN, 1988; TRIANES, MUOZ & JIMNEZ, 1997). La presente investigacin ha utilizado una metodologa mixta, tanto cuantitativa como cualitativa, y tiene como objetivo principal identificar el nivel de competencia intercultural entre los profesionales que trabajan con nios y nias en los ciclos de Educacin Infantil y Primaria. El texto que ahora presentamos es la segunda parte del trabajo realizado en 2008 en el que se preguntaba a los educadores, familiares y responsables educativos sobre las competencias ideales de los profesionales que trabajan con alumnado inmigrante. En 2009, la investigacin se focaliza en averiguar

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

83

Flix Etxeberra, Iaki Karrera & Hilario Murua

cules de esas competencias se corresponden con las competencias reales que dominan los educadores actuales. B. METODOLOGA

El cuestionario y la entrevista
El cuestionario est compuesto por 38 items (Anexo I), que se agrupan en diferentes bloques que intentan valorar algunos de los aspectos relacionados con la educacin con alumnos inmigrantes. Estos cuatro bloques son los siguientes:

Conciencia. En este bloque se pone de relieve algunos aspectos relacionados con el hecho de
ser consciente respecto de algunos temas relacionados con las culturas, la escucha, dificultades, necesidad de colaboracin y posibilidad de enriquecimiento mutuo entre personas de diversas culturas.

Actitudes. En el captulo de las actitudes se resalta el hecho de que el encuestado debe


demostrar una cierta inclinacin ante determinados problemas o desafos, como elaboracin de planes, eliminar expresiones de racismo y xenofobia o trabajar para promover el xito escolar.

Conocimientos. Hacen referencia al grado de informacin sobre aspectos culturales propios


y ajenos, saber palabras o expresiones, conocimientos sobre dinmica de grupos y conocer barreras de tipo cultural.

Destrezas y habilidades. Se refieren a la habilidad para interpretar diferentes culturas, mejorar el rendimiento de los inmigrantes, crear climas de convivencia y espacios donde se pueda practicar la lengua y cultura de origen.

Tambin se hicieron tres preguntas sobre formacin especfica, grado de satisfaccin y expectativas del profesorado que trabaja con alumnado inmigrante. El cuestionario de este segundo trabajo cuenta tambin con preguntas abiertas que interrogan sobre aquellos aspectos ms positivos y los ms negativos en relacin con la labor con el alumnado inmigrante. Adems de este cuestionario, se realizaron tambin entrevistas al 10 % de los encuestados, con lo que se obtuvo una interesante informacin de tipo cualitativo. C. LA MUESTRA El colectivo objeto de estudio ha estado formado nicamente por maestros y maestras de Educacin Infantil y Primaria de Bilbao y Donostia. Como ya hemos indicado ms arriba, en esta muestra hemos preguntado sobre el grado en que los educadores encuestados poseen o dominan las competencias indicadas. Es decir, al igual que en la primera parte de la investigacin en 2008 se preguntaba sobre la importancia de unas determinadas competencias, ahora preguntamos sobre la medida en que los educadores se consideran preparados o dominan dichas competencias. Si antes eras las competencias ideales, en este caso preguntamos sobre las competencias reales de los encuestados. D. RESULTADOS DE LAS RESPUESTAS POR BLOQUES (N=200) A continuacin ofrecemos los datos cuantitativos en las respuestas calificadas de cero a cien puntos. El intervalo de las puntuaciones va desde 84 (la ms alta) hasta 46 (la ms baja), siendo la media de 70 puntos.
COMPETENCIAS INTERCULTURALES. VALORACIONES DEL PROFESORADO, (N=200) Donostia-Bilbo
100 80 60 40 20 0 CONSCIENCIA ACTITUDES CONOCIMIENTOS DESTREZAS

79

72

65

68

84 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

Vemos que las competencias que mayor puntuacin obtienen son las relacionadas con la consciencia y actitudes, mientras que los conocimientos y destrezas se sitan por debajo.

NIVEL FORMACION, SATISFACCION Y EXPECTATIVAS. VALORACIONES DEL PROFESORADO, (N=200) Donostia-Bilbo 69 80 60 40 20 0 FORMACION ESPECFICA SATISFACCION EXPECTATIVAS MEDIA 46 71 70

El nivel de formacin que afirman disponer los educadores ocupa el ltimo lugar de la tabla. Tambin las expectativas y el grado de satisfaccin en el trabajo obtienen puntuaciones bajas.

4. Valoracin de los resultados obtenidos en la encuesta


FRECUENCIAS Las 200 encuestas obtenidas en los distintos centros escolares de Bilbo y Donostia se reparten de la siguiente manera: SEXO: Mujer Hombre 84 % 16 %

La gran mayora de los encuestados de la etapa infantil y primaria de Bilbao y Donostia est constituida por mujeres, el 84 %, siendo el porcentaje de los varones del 16 %. ETAPA Infantil Primaria 34 % 66 %

En la muestra que hemos examinado, los profesoresas de primaria suman el doble que los que trabajan en la etapa infantil. CENTRO Publico Privado 69 % 31 %

Los centros pblicos conforman el 69 % de los encuestados, mientras que el porcentaje de los que responden desde los centros privados es del 31 %. FORMACIN Diplomado Licenciado 80 % 20 %

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

85

Flix Etxeberra, Iaki Karrera & Hilario Murua

La gran mayora del profesorado de infantil y primaria est formado por Diplomados, el 80 %, siendo el porcentaje de licenciados del 20 % ANALISIS DE LOS ITEMS DE LA ENCUESTA Apenas hay diferencias significativas en relacin a las distintas variables independientes analizadas en esta investigacin. Las respuestas recibidas en los 38 items parecen ser muy consistentes y sufren pocas variaciones por el hecho de que los encuestados sean de diferente sexo, trabajen en centros pblicos o privados o ejerzan su labor en un determinado modelo lingstico. 1. CONSCIENCIA Y ACTITUDES Casi todos los tems relativos a competencias relacionadas con ser consciente y tener determinadas actitudes necesarias para trabajar con alumnado inmigrante se encuentran por encima de la media, obteniendo las puntuaciones ms altas de la tabla (Anexo 1). Esto indica que el profesorado que atiende al alumnado inmigrante parece encontrarse al tanto de los problemas y de las consecuencias que su trabajo acarrea. Demuestran buena actitud y buenas cualidades en cuanto a la sensibilizacin ante los problemas. 2. CONOCIMIENTOS Y DESTREZAS Por el contrario, los tems relacionados con los conocimientos y con las destrezas que los profesionales deben poseer a la hora de enfrentarse a las tareas educativas con alumnado inmigrante ocupan los puestos ms bajos de la tabla, por debajo de la media en su mayora. Esto parece indicar que aquellos aspectos relacionados con la preparacin especfica del profesorado en temas relacionados con los conocimientos adquiridos o con las habilidades para desarrollar programas interculturales son los menos cultivados. En concreto, desde el punto de vista de los conocimientos, los aspectos menos valorados, son los siguientes: Saber las necesidades que se les presentan a las personas inmigrantes. Tener informacin del pas de origen. Conocer elementos culturales. Saber algunas palabras o expresiones del pas de origen.

En relacin con las destrezas que dominan en menor medida los profesionales de la educacin, destacamos las siguientes: Ser capaz de analizar las necesidades. Mejorar el rendimiento del alumnado inmigrante en las lenguas. Adaptar los recursos humanos, materiales, medios. Tener habilidad para reconocer e interpretar las diferentes culturas. Disear y poner en marcha nuevas experiencias. Organizar actividades que enriquezcan. Fomentar contactos con familiares y asociaciones. Crear espacios y momentos para cultivar la lengua y cultura de origen.

Parecen profesionales muy consciente y con buena actitud hacia la educacin intercultural, pero con pocos conocimientos y recursos para llevar a cabo esa tarea. Algunas expresiones de los educadores que respondieron a las entrevistas ilustran esta situacin con mucha crudeza: Estamos desnudos en el trabajo, porque Cmo ensear euskara a una persona que no sabe y que tiene cierta edad? En cuestin de organizacin, materiales, recursos, etc. estamos desnudos.

86 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

En primaria es un desamparo tal, cuando de repente te llega el tpico nio ruso, que no

te habla euskara ni castellano y est que no se entera, que no se aclara es una situacin de desproteccin desde el punto de vista emocional y afectivo terrorfica.
La verdad es que nos sentimos un poco en mantillas en este tema. Una vez que vienen y haces los papeles, pues se quedan bajo nuestra responsabilidad,son vuestros, arreglaos como podis.

3. FORMACIN, EXPECTATIVAS Y SATISFACCION DEL PROFESORADO QUE TRABAJA CON INMIGRANTES Adems del anlisis de las competencias interculturales, hemos analizado tambin estos tres aspectos mencionados en la encuesta respondida por los 200 profesores y profesoras de Bilbao y San Sebastin. Del anlisis de los resultados se pueden obtener las primeras consecuencias: En lo que se refiere a satisfaccin, las puntuaciones resultantes estn por debajo de la media, aunque en posiciones relativamente altas. Las respuestas relativas a las expectativas que tiene el profesorado, puntan justo encima de la media del conjunto de todos los tems. La peor puntuacin, hasta el hecho de ser la ltima de la tabla, es la relativa al grado de formacin especfica recibida para el trabajo con el alumnado inmigrante. La puntuacin obtenida en este tema es de 46 sobre 100 y supone una llamada de urgencia a la hora de establecer pautas para la formacin del profesorado dedicado al alumnado inmigrante.

A la luz de estos resultados, podemos concluir que la situacin del profesorado que trabaja con alumnado inmigrante deja mucho que desear en los aspectos ms personales de los docentes. A la baja satisfaccin y pocas expectativas que parecen demostrar se le suma la escasa formacin que dicen haber recibido en lo relativo al trabajo con alumnos extranjeros. Esto queda reflejado en palabras de los propios afectados con expresiones de este tipo: Hay cursos sobre interculturalidad, pero no hay nada especfico. Hay materiales y experiencias, pero no hay una formacin especfica, o por lo menos nosotros no la hemos tenido.

5. Valoracin de las entrevistas


La encuesta al profesorado cuenta tambin con una entrevista de preguntas abiertas que demandan a los profesoresas sobre aspectos ms negativos y ms positivos relativos al trabajo con alumnado inmigrante. Por las respuestas de los docentes, sabemos cules son los principales logros, medios o recursos de que disponen a la hora de trabajar en este terreno. Se puede decir que, en general, son conscientes de los recursos y los medios materiales y humanos que existen para responder a la educacin intercultural, pero tambin parecen tener claro cules son las limitaciones y los principales problemas que afectan a la educacin con alumnado inmigrante. PRINCIPALES ASPECTOS POSITIVOS Dentro del captulo de los logros y balance positivo respecto a medios y condiciones buenas de trabajo, cabe destacar que la mayora de los entrevistados afirma conocer la existencia de los siguientes dispositivos: Profesores de refuerzo lingstico. Son profesores de apoyo que reciben algunos centros cuando superar en cierto grado el porcentaje de alumnos inmigrantes en el centro. Asesoramiento y ayuda por parte de los Berritzegune, o centros de Renovacin Pedaggica, que son centros de apoyo para el profesorado en general y tambin de modo especfico para los que trabajan con alumnado inmigrante. Materiales y unidades didcticas que pueden encontrar en determinados sitios de Internet y que se les ofrecen para que puedan adaptarlos a las necesidades concretas del aula.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

87

Flix Etxeberra, Iaki Karrera & Hilario Murua

Traductores que permiten ayudar a los nios, familias y profesores en el caso de que hablen lenguas que no son conocidas en el aula. Jornadas y seminarios que son organizados peridicamente, principalmente bajo el auspicio de los centros Berritzegune. Comisin de Escolarizacin, que es un organismo encargado de hacer la primera acogida a las familias inmigrantes y orientarles de cara a la eleccin del centro en el que van a recibir a los alumnos recin llegados. Planes de acogida que han sido elaborados para hacer ms fcil el primer contacto de la familia y del nio inmigrante con la escuela.

Vemos por lo tanto que el profesorado que trabaja con alumnado inmigrante est al tanto de los dispositivos, de los medios y los recursos materiales y humanos que existen en el sistema educativo para abordar el trabajo del aula. Es en principio un balance positivo, porque demuestra que existen medios y que son conocidos por los profesionales de la educacin. PRINCIPALES DEFICIENCIAS A la hora de analizar aquellos aspectos ms negativos de la educacin con alumnado inmigrante, debemos destacar que las manifestaciones del profesorado entrevistado son mucho ms abundantes y ms ricas en expresiones que demuestran la preocupacin por la situacin en la que parecen encontrarse los docentes. Las principales deficiencias detectadas son las siguientes:

Falta de recursos humanos, profesores de apoyo. Esta es la principal deficiencia que se detecta en las entrevistas al profesorado. Parece haber una llamada unnime por parte de los profesionales para que los problemas derivados de la presencia de alumnado inmigrante se resuelvan principalmente por medio de los profesores de refuerzo o de apoyo.
hace falta ms recursos, es que no llegamos a ms. en la red puedes encontrar muchas cosas es entrar y adecuar tus materiales, pero los recursos de personal que si no las cosas van a salir un poquito a medias.

Falta de recursos, de medios materiales. Aunque en general reconocen que existen materiales, los consideran como insuficientes, y que en todo caso deben ser adaptados a las circunstancias particulares del aula.
S es verdad que en Berrikuntza o en Hezkuntza.net haba unos materiales, pero necesitan ms. Existen unos materiales u orientaciones, pero son muy generales.

Falta de tiempo. En algunos casos, aunque se sienten conscientes de los problemas y saben cules son las pautas a seguir, e incluso disponen de los materiales y hasta la formacin necesaria, lo que destacan es que no tienen el tiempo suficiente para abordar de modo eficiente la tarea encomendada y coordinarse mejor. Esta situacin va acompaada de expresiones de este tipo:
Siempre estamos pillados. Son demasiadas cosas las que nos piden. Necesitaramos ms tiempo para profundizar ms.

Falta de formacin especfica para la educacin intercultural. Los docentes de este estudio expresan claramente las deficiencias que encuentran en su propia preparacin y, aunque reconocen cierta formacin y un esfuerzo por parte de las instituciones para mejorar la preparacin, afirman que lo que se hace no es suficiente, que no se avanza ms all de las generalidades:
Hay otros cursos, sobre interculturalidad pero no hay nada especfico. Los profesores ordinarios no recibimos formacin y los profesores de apoyo acuden a seminarios y al Berritzegune y con eso se hace algo, material, conocer otras experiencias pero no creo que tengan formacin propia, o por lo menos nosotros no la hemos tenido.

Dificultades para enfrentarse al principal problema que se les plantea. El problema ms citado a la hora de hablar de las dificultades es el que se presenta al profesorado cuando tiene que abordad la escolarizacin y la enseanza del euskara a inmigrantes que vienen durante el curso, en la etapa de

88 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

educacin primaria. Las expresiones de incertidumbre se suceden una tras otra cuando los profesores se enfrentan a este tipo de problema bsico:

Cmo ensear euskara a unos alumnos que no conocen ninguna de las lenguas y que llegan con 10 aos? Al principio te planteas, Cmo voy a empezar yo con estos nios? Si entran en el aula a mitad del curso y sin concretar nada, Cmo tenemos que organizar todos eso?

Sensacin de abandono, desproteccin. Finalmente, es una impresin de impotencia, de abandono, de no contar con la formacin y los instrumentos necesarios para la tarea que se les presenta. La riqueza de expresiones es muy variada y el repertorio de manifestaciones de malestar tambin:

En cuanto a organizacin, materiales y recursos estamos desnudos. S, eso es lo ms frustrante en este trabajo, que no est organizado. siempre te vienen bien como ideas y dems, pero la verdad es que nos sentimos un poco en mantillas en este tema. Una vez que vienen, rellenas los papeles y luego arrglate como puedas.

6. Conclusiones
Del anlisis conjunto de las encuestas y las entrevistas realizadas a los 200 profesores y profesoras de Bilbao y Donostia, podemos afirmar lo siguiente: Los profesores y profesoras encuestados afirman tener buen nivel de consciencia y actitudes respecto a las tareas que exige la educacin con alumnado inmigrante. Sin embargo, dicen que no tienen suficiente conocimiento respecto a las necesidades que les plantean los nios inmigrantes, especialmente en lo relativo a la cultura de origen, informacin del pas, conocimiento bsico de la lengua, etc. Se encuentran en situacin de precariedad a la hora de dominar las habilidades para adaptar materiales, disear nuevas experiencias integradoras, mejorar el rendimiento del alumnado inmigrante o establecer buenos contactos con las familias. El balance relativo a la formacin, las expectativas y la satisfaccin que sienten respecto al trabajo con inmigrantes se encuentra en los niveles ms bajos de las escalas analizadas. En el lado ms favorable, conocen la existencia de recursos y dispositivos para enfrentarse a la educacin intercultural y los valoran positivamente, aunque sean considerados como insuficientes. En el plano negativo, manifiestan disponer de poco tiempo, recursos, formacin y apoyos suficientes para enfrentarse a su tarea. Como resultado de todo esto, aparece la sensacin de abandono, desproteccin y no saber cmo encarar la educacin con inmigrantes, especialmente con los que se incorporan en la enseanza primaria.

7. Declogo para la Educacin Intercultural


Estos puntos pueden constituir la base para la elaboracin de un curso de formacin en educacin intercultural de cara al profesorado de Educacin Infantil y Primaria. Estas consideraciones han sido extradas a partir de las respuestas dadas a los cuestionarios inicial y final, y a las entrevistas realizadas a una parte del profesorado. Con esa informacin se ha contrastado el ideal de formacin y la realidad de la situacin del profesorado de dichas etapas en Bilbao y Donostia. 1. Desarrollar buenas actitudes y ser conscientes de la situacin y problemas del alumnado inmigrante y de los riesgos, del racismo y xenofobia.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

89

Flix Etxeberra, Iaki Karrera & Hilario Murua

Buenas prcticas: este es un primer paso fundamental para enfrentarse a los principales
problemas que se plantea el trabajo con el alumnado inmigrante. En general parece que existe un bien nivel de competencias de este tipo.

Riesgos: el principal riesgo de este planteamiento es que la consciencia y buenas actitudes se queden en una dimensin ms pasiva, sin terminar de entrar en la prctica o en los retos derivados de la educacin con inmigrantes.

2. Conocer las necesidades del alumnado inmigrante relativas a los aspectos afectivos, familiares, salud, formacin y otros aspectos.

Buenas prcticas: es necesario un estudio individualizado para saber con precisin cules son las necesidades o principales problemas del alumnado inmigrado. Aunque de modo general podemos conocer muchos de esos aspectos, ser necesario un mayor contacto con la familia para esclarecer el nivel exacto de la situacin. Riesgos: actuar con el alumnado inmigrante en base a unos planteamientos generales o estereotipos respecto a su nivel de formacin, costumbres, pautas culturales y valores, sin caer en la cuenta de que, si bien hay que partir de ese a priori, luego cada familia tiene su propia realidad.

3. Tener informacin del pas de origen del alumnado inmigrante y algunos rasgos de su cultura y su lengua. Aspectos relacionados con la historia, economa, cultura, lengua

Buenas prcticas: mapas, historia, literatura, msica, algunos conocimientos de la lengua, etc. pueden ser medios tiles para un mayor acercamiento hacia el alumnado inmigrante, hacia su familia y para hacer partcipes a los dems alumnos de las circunstancias de estos alumnos. Riesgos: caer en los estereotipos culturales, el folklorismo, la idea de que todos los miembros
de un pas deben encajar en ese tipo de coordenadas. Tambin puede ser un riesgo el no tener en cuenta la diferencia entre cultura oficial y cultura familiar.

4. Mejorar el rendimiento escolar del alumnado inmigrante en las lenguas de acogida. Fomentar el xito escolar, aprendizaje de lenguas, promocin e insercin sociolaboral.

Buenas prcticas: si no hay xito escolar, todo lo dems puede quedar en mero folklorismo identitario. Es fundamental que pongamos todos los medios, ms que los habituales, para conseguir que el nivel acadmico del alumnado inmigrante se aproxime al de los nativos. Programas de refuerzo, de ayuda a la familia, etc. sern tenidos en cuenta. Riesgos: pensar que por el mero hecho de ser inmigrante, el nio o nia necesita ayuda especial o compensatoria. En este sentido, es fundamental analizar a fondo la situacin escolar del alumno y ver qu tipo de programa puede necesitar.

5. Adaptar recursos humanos, materiales y medios para mejorar la prctica educativa con el alumnado inmigrante.

Buenas prcticas: los libros, manuales, mapas y otra documentacin, as como los materiales didcticos que habitualmente usamos en nuestras aulas tienen un sesgo identitario particular. Generalmente estn hechos desde una perspectiva ms local. Por ello es preciso dar cabida tambin a la diversidad cultural en los materiales que utilicemos en el aula. Riesgos: caer en los tpicos y el folklorismo, los estereotipos y los lugares comunes.

6. Disear y poner en marcha nuevas experiencias de aprendizaje que reconozcan la diversidad cultural.

Buenas prcticas: El aprendizaje que reclama una educacin intercultural ha de estar basado en la cooperacin, trabajo de grupo, intercambio, encuentros, proyectos en comn, participacin real de todos los colectivos implicados y reconocimiento de la diversidad en el curriculum. Riesgos: el trabajo rutinario, individualizado, competitivo, memorsticos, etc. no puede ser un buen cauce para el desarrollo de la educacin intercultural. Tampoco vale el realizar los

90 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

cambios formales, sin caer en cuenta sobre las consecuencias reales o los resultados que estamos consiguiendo. Una evaluacin de la situacin nos permitir ver si vamos o no en la buena direccin. 7. Conocer y organizar actividades y dinmicas de grupo que favorezcan la convivencia entre culturas.

Buenas prcticas: el tiempo libre, el patio, las excursiones, las fiestas del centro escolar
pueden ser una va de extraordinario efecto en el proceso de integracin de los alumnos nativos e inmigrantes. Tcnicas de dinmica de grupo que impulsen y aceleren procesos de toma de contacto y de superacin de barreras pueden ser muy tiles en esa direccin.

Riesgos: tener cuidado de que las actividades de este tipo, excursiones, recreo, dinmicas de grupo, etc. no tengan un efecto contrario al deseado, es decir, que sirvan para consolidar y reafirmar los tpicos y los estereotipos.

8. Fomentar contactos con familiares, asociaciones y comunidad para mejorar la comprensin de lo que ocurre en el centro.

Buenas prcticas: la influencia de la escuela es limitada, por lo que todo tipo de


intervencin que la complemente ser fundamental. El contacto con la familia debe ser bsico para entender y ayudar al alumnado inmigrante. Igualmente, el recurso a las asociaciones y colectivos inmigrantes pueden dar pautas para mejor entender y apoyar a estos alumnos.

Riesgos: desistir del contacto con la familia por la aparentemente poca atencin que le prestan a la escuela o a la educacin. En algunas culturas y determinadas familias el hecho de acudir a hablar con el profesor es visto como muy remoto y de difcil acceso. Buenas prcticas: las clases o los trabajos de lengua y cultura de origen pueden ser tambin
un lugar de encuentro para los alumnos nativos y emigrantes. Para los nativos puede servir de apertura hacia los otros y para los inmigrantes puede ser una va de cultivar la propia identidad y desarrollar mejor su autntica integracin. Fiestas, aniversarios, cantos, costumbres, etc. pueden servir tambin de complemento.

9. Crear espacios y momentos donde el alumnado inmigrante pueda practicar la lengua de origen.

Riesgos: no identificar bien la lengua de origen, caer en estereotipos, hacer grupos separados para trabajar la lengua de los inmigrantes, etc.

10. Impulsar actividades que supongan intercambio y relacin entre alumnado inmigrante y autctono. Evitar guetos y grupos separados. Si el objetivo es la integracin, los medios tambin tienen que ser integradores.

Buenas prcticas: en lugar de la clase terica o encerrada en aspectos lingsticos, parece


ms efectivo el planteamiento de realizar tareas, llevar a cabo proyectos conjuntos en los que se intercambie la actuacin de todos los alumnos. Prcticas deportivas, juegos, msica y otras actividades se prestan especialmente para este fin. En todo caso, si debe haber algunos momentos de trabajo separado, debieran ser lo ms cortos posible y con autntica vocacin de integrarse en el aula ordinaria.

Riesgos: hacer grupos separados, aunque con muy buena voluntad. Ejemplos de este tipo son la enseanza de la lengua de origen en un horario y lugar ajeno a la clase ordinaria. O la organizacin de los comedores conforme a criterios de origen, religin, etc.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

91

Flix Etxeberra, Iaki Karrera & Hilario Murua

Anexo 1. Resultados de las respuestas a los tems del cuestionario (n=200)


EN QU MEDIDA ME CONSIDERO PREPARADO O FORMADO EN ESTAS COMPETENCIAS. MEDIA DE LAS RESPUESTAS A LOS ITEMS. CODIFICADAS DE 1 A 10 Y ORDENADAS DESCENDENTEMENTE intentar eliminar del centro cualquier expresin de racismo o xenofobia ser consciente de la necesidad de escuchar abiertamente ser consciente de la importancia que tiene la lengua en una cultura ser consciente de la necesidad de ponerse en el lugar de la persona de la otra cultura para poder entenderla ser consciente de las dificultades que pueden surgir del hecho que la lengua de origen del nio o nia y la lengua de acogida de la escuela sean distintas ser consciente del enriquecimiento que producen las relaciones entre personas de diversas culturas conocer los valores, actitudes, tradiciones, creencias y costumbres de la propia cultura ser consciente de la necesidad de colaborar con otros profesionales para abordar los temas interculturales estar dispuesto a trabajar para superar las resistencias que surgen en la convivencia entre culturas ser capaz de crear un clima de convivencia basado en el respeto mutuo y la solidaridad entre el alumnado ser consciente de que los malos entendidos pueden surgir en las relaciones entre personas de distintas culturas asumir que se produzcan cambios en su trabajo como consecuencia de la incorporacin del alumnado inmigrante estar dispuesto a trabajar en la elaboracin y puesta en marcha de planes y programas especficos para la integracin de alumnos inmigrantes tener conocimiento de las consecuencias que se derivan de actitudes racistas y xenfobas ser capaz de obtener informacin sobre una cultura determinada ser consciente de la influencia de su propia cultura asumir un papel activo para evitar conflictos por razones culturales en el centro fomentar el xito escolar del alumnado inmigrante ser capaz de reflexionar y evaluar sobre las acciones que ha desarrollado para mejorar ser consciente de la influencia de la cultura de origen en los grupos inmigrantes conocer la influencia del plurilingismo en el desarrollo educativo tengo estas expectativas de cara al futuro en el trabajo con alumnado inmigrante MEDIA DE LAS MEDIAS DE LOS ITEMS saber las necesidades que se les presentan a las personas inmigrantes a su llegada a los centros este es mi grado de satisfaccin en el trabajo con el alumnado inmigrante ser capaz de analizar las necesidades asociadas a la convivencia intercultural en el centro educativo ser capaz de mejorar el rendimiento del alumnado inmigrante en la(s) lengua(s) del centro educativo adaptar los recursos humanos, materiales y medios para la mejora de la practica educativa con alumnado inmigrante conocer las barreras que surgen al incorporarse practicas derivadas de otras culturas en el funcionamiento del centro educativo tener habilidad para reconocer e interpretar las diferentes culturas disear y poner en marcha nuevas experiencias de aprendizaje que reconozcan la diversidad cultural como parte de los contenidos del curso organizar actividades que enriquezcan a convivencia entre las diferentes culturas tener informacin del pas de origen para trabajar eficazmente con el alumnado inmigrante conocer dinmicas de grupo que favorezcan la convivencia entre culturas fomentar los contactos con familiares y asociaciones de inmigrantes para entender mejor las situaciones que se puedan presentar en el centro conocer elementos culturales (verbales y no verbales) para enriquecer las relaciones interculturales crear espacios y momentos donde el alumnado inmigrante pueda practicar la lengua de origen saber algunas palabras y expresiones de las lenguas de origen del alumnado extranjero para facilitar la comunicacin esta es la formacin especfica que he recibido para el trabajo con el alumnado inmigrante Media 8,441 8,131 8,122 8,023 7,987 7,972 7,966 7,821 7,756 7,657 7,655 7,643 7,642 7,629 7,590 7,552 7,474 7,446 7,446 7,332 7,124 7,116 6,99 6,953 6,901 6,855 6,760 6,757 6,609 6,423 6,250 6,011 5,984 5,538 5,457 5,365 4,931 4,883 4,577

CONSCIENCIA

ACTITUDES

CONOCIMIENTOS

DESTREZAS

92 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

Competencias interculturales del profesorado con alumnado inmigrante en el Pas Vasco

Referencias bibliogrficas
AGUADED RAMREZ, E. M. (2006). La educacin de competencias bsicas para el desarrollo de la ciudadana intercultural en la ESO. Ponencia. AKKARI, A. (2000). Audel de lethnocentrisme en sciences de lducation. En: P. R. DASEN & CH. PERREGAUX (eds.), Pourquoi des aproches interculturelles en sciences de lducation?, De Boeck Universit, Raisons ducatives, 3, 3148. ANEAS LVAREZ, A. (2003). Competencias profesionales. Anlisis conceptual y aplicacin profesional. Conferencia. ANECA (2004). Libro blanco. Ttulo de Grado de Magisterio. Madrid: Autor. ANECA (2005). Libro blanco del Ttulo de Grado en Pedagoga y Educacin Social. Madrid: Autor. BESAL, X. (2002): Diversidad cultural y educacin. Barcelona: Sntesis Educacin. CARRASQUILLO, A. L. & RODRGUEZ, V. (2002). Language Minority Students in the Mainstream Classroom. Clevedon: Multilingual matters COELHO, E. (2005). Aprendre llengua a travs del currculum. Immersi Lingstica, 7, 3948. COLECTIVO IOE (1996): La Educacin Intercultural a prueba: hijos de inmigrantes marroques en la escuela. Madrid: MEC. CONSEJO ESCOLAR DE EUSKADI (2005): Informe sobre la situacin de la enseanza en la CAPV. DE HARO, R. (2003). Educacin intercultural: Nuevos retos y propuestas para la prctica educativa. Comunicacin al curso Educacin Intercultural: PEC, PCC y Programacin de Aula. www.educarm.es/torreintercultural. DE NUCHEZE, V. (2004). La recontre interculturelle, LiDIL, 299. DEFENSOR DEL PUEBLO (2003): La escolarizacin del alumnado inmigrante en Espaa. Madrid. www.defensordelpueblo.es. ETXEBERRIA, F. (2002): Sociedad multicultural y educacin. Donostia: Ibaeta Pedagoga. FABIANO, E., ROBINSON, D. & PORPORINO, F. (1991). A preliminary assessment of the cognitive skills training program. A component of living skills programming. Ottawa: Correctional Service of Canada. FANTINI, A. E. (2000). A Central Concern: Developing Intercultural Competence. Direccin en Internet: http://www.sit.edu/publications/docs/competence.pdf. FANTINI, A. E. (2007). Exploring and assessing intercultural competence. Center for Social Development. CSD. Global Service Institute. Washington University in St. Louis. Direccin en Internet: http://gwbweb.wustl.edu/csd/Publications/2007/RP0701.pdf FRANC, A.& MIJARES, L. (1999): Lengua y cultura de origen. Nios marroquies en la escuela espaola. Madrid: Ediciones del Oriente y del Mediterraneo. FRANOIS, F. (1990). La communication ingal. Paris: Delachaux et Niestl. GARRIDO, V. & LPEZ, M. J. (1995). La prevencin de la delincuencia: El enfoque de la competencia social. Valencia: Tirant. Criminologa y Educacin Social. GOBIERNO VASCO (2008): Programa de interculturalidad y de inclusin del almunnado recin llegado. 20072010. VitoriaGasteiz. GOLDSTEIN, A. P. (1988). The prepare curriculum. Teaching prosocial competencies. Champaign, IL.: Research Press. GOLEMAN, D. (1995). Inteligencia emocional. Barcelona: Kairs. GOLEMAN, D. (1999). La prctica de la inteligencia emocional. Barcelona: Kairs. IKUSPEGI (2008): Lenguas e Inmigracin. Observatorio Vasco de la Inmigracin, 25. www.ikuspegi.org. JAUSSI, M. L. (1998): Educacin Intercultural. Orientaciones para la respuesta educativa a la diversidad tnica y cultural de la escuela. VitoriaGasteiz: Gobierno Vasco.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

93

Flix Etxeberra, Iaki Karrera & Hilario Murua

LAPLANTE, B. (2000). Apprendre en sciencies, cest apprendre parler sciences: des lves de limmersion nous parlent des ractions chimiques. The Canadian Modern Language Review, 57, 2: 245271. M.E.C. (2008). Datos y cifras. Curso escolar 20082009. Madrid. MALIK LIVANO, B. (2003). Intervenciones para la adquisicin de competencias interculturales. MIJARES, L. & BROEDER, P. (2004): Ciudades plurilinges: una encuesta sobre usos lingsticos en las escuelas de Madrid. Estudios de Sociolingstica. Volumen 5 (2), Universidade de Vigo. NOGUEROL, A. ET AL.(2002): Pensar lo dicho: la reflexin sobre la lengua y la comunicacin en el aprendizaje de lenguas. Barcelona: Milenio. Pgina de internet: http://www.eslee.org/ migraciones.php?glosario=migraciones. THARP, R. G., ESTRADA, P., STOLL DALTON, S. & YAMAUCHI, L. A. (2002). Transformar la enseanza. Temas de educacin, Paids. TRIANES, M. V., MUOZ, A. M. & JIMNEZ, M. (1997). Competencia social: Su educacin y tratamiento. Madrid: Pirmide.

i Este artculo es uno de los resultados del proyecto de investigacin financiado por el Fondo de Cooperacin Transfronterizo e Interrregional, EuskadiAquitania (20082009), del Gobierno Vasco.

94 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 7994

REFERENCIA: Barqun, Amelia; Alzola, Nerea; Madinabeitia, Mnika & Urizar, Ane (2010). El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes. REIFOP, 13 (4). (Enlace web: http://www.aufop.com - Consultada en fecha (dd-mm-aa):)

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes


AmeliaBARQUN NereaALZOLA MonikaMADINABEITIA AneURIZAR
Correspondencia: AmeliaBarqun NereaAlzolaMaiztegi MonikaMadinabeitia AneUrizar Correoselectrnicos: nerea_alzola@huhezi.edu aneurizar@huhezi.edu Telfono: +34943714157 Direccinpostal: FacultaddeHumanidades yEducacin UniversidadMondragon 20540Eskoriatza Recibido:10dejuniode2010 Aceptado:18deoctubrede2010

RESUMEN
Estos ltimos aos miles de nios y nias inmigrantes han llegado a nuestro sistema educativo. La investigacin que presentamos en este artculo tiene el siguiente objetivo: conocer y analizar las creencias y representaciones que tienenlosalumnosdelltimoaodeMagisterio,apuntode ser maestros, sobre la emigracin y los emigrantes. Para acercarnos al pensamiento implcito hemos aplicado un mtododelargatradicinenlainvestigacincualitativa:las narraciones de vida. El anlisis de los textos nos aporta sugerentesconclusionesytemasdeinvestigacin.

PALABRAS CLAVE: Educacin intercultural, Creencias, Representaciones,Inmigracin.

Undergraduate Teacher Education students thoughts on immigration and immigrants


ABSTRACT
Many immigrant children have become part of our educational system in the last few years. This researchpaperaimstoexaminethebeliefsandrepresentationsthatthethirdyearstudentsofTeacher Educationhavetowardsimmigrationandimmigrants.Wehaveusedlifenarrativesastheresearchtool. This method has a solid tradition in the area of qualitative research. Our close examination of texts throwsinterestingresultsandresearchtopics.

KEY WORDS: Crossculturaleducation,Beliefs,Representations,Immigration

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

95

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

1. Creencias y actitudes del alumnado


El objetivo de la investigacin es el de conocer las creencias y actitudes del alumnado del ltimo curso de Magisterio de la Facultad de Humanidades y Educacin (HUHEZI, Universidad de Mondragon) con respecto a las personas inmigrantes y a la inmigracin. El estudio ha sido llevado a cabo por el grupo ELEA, de HUHEZI, equipo investigador y docente de carcter interdisciplinar que tiene como eje la educacin intercultural. Como fuente de informacin para esta investigacin nos hemos servido de los textos de carcter autobiogrfico escritos por los estudiantes de magisterio mencionados. La presencia de nios inmigrantes en la escuela vasca se ha incrementado de manera significativa en los ltimos aos. El modo en que el profesorado acta profesionalmente con estos alumnos y con sus familias tiene relacin no slo con sus creencias y saberes profesionales, sino tambin con las creencias y actitudes personales en gran medida construidas socialmente que estos profesores tienen con respecto a las personas inmigrantes. El profesor es un ser social y sus creencias y actitudes influyen en su conducta. Detectar esas creencias y actitudes en los que sern futuros profesores tiene por tanto un enorme inters, y tal ha sido el objetivo del grupo. La informacin obtenida permitir, en el futuro, una intervencin pedaggica ms adecuada con los futuros profesores en aquellas materias de la carrera donde se trabajan la educacin en valores y la enseanza con nios inmigrados e hijos de inmigrantes. El material recogido tiene, adems, un gran potencial formativo, de discusin, anlisis y aplicacin, para ser utilizado en contextos de formacin. Sealaremos, para empezar, que las percepciones del profesorado acerca del alumnado inmigrante han sido el tema de diferentes investigaciones, de las que researemos aqu aquellas que mayor relacin tienen con nuestro trabajo. Jordn (1994) llev a cabo un acercamiento pionero a las opiniones del profesorado sobre la educacin con inmigrantes. El estudio, realizado en Catalua con una muestra de una treintena de encuestas, mostraba la preocupacin de la mayor parte de los maestros encuestados por integrar a los nios en un sentido eminentemente asimilacionista. Jordn conclua la necesidad de una verdadera formacin de los docentes en este terreno. Colectivo IO (1996), en un estudio de carcter ms general sobre la escolarizacin de los nios marroques en Espaa, seala asimismo el predominio de un enfoque asimilador en la escuela. Trabajos como los de Colectivo IO (1997), Garreta Bochaca (2003) y LpezReillo & Gonzlez Garca (2005) analizan el discurso y las actitudes de los profesores a travs de muestras y metodologas diversas. Los estudios dejan ver la necesidad de una mejor formacin para el profesorado en el terreno de la educacin intercultural. Por su parte, Vecina Merchante (2005) se refiere al profesorado como un colectivo susceptible de verse sometido a las mismas corrientes ideolgicas que cualquier otro colectivo, transmitidas en la

interaccin social de la vida cotidiana y, cmo no, del poder de los medios de comunicacin y su capacidad para crear una realidad y una forma de entenderla (2005: 7).
Ortz Cobo (2008) analiza las percepciones que los docentes tienen acerca de la presencia del alumnado extranjero en la provincia almeriense. El estudio, de carcter cualitativo, presenta interesantsimas conclusiones que exigen pensar en la necesidad de trabajar en la prevencin de prejuicios tnicoculturales en las aulas escolares. La ms visible es que el alumnado inmigrante es percibido por el profesorado como una amenaza y un grave problema educativo. Adems, los docentes entienden las culturas de origen de los alumnos como un conjunto homogneo y perciben las culturas como obstculos para el aprendizaje de determinados grupos. Tres estudios recientes se centran en las actitudes de los alumnos de magisterio. Calvo Poblacin, Calvo Fernndez & Alejo Montes (2002) presentan en un breve artculo algunos datos obtenidos mediante encuesta con respecto a la percepcin de la interculturalidad en los alumnos de 1 de Educacin Fsica de la Facultad de Formacin del Profesorado de Cceres. Rodrguez Izquierdo (2005), en un estudio realizado con alumnos de magisterio de diversos cursos, explora el pensamiento de stos sobre la diversidad cultural y su incidencia en la educacin. El estudio, llevado a cabo mediante una escala de actitudes, concluye que los alumnos tienen una conciencia vaga de la diversidad cultural, aunque en trminos generales se trata de una actitud positiva.

96 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

El trabajo de Urizar (2007) es el antecedente ms directo del estudio que estamos presentando en estas pginas. En l se pretende, entre otros objetivos, medir el cambio en las creencias y representaciones de los alumnos de magisterio en torno a la educacin intercultural antes y despus de cursar la asignatura Educacin intercultural en el tercer curso de la carrera. Una de las conclusiones obtenidas en este estudio, realizado mediante encuesta, es precisamente la dificultad de llegar al verdadero pensamiento del alumnado, ya condicionado por el discurso profesional interiorizado durante la carrera. Siqus, Vila & Perera (2009: 106107) se refieren a diferentes trabajos que han evidenciado que una parte del profesorado tiene prejuicios y estereotipos respecto a las minoras tnicas y lingsticas e incluso han mostrado que, en algunas ocasiones, hay una estrecha relacin entre los prejuicios del profesorado y su prctica educativa. Sealan, asimismo, que en la dcada de 2000 diversos estudios han mostrado que en Europa crecen los prejuicios y las actitudes negativas hacia las minoras tnicas. No son las nicas investigaciones centradas en las creencias de los futuros profesores. Aunque no podemos hacer una revisin exhaustiva, debemos citar aqu el estudio de Middleton (2002), que se sirve de mtodos cuantitativos y cualitativos para analizar el cambio en las creencias sobre la diversidad de un conjunto de alumnos de magisterio tras la participacin en un curso sobre la diversidad. Por su parte, Pohan & Aguilar (2001) realizan un trabajo basado en encuestas que distingue las creencias profesionales de las personales, distincin que creemos digna de atencin y que hemos utilizado en nuestra investigacin. Efectivamente, el equipo ELEA decidi recoger las creencias y actitudes de los alumnos de tercero de magisterio con respecto a la inmigracin y los inmigrantes no en el terreno profesional (de la educacin), sino en el terreno personal. Adems el equipo estableci que el instrumento de recogida de los datos sera la narracin autobiogrfica. Ambas decisiones tenan como objetivo el alejarnos del pensamiento profesional ya asumido por estos alumnos en el tercer curso, as como alejarnos de la expresin de lo polticamente correcto que se desprende de la respuesta a muchos de los cuestionarios que hemos examinado. Se trata, pues, de acercarnos al pensamiento profundo de los sujetos de la investigacin.

2. El pensamiento narrativo y la investigacin cualitativa


Hemos de referirnos ahora brevemente a la metodologa de la investigacin y a la narracin autobiogrfica en particular. El lenguaje narrativo, bien sea de tinte autobiogrfico o de ficcin, nos sita ante una forma de conocimiento distinta a la argumentativa o lgicocientfica. Su pretensin no es demostrar y convencer con razonamientos, sino construir relatos cuya semejanza con la vida nos permita entenderla mejor. En este sentido, junto al tradicional enfoque lgicocientfico y con pretensin de objetividad, es clara la necesidad de una metodologa ms cualitativa y contextual interesada en desentraar el significado personal de ciertos acontecimientos. En la base se encuentra la distincin hecha por Bruner (1992; 1994; 1995) entre pensamiento proposicional (propositional thinking) y pensamiento narrativo (narrative thinking), que requiere imaginacin, comprensin de las intenciones humanas y una apreciacin de las situaciones particulares relativas al tiempo y al lugar. En efecto, Bruner plantea la existencia de dos modalidades de funcionamiento cognitivo o de pensamiento y cada una de ellas brinda modos caractersticos de ordenar la experiencia, de construir la realidad: la paradigmtica o lgicocientfica y la narrativa. No tener en cuenta o eliminar alguna de las dos modalidades sera perder la rica diversidad que encierra el pensamiento. No se ha de entender, pues, el enfoque narrativo como una alternativa al enfoque racionalista o al mtodo experimental, sino

ms bien como una perspectiva interpretativa que complementa e integra algunas de las crticas ms relevantes que se han realizado al enfoque cognitivo, tanto desde la psicologa como desde la educacin. Comprender los motivos e intenciones que argumentan las personas nos ofrece una visin ms amplia de su desarrollo personal (MEDRANO, 2007: 40) y, al mismo tiempo, de su visin de las cosas, de las
situaciones, de los hechos culturales o sociales y de la vida. Por otra parte, Bruner, en su trabajo en torno al pensamiento narrativo, se refiere a Vigotsky para sealar un aspecto de singular inters: el lenguaje no es entendido o visto por Vigotsky slo como un medio para transmitir la historia cultural, sino que, en contacto con Jakobson o Bajtn, entiende que la generatividad del lenguaje desempea la funcin incluso de ser productora de conciencia; el lenguaje es un agente para modificar las facultades del pensamiento, para dar al pensamiento nuevos
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

97

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

medios para explicar el mundo, a la vez que se convierte en el depositario de los nuevos pensamientos una vez logrados. En nuestra investigacin hemos tenido en cuenta los trabajos de diversos autores que apuestan en sus investigaciones por una sensibilidad ms subjetiva, dialgica e implicativa de la investigacin social (GONZLEZ MONTEAGUDO, 2007; MEDRANO, 2002; 2007; BOLVAR, 1998; 2001). Es particularmente interesante la aportacin de Todorov (1991: 150), para quien el texto analizado e interpretado es un

t, un interlocutor con el cual se discute acerca de los valores humanos. Pero el dilogo es asimtrico, ya que el texto est cerrado mientras que el anlisis del crtico puede seguir indefinidamente abierto. Para no hacer trampas en el juego, el crtico debe hacer escuchar lealmente la voz de su interlocutor.
As, en nuestra investigacin, para interpretar los textos del alumnado de magisterio, el modo de proceder de las investigadoras ha sido precisamente realizar una lectura consistente en ejercer la escucha del texto. En este tipo de lectura, la iniciativa proviene del texto y nuestra respuesta consiste en exponernos a su alteridad. Consideramos que esta escucha radical es la que posibilita la construccin dialgica del sentido del texto. Pero, adems, en palabras de Alzola (2004: 289), el lector/investigador

no est vaco sino que en ese dilogo, como receptor, tiene unas expectativas con respecto al texto (una concepcin de vida) que orientan la lectura. As, en nuestro caso, la escucha y el dilogo han sido
orientados por las categoras que hemos establecido para analizar los textos, reflejo de nuestras propias teoras y creencias, aunque esas categoras hayan sido adaptadas al leer y releer los textos, en un dilogo continuo.

3. La recogida de datos
Para la obtencin de datos se pidi a los alumnos del tercer y ltimo curso de la carrera de Magisterio que escribieran un texto fuera del aula y lo entregarn en clase tres semanas despus. En el texto deban narrar su experiencia con personas de origen inmigrante a lo largo de su vida, y deban expresar cules eran sus sentimientos, pensamientos y preocupaciones con respecto a la inmigracin y las personas inmigrantes. Asimismo se peda a los estudiantes que indicarn en lo posible las procedencias de esos sentimientos, pensamientos y preocupaciones (familia, escuela, medios de comunicacin, experiencia). Finalmente se les peda que dijeran algo acerca de los derechos de los inmigrantes y acerca de sus obligaciones. Se solicitaba a los alumnos que contestaran con sinceridad y sin preocuparse de lo que la ideologa dominante, los medios de comunicacin, los polticos, etc. dicen sobre esas cuestiones. Con objeto de facilitar la tarea, se les entreg un breve guin con la consigna indicada. La funcin del guin era orientar en la escritura, pero sin obligar a responder a unas preguntas concretas cuya formulacin pudiera ejercer influencia. El guin pretenda, adems, contribuir a superar algunas posibles dificultades, ya que al tratarse de la escritura de un texto y no de un intercambio oral o entrevista, no exista la posibilidad de preguntar al alumno acerca de aspectos que no surgieran de manera espontnea en su texto. El encargo de la escritura de los textos autobiogrficos se realiz un mes antes del comienzo de la materia denominada Educacin intercultural y en valores. Se pretenda con ello que la expresin de los alumnos no estuviera influida por el contenido de la materia. El anlisis de los datos, adems, nos permitira valorar si el contenido de la materia responda a las necesidades formativas de los alumnos. Los alumnos no deban firmar sus textos, sino identificarse con un cdigo, que ellos mismos deban formar con su fecha de nacimiento y las primeras letras de sus apellidos.

4. Anlisis de los datos


Tal y como seala Bolvar (1998; 2001), el material de la historia de vida ha de ser organizado y conceptualizado. Trabajar con material narrativo requiere la escucha dialgica de, al menos, tres voces: la voz del narrador, representada en el texto; el marco terico, que provee los conceptos e instrumentos para la interpretacin; y la reflexin propia del acto de lectura e interpretacin. Hemos seguido las etapas prescritas por Ruiz Olabunaga (1999) segn la metodologa denominada anlisis de contenido, destinada a la recogida de informacin o a la lectura realizada de modo sistemtico y replicable. El Anlisis de Contenido es una metodologa que utiliza una serie de procedimientos para efectuar inferencias vlidas de un texto (RUIZ OLABUNAGA, 1999: 199). Las etapas son:

98 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

Eleccin de los textos que se someten a anlisis. Definicin de los contenidos a inferir: definicin de las categoras. Elaboracin del modelo de anlisis y fundamentacin del modelo de anlisis. Procedimiento y procesos en la lectura de los textos: construccin del instrumento de lectura e indicadores. Exposicin y anlisis de resultados.

Desde la metodologa propuesta el analista acepta los documentos tal y como le llegan. ste, si quiere entenderlos y apropirselos, tiene para ello que transformarlos; es decir, someterlos a un proceso de manipulacin. De ah que una idea central de esta metodologa sea que el texto original debe ser tratado como un escenario de observacin o como el interlocutor de una entrevista del que se extrae informacin a travs de la lectura. La lectura, lejos de ser nica, es mltiple y repetida; es decir, el anlisis cualitativo de contenido procede de forma cclica y circular. Concluido un primer paso, se pasa al siguiente para, con frecuencia, volver de nuevo a la primera fase y reiniciarla con una informacin ms rica y completa. Este proceso implica que un texto es sometido a mltiples lecturas y manipulaciones, sin que basten una lectura y una categorizacin iniciales. Por lo que respecta a nuestro trabajo, los textos recogidos en nuestra investigacin fueron 110. De ellos se han analizado 85. No hemos tenido en cuenta aquellos demasiado breves o que no respondan a la consigna. Para realizar el anlisis de los textos ha sido necesario establecer una serie de categoras que permitieran dar cuenta de una manera sistemtica del contenido. El examen de los primeros textos permiti llevar a cabo la primera clasificacin en unidades ideolgicas que se repetan en los textos. Esa clasificacin se aplic a los siguientes textos. A medida que se examinaban y vaciaban nuevos textos, aparecan nuevas unidades, de modo que el nmero de categoras se fue enriqueciendo y fue necesario establecer subcategoras. Esto exigi el reexamen de todos los textos teniendo en cuenta la tabla final con todos los elementos de clasificacin. Dos miembros del equipo han definido separadamente cada categora y subcategora con objeto de consensuar su significado y de comprobar que no se produjeran divergencias en el entendimiento de cada uno de ellos. Como parte de la triangulacin metodolgica, dos miembros del equipo han examinado separadamente cada uno de los relatos y han contrastado conjuntamente las categoras halladas. Asimismo, quince de los textos fueron analizados separadamente por tres miembros del equipo con objeto de comprobar la validez de la aplicacin de la tabla de categoras y dotar de fiabilidad el instrumento de anlisis. El tercer miembro hizo una revisin final de la atribucin de categoras con objeto de corregir posibles incoherencias.

5. Las categoras
Antes de exponer la tabla de categoras, debemos explicar nuestros criterios. Para nuestro anlisis, hemos establecido un nmero de categoras que resultara adecuado y eficaz. No hemos realizado una mayor discriminacin puesto que un nmero muy elevado de categoras hubiera restado funcionalidad al estudio. En el anlisis se tiene en cuenta nicamente la aparicin de la categora en cada texto, no la extensin ni la intensidad en la expresin. Se cuantifica la categora una sola vez aunque se retome ms adelante en el texto. As la categora razones para inmigrar puede aparecer en varios lugares del texto, pero se recoge una nica vez. TABLA DE CATEGORAS 1. Razones para emigrar: el narrador menciona razones que los inmigrantes tienen para emigrar (condiciones econmicas, polticas del pas de origen, bsqueda de una vida mejor, oportunidades). 2. Soluciones para la inmigracin: el narrador seala una o ms soluciones para que las personas no tengan la necesidad de emigrar. 3a. Responsabilidad moral y/o polticosocial: el narrador seala las responsabilidades de las sociedades/de los ciudadanos/de los poderes pblicos con respecto a la igualdad/a la justicia /al respeto de los derechos de las personas inmigrantes.
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

99

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

3b: Ayuda y/o buen trato: el narrador seala que las personas de la sociedad receptora deben ayudar a los inmigrantes y/o tratarlos de manera adecuada. 4. Esfuerzo/sacrificio/valenta/sufrimiento (de los inmigrantes) para emigrar: el narrador menciona el esfuerzo/el sacrificio/la valenta/el sufrimiento de los inmigrantes para llegar a la sociedad receptora. 4b. Emigracin de los vascos: el narrador seala que tambin los vascos emigraron en el pasado. 5. Dificultades (de los inmigrantes en la sociedad receptora): el narrador menciona dificultades que los inmigrantes padecen en la sociedad receptora: 5A. En general o sin especificar (de todo tipo o sin especificar) 5B. Plano laboral: no les contratan, cobran menos 5C. Plano social: discriminacin, marginacin, racismo, abusos 5CC. Estereotipos y generalizaciones: se aplican a grupos enteros caractersticas estereotipadas. 5D. Plano cultural y lingstico: las costumbres o elementos culturales son distintos de los propios y desconocen la(s) lengua(s) local(es). 5E. No tener papeles: dificultades para obtener papeles/dificultades por no tener papeles. 5FF. Plano afectivo. 5F. Otros planos. 6. Inmigracin en sus aspectos positivos: el narrador se refiere a aspectos positivos de la inmigracin / los inmigrantes 6A. En general o sin especificar: los/algunos inmigrantes o la inmigracin tienen aspectos positivos (en general o sin especificar). 6B. Plano laboral: los/algunos inmigrantes realizan labores necesarias / labores que los autctonos no realizan. 6C. Aportacin en el plano cultural: los/algunos inmigrantes aportan riqueza cultural a la sociedad receptora. 6CC. Plano cultural: los/algunos inmigrantes tienen una relacin positiva con la cultura vasca. 6D. Integracin: los/algunos inmigrantes se integran en la sociedad receptora. 6DD Plano lingstico: los/algunos inmigrantes aprenden euskara. 6E. Plano econmico: los inmigrantes aportan riqueza a la sociedad receptora. 6F. Plano humano: los inmigrantes aportan amistad, experiencias, valores 6G. Otros planos. 6H. Capacidad de trabajo. Los/algunos inmigrantes son trabajadores. 7. Inmigracin como problema: el narrador se refiere a la inmigracin/los inmigrantes como problema: 7A. En general o sin especificar: los/algunos inmigrantes o la inmigracin tienen aspectos negativos (en general o sin especificar). 7B. Plano laboral: los/algunos inmigrantes se apoderan de los puestos de trabajo, provocan que bajen los sueldos 7BB. Plano econmico: la inmigracin tiene repercusiones negativas en el terreno econmico en la sociedad receptora. 7C. Plano cultural: los/algunos inmigrantes no se interesan por la cultura vasca o que la inmigracin influye negativamente en la cultura vasca. 7D. Plano lingstico: los/algunos inmigrantes no aprenden la(s) lengua(s) local(es)/la inmigracin influye negativamente en el uso del euskara.

100 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

7E. Plano social: los/algunos inmigrantes se hacinan en las viviendas, obtienen beneficios sociales injustamente, provocan tensiones, son fuente de conflicto en las poblaciones 7F. Escasa integracin: insuficientemente. los/algunos inmigrantes no se integran/se integran

7G. Delincuencia / falta de honradez / peligro: los/algunos inmigrantes son delincuentes, personas poco honradas o peligrosas. 7H. Machismo/comportamiento inadecuado con las mujeres/violencia de gnero: los/algunos inmigrantes son machistas/se comportan inadecuadamente con las mujeres/ejercen violencia de gnero. 7I. 7J. Holgazanera: los/algunos inmigrantes son holgazanes. Pobreza: los/algunos inmigrantes son pobres.

7K. Excesivo nmero: el nmero de inmigrantes es excesivo. 7L. Excesivo consumo: los/algunos inmigrantes se entregan a un consumismo excesivo. 7M. Otros problemas.

8. Creencia social: el autor indica los problemas sealados en el epgrafe 7 como expresin de
otras personas (no propia) en la sociedad receptora y se muestra en desacuerdo con esa expresin. Los tipos son los que se han sealado en la categora anterior.

10. Importancia de la informacin: el autor seala la importancia de una buena informacin


para desarrollar una visin adecuada de la inmigracin o de los inmigrantes/el autor seala que la falta de informacin o de una informacin adecuada incide negativamente en la sociedad receptora.

11. Respuesta educativa: el autor se refiere a la respuesta educativa que debe realizar la escuela y
los profesores con los hijos de los inmigrantes.

12. Buena experiencia: el autor refiere alguna experiencia de carcter positivo con personas
inmigradas.

13. Mala experiencia: el autor refiere alguna experiencia de carcter negativo con personas
inmigradas.

14. Sentimientos de desconfianza/miedo/odio/disgusto/preocupacin: el autor indica que


siente desconfianza/miedo/odio hacia los inmigrantes.

15. Sentimientos de pena/solidaridad/simpata/empata/admiracin: el autor expresa pena/


solidaridad/simpata/empata hacia los inmigrantes. 16. Derechos. 16A. Derechos en general: el autor expresa que los inmigrantes deben tener derechos (en general o sin especificar). 16B. Derechos especficos: el autor expresa que los inmigrantes deben tener derechos y especifica: condiciones materiales: trabajo, casa, sueldo, educacin, salud 16C. Derecho a mantener sus costumbres/su cultura: el autor expresa que los inmigrantes tienen derecho a mantener sus costumbres/su cultura o a que sean respetados. 16D. Derecho a utilizar la lengua materna: el autor expresa que los inmigrantes tienen derecho a mantener la lengua materna.

17. Restriccin de derechos: el autor expresa que los inmigrantes deben tener derechos
nicamente si cumplen determinadas condiciones: tener papeles, integrarse, no cometer delitos 18. Obligaciones. 18A. Obligaciones en general: el autor seala que los inmigrantes tienen obligaciones (sin especificar). 18B. Obligacin de adaptarse/integrarse: el autor seala que los inmigrantes deben adaptarse/integrarse en la sociedad receptora.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

101

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

18C. Obligacin de cambiar alguna de sus caractersticas o abandonar alguna de sus costumbres: el autor seala que los inmigrantes deben cambiar alguna de sus caractersticas o abandonar alguna de sus costumbres. 18D. Obligaciones cvicas: el autor seala que los inmigrantes deben cumplir obligaciones cvicas (normas de convivencia, respeto por los dems). 18E. Obligacin con el euskara: el autor seala que los inmigrantes deben respetar/aprender el euskara. 18F. Obligacin con la cultura/costumbres de la sociedad de acogida/vasca: el autor seala que los inmigrantes tienen obligaciones hacia las costumbres/cultura vascas o locales. 18G. Otras obligaciones. 18H. Obligacin de no imponer su cultura: el narrador seala que los inmigrantes no deben imponer su cultura en la sociedad receptora.

6. Interpretacin de los resultados


A continuacin presentaremos los resultados de nuestro anlisis teniendo en cuenta tanto los aspectos cuantitativos como los cualitativos. En primer lugar, cabe destacar que el concepto de inmigrante es empleado de un modo muy difuso en varios textos. Algunos sujetos hacen mencin a bebs adoptados o a nios y jvenes (especialmente saharauis) que vienen a pasar una temporada en verano. Otros incluyen en ese grupo a los miembros de etnia gitana. Hay incluso quien rescata del recuerdo a personas que conoci en viajes realizados al extranjero. Todo ello indica que hay narradores que no tienen claro el concepto de inmigrante. Por otro lado, parece que a la hora de pensar en inmigrantes ciertos narradores han establecido un criterio tnico que diferencia al nosotros (quienes son como yo) de los dems (todos los dems; es decir, todas aquellas personas que no estn incluidas en ese nosotros: gitanos, nios adoptados en China, gente conocida en Sudamrica). En lo que respecta a esta investigacin, no hemos cuantificado los contenidos que se distanciaban notablemente del concepto de inmigrante. El anlisis de todos los datos obtenidos requerira un tratamiento que supera los lmites del presente texto, por lo que nos limitaremos a los ms relevantes. Hemos seleccionado algunos fragmentos de las narraciones que resultan significativos para ilustrar los datos. Las citas son literales y estn traducidas del euskara, que es la lengua en la que se realizaron las narraciones. 1. RAZONES PARA EMIGRAR 54 alumnos citan las razones que tienen las personas para emigrar, a pesar de que en el guin que se les ha ofrecido no se les peda que hablaran de esa cuestin. sta es, precisamente, la categora que ms se repite y evidencia que los narradores tienen presente que tras el fenmeno de la emigracin existen unos motivos. Las explicaciones ofrecidas son muy variadas y pueden ser ordenadas en un continuum, donde en un extremo se pueden situar las circunstancias y expectativas personales y en el otro la injusticia, el desequilibrio global y la responsabilidad de los pases occidentales. Entre las razones mencionadas la que se repite con ms frecuencia es la bsqueda de un trabajo y una vida digna; por lo general, el nivel de anlisis resulta bsico o simplemente no existe tal anlisis.

Han emigrado siendo muy jvenes y han venido aqu en busca de trabajo, buscando otro trabajo y otro modo de vida. (0505GH) Por qu querrn estas personas abandonar su pas, sus amistades, su familia e irse a vivir a otro lugar? Estas preguntas que en ms de una ocasin me he planteado slo tienen una respuesta: la necesidad de una vida ms digna y mejor. (1201O
O)

La inmigracin actual ha sido originada en gran medida por razones econmicas, aunque son muchas las razones que impiden a esas personas vivir en sus pases: aparte de las razones econmicas, estn los conflictos polticos, demogrficos (07
06EB)

No creo que a nadie le guste emigrar, yo lo definira como una necesidad. Adems, si tenemos en cuenta que esta situacin se da en todo el mundo, es decir, si tenemos en cuenta que en todo el mundo la gente de pases pobres o de nivel bajo emigran a

102 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

pases desarrollados, no se puede hacer nada? No pueden mejorar esta situacin los pases ricos, reduciendo as la emigracin? (1201OO) Centrndome en la situacin actual, me parece que el mundo se est tambaleando definitivamente. La riqueza se concentra cada vez ms en manos de unos pocos mientras muchos pases se sumergen en una situacin de pobreza insostenible. Encima, nos parece mal que vengan a nuestras ciudades en busca de unas condiciones dignas de vida, porque creemos que peligra nuestra riqueza, en el sentido ms amplio de la palabra. (1028IH)
3. RESPONSABILIDAD MORAL/POLTICA/SOCIAL Esta categora aparece en 19 textos, lo que indica que un notable nmero de narradores tiene conciencia sociopoltica y cree que existe una responsabilidad pblica en el trato hacia los inmigrantes. Tomando como referencia la clasificacin realizada por Kohlberg (1997) en relacin con la madurez moral, podemos afirmar que hay alumnos con un alto nivel de desarrollo moral, si bien en algunos casos expresan su conciencia o sus reivindicaciones de un modo desordenado. [] el sistema es el responsable y el culpable de la penosa situacin de los inmigrantes. Y tambin de la de las familias y personas que no son inmigrantes. Ciertamente, en nuestros pases hay mucha gente en paro y como consecuencia de la manipulacin a la que nos somete el sistema, esas personas acusan a los inmigrantes de haber venido a quitar puestos de trabajo, lo que provoca conductas y situaciones de enfrentamiento, cuando la culpa, la verdadera culpa es del sistema. Todo ello hace que la situacin de la sociedad empeore, lo que se refleja en un aumento de la xenofobia y de las actitudes racistas. (0220UA)

Esta situacin la provocan la sociedad en general y los individuos en particular, y es algo que todos y todas aceptamos. Es, adems, una situacin que toleran los polticos, las instituciones y los medios de comunicacin; por lo tanto, lo considero un problema que se genera en la base de la sociedad. (1005AA)
4. AYUDA/BUEN TRATO Este contenido aparece en 32 textos. Los narradores creen que las personas autctonas somos responsables de la acogida y la integracin de los inmigrantes. Podemos decir que la categora refleja un alto desarrollo moral de dichos narradores. En algunos pasajes, el contenido hace referencia al principio de reciprocidad, de modo que se relaciona la ayuda y el buen trato para con los inmigrantes con la respuesta que se quiere conseguir de ellos: los inmigrantes deben recibir un buen trato si se quiere que tambin ellos se comporten de un modo apropiado (con respecto a la cultura, las normas, etc. del lugar de acogida).

Para que se d un proceso adecuado de integracin, es necesario que ambas partes realicen un esfuerzo. [] Es cierto que toda accin tiene alguna razn que la impulsa. [] Por ello, es necesario que desde un principio [] se les ofrezcan oportunidades, cuidando el trato que se les da. Es importante que se sientan a gusto, que tengan la sensacin de que son aceptados. De ese modo, no seran tan frecuentes los puntos negros que en ocasiones se relacionan con ellos (violaciones, robos).
(1022CU)

[] para facilitar la convivencia, me parece muy importante que tanto los inmigrantes como las autctonas practiquemos un respeto mutuo. (0519IG) Tambin nosotros tenemos que comprender que en ciertos momentos los inmigrantes tampoco se sentirn cmodas, de modo que deberamos estar dispuestos a ofrecer nuestra ayuda en lo que respecta a la lengua, las costumbres, etc. Tambin a m me gustara que me ofrecieran ayuda si tuviera problemas. (0227AB)
5. EL ESFUERZO/EL SACRIFICIO/EL VALOR DE LOS INMIGRANTES Esta categora aparece en 23 textos. Los narradores hacen mencin de las penas, el sufrimiento y el valor de que hacen gala los inmigrantes cuando inician su viaje. Los narradores que hacen referencia a esta categora muestran sentimientos de empata.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

103

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

[] la mayora de las personas llegan debilitadas, sin poder caminar, embarazadas, etc. con la esperanza de que aqu encontraran una buena vida, pero al final no suele ser as, no es tan fcil. (0916AA) Son pateras llenas de sueos, que transportan a personas llenas de sueos e ilusiones, desafiando al mar, escondindose entre el oleaje y un nuevo mundo se abre ante ellas cuando llegan a la costa, un mundo lleno de oportunidades. Quienes pisan tierra firme son afortunados por el mero hecho de haber llegado con vida [] El peligro ha quedado atrs, pero no todos los cuentos acaban del mismo modo (05
27LL) 6. LA EMIGRACIN DE LOS VASCOS Han sido 15 personas las que han recordado que tambin ha habido ciudadanos vascos que han sido inmigrantes en otras tierras o que pueden volver a serlo en un futuro. Tambin los ciudadanos vascos han emigrado en ocasiones y han padecido las situaciones y los problemas que conlleva el hecho de emigrar. Al igual que ocurre con la categora anterior, con sta tambin se muestra empata; recordar el hecho de que los vascos han sido emigrantes ayuda a acercarse a la situacin de los inmigrantes.

[] Tambin las generaciones que nos precedieron hicieron lo mismo cuando aqu haba una crisis econmica. (0802UB) Por otro lado, no se puede olvidar que en cierta poca tambin los vascos tuvimos que irnos de aqu impulsados por distintas razones y en busca de una vida mejor en otro lugar. Con esto quiero decir que siempre han existido movimientos de gente de unos lugares a otros. (0616CU).
7. LAS DIFICULTADES DE LOS INMIGRANTES Entre las dificultades a las que se hace mencin en los textos cabe destacar las que hacen referencia al empleo (34 menciones) y a la sociedad (31 menciones). En otras 12 ocasiones se citan los problemas en general y en 10 ocasiones se habla de vivir sin papeles. Los alumnos que hacen referencia a esta cuestin muestran conciencia o sensibilidad hacia las dificultades que padecen los inmigrantes, la marginacin y las injusticias que sufren.

A menudo sufren la explotacin, trabajando ms de ocho horas diarias sin que ello se refleje en sus sueldos. Una persona autctona que trabaja la misma cantidad de horas cobra un salario ms alto. En mi opinin, deberamos tener los mismos derechos y por el momento no veo claro que eso sea as. (0212UA) Cuando llegan aqu, padecen las conductas racistas de las personas autctonas y sus derechos son vulnerados. Muchas veces, la gente de aqu no ve con buenos ojos a los inmigrantes, por lo que stos tienen verdaderos problemas para integrarse. (0115
LD) Por otro lado, en 17 ocasiones se hace referencia a estereotipos y a generalizaciones. Los narradores mencionan que no es adecuada la tendencia existente en la sociedad a generalizar y a clasificar a las personas basndose en estereotipos.

[] tenemos demasiados prejuicios hacia los inmigrantes, o yo al menos los tengo. Creo que dichos prejuicios son suscitados por la sociedad; dira que ese es mi caso []. Creo que lo que he odo ha influido mucho en m, por la tendencia que tenemos a generalizar; es decir, si alguien relata alguna mala experiencia vivida con una persona extranjera, pensamos que todas las personas extranjeras son iguales, aunque no las conozcamos. (0212.SM) [] Pero a menudo tendemos a generalizar ese tipo de comportamientos y debido a unos pocos pensamos que todos deben ser iguales. (0505AU)
8. LA INMIGRACIN COMO FENMENO POSITIVO Son muchas las veces en que aparece esta categora. 33 alumnos opinan que algunas personas inmigrantes o los inmigrantes en general se integran en la sociedad y 11 dicen que aprenden euskera. Tambin se hace mencin a la aportacin de los inmigrantes en el mbito laboral (13); se cita que aportan riqueza a nivel cultural (18) y tambin a nivel humano (17).

104 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

[] me parece positivo que estemos mezclados en la sociedad; de ese modo,

podemos ver, conocer y tener en nuestro entorno otros modos de pensar y otras costumbres. (0120MD) Segn lo veo yo, se han adaptado muy bien a la vida de nuestra tierra y han aprendido muy bien nuestra lengua [] A sus padres, en cambio, les est costando ms debido a la lengua, la cultura, la religin y las costumbres, pero tambin ellos estn haciendo un esfuerzo y lo estn logrando rpidamente con la ayuda de todos.
(1112AZ)

() he tenido relacin directa con personas extranjeras o de otra cultura y a decir verdad, por lo general he tenido buenas relaciones. No he tenido ningn tipo de problema con ellas, y adems, me parece enriquecedor que convivamos todos juntos. Me parece imprescindible que aprendamos a vivir todos juntos, pues eso nos ofrecer la oportunidad de aprender de ellos y viceversa. (0727ZM).
9. LA INMIGRACIN COMO PROBLEMA Las categoras descritas hasta el momento reflejan una actitud positiva hacia la inmigracin. La categora presente, en cambio, es reflejo de una actitud de desconfianza. Han sido mltiples las apariciones de esta categora; 29 alumnos opinan que los inmigrantes en general no se integran adecuadamente y 12 expresan que la inmigracin tiene un efecto negativo en el euskera. 18 opinan que incide negativamente en la cultura vasca. La delincuencia y el peligro se citan en 25 ocasiones; el machismo y la violencia de gnero en 9 ocasiones. Slo 5 alumnos mencionan la inmigracin como problema a nivel laboral y econmico (en tres ocasiones, unido a negocios de comerciantes chinos). [] Hay quienes emigran slo con la intencin de quebrantar la ley en el pas al que

emigran; por ejemplo, para dedicarse al mundo de la droga, al robo, para generar conflictos y no estoy nada de acuerdo con esa actitud. (0912MG)
[] a nuestro pas llega mucha gente del exterior, y ha quedado claro que podemos convivir sin ningn problema. Pero no se integran en nuestra cultura, y si la cultura vasca y Euskal Herria son pequeas, ahora se estn volviendo cada vez ms pequeas. [] No s, al final, veo que esa es la parte negativa de la inmigracin, la desaparicin de los valores propios o al menos, su reduccin. (0714BE)

Quienes intentan sacar adelante su vida tendran que integrarse en esta cultura, y si no lo hacen, al menos deberan respetarla, ya que al fin y al cabo, se juntarn en un mismo lugar personas de todas partes y culturas y tanto culturas como razas desaparecern. Eso es lo que ms me preocupa. (0916AA) Hay algo que me da rabia de los de afuera y est unida a la lengua. Cuantos ms inmigrantes haya se hablar menos euskera y se ir perdiendo. Hay que reconocer que hay muchos euskaldunes que no hablan euskera, y por ellos y por los que vienen de afuera dejaremos a un lado el euskera, y eso me da rabia, porque el euskera ha sido mi lengua desde que nac. (0505IG)
10. CREENCIA SOCIAL: LA INMIGRACIN COMO PROBLEMA EN OPININ DE LA SOCIEDAD Tambin hay quien ve las subcategoras del punto anterior desde otra perspectiva. Los narradores expresan que la sociedad ve a los inmigrantes y la inmigracin como un problema y muestran su desacuerdo con ese punto de vista. Las subcategoras son, por lo tanto, las mismas que en el punto 7, pero en este caso reflejan una actitud positiva. En opinin de 13 alumnos la desconfianza de la sociedad est unida al mbito laboral y econmico; 12 opinan que la sociedad relaciona inmigracin con delincuencia y con peligro; segn 12 alumnos, se ve la inmigracin como perjudicial para la cultura vasca. Finalmente, 10 alumnos mencionan crticas de la sociedad sin especificar ms. []en nuestros pases hay mucha gente en paro y como consecuencia de la manipulacin a la que nos somete el sistema, esas personas acusan a los inmigrantes de haber venido a quitar puestos de trabajo, lo que provoca conductas y situaciones de enfrentamiento, cuando la culpa, la verdadera culpa es del sistema. Todo ello hace que la situacin de la sociedad empeore, lo que se refleja en un aumento de la xenofobia y de las actitudes racistas. (0220UA)

Tal y como ha ocurrido en otros lugares, culpamos a los inmigrantes de muchos de los problemas que tenemos: la delincuencia, las drogas, el paro, el monopolio de las

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

105

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

ayudas sociales En muchas ocasiones hemos odo ese tipo de argumentos, sobre todo en barrios en los que hay una concentracin masiva de inmigrantes [] Acaso no vemos por qu vienen estas personas?Por qu se concentran en zonas pobres?Estamos seguros de que son los responsables de la situacin?Qu solucionamos con ello? (1028IH)
12. LA RESPUESTA DE LA EDUCACIN A pesar de que los narradores se encuentran a las puertas de ejercer su profesin de docentes, es un contenido que no aparece con mucha frecuencia en los textos. Aun as, 14 narradores mencionan en sus escritos la funcin de la enseanza. He aqu un ejemplo:

Otro problema que se da en las aulas son los inmigrantes que llegan para una temporada, segn me han manifestado algunos profesores. Es algo que no suele saber el personal docente y ofrecen a los inmigrantes que estn en el aula todos los medios a su alcance; es decir, se invierte mucho tiempo en tratar de lograr que el alumno inmigrante consiga seguir el ritmo del resto de la clase, dejando de lado en cierta medida al resto de la clase. Y todo ello para qu? Al cabo de un mes vuelven a marcharse sin decir una palabra. Eso, en mi opinin, es una falta de respeto tanto para con los profesores como para con los alumnos. (0119EA)
13 Y 14. BUENAS EXPERIENCIAS Y MALAS EXPERIENCIAS Segn hemos podido ver en los textos, el contacto directo con los inmigrantes es escaso. Cuando ha habido alguna relacin, ha sido en muchos casos en el mbito laboral (sobre todo en hostelera), y en poca de prcticas de magisterio. En la mayora de casos las relaciones han sido positivas. Han sido numerosos 51 en concreto los casos en los que se han relatado experiencias positivas.

Hoy en da los inmigrantes son cada vez ms en mi pueblo y en consecuencia, tambin me he encontrado con inmigrantes en mi trabajo. Trabajo en un bar y tambin trabajan all una persona de Brasil y otra de Bolivia. Veo la situacin con normalidad, no tengo ningn tipo de problema y tenemos muy buena relacin. Trabajamos muy a gusto juntos y tambin nos vemos fuera del trabajo, les tengo mucho aprecio. (0730GA). Por fortuna, conozco muchos portugueses muy agradables adems de mi vecino. Trabajo en una ikastola y all hay 5 nios portugueses. Conozco a todos sus padres y madres ya que soy yo quien est con ellos cuando van a recogerlos, y debo decir que se trata de gente muy sencilla y muy agradable. (415OA) Como curiosidad, en cierta ocasin me encontraba en Zumaia haciendo autostop para ir a Getaria. Pasaron 50 coches (48 seran de Euskal Herria, quin sabe cuntos seran euskaldunes, ni idea de cuntos seran abertzales, y tampoco s cuntos seran seguidores de la Real. Los otros dos, turistas europeos) y quien me recogi fue un rumano. Una persona muy agradable. (1024AA).
En cambio, aparecen en 20 textos experiencias negativas, en ocasiones no muy cercanas.

Contar una ancdota que me ocurri con un rumano. Este nio tendra unos 12 aos y se pasaba el tiempo pegando a los dems, provocndoles, pegando a los cuidadores y faltndoles al respeto. A decir verdad, era insoportable y al final decidimos llevarlo a casa. Entonces conocimos a sus padres y tuvimos una gran discusin. De ah deduzco que los padres tienen una enorme influencia sobre sus hijos e hijas y que la educacin es una herramienta bsica para adaptarse adecuadamente. (0827IS)
() en el pueblo hemos tenido contacto con un grupo de nios inmigrantes, aunque no fue un contacto directo. Un grupo de menores de edad que estaba internado en Tolosa vino a Segura a pasar una temporada y provocaron bastantes daos en el pueblo. Como consecuencia, la gente del pueblo se enfad y hubo bastantes discusiones. (0426GF) Por otro lado, en muchos textos aparecen aspectos tanto positivos como negativos.

Seguramente, no son muchas las experiencias que he tenido con inmigrantes, pero han sido muy enriquecedoras para mi vida personal. Pero tambin he tenido

106 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

experiencias desagradables con los inmigrantes que relatar en el prximo texto.


(1222SH) 15 Y 16. DESCONFIANZA/MIEDO/ODIO VS. COMPASIN/EMPATA/ADMIRACIN En 23 narraciones se manifiestan sentimientos negativos. Positivos, en cambio, en 14. Las manifestaciones se han contabilizado cuando el narrador ha empleado alguno de los trminos estipulados; es decir, las investigadoras no hemos inferido dichos sentimientos basndonos en el contenido de los textos. Dicho procedimiento explica tal vez la diferencia en el nmero que contrasta con lo recogido en las categoras 12 y 13 (tal y como hemos visto, se describen muchas ms experiencias positivas que negativas).

En mi pueblo hay muchos inmigrantes procedentes de Pakistn, hombres en su mayora, y no me gustan nada; incluso he llegado a odiar a algunos debido a las experiencias desagradables que he tenido. (0730GA) Muchos de los que he conocido son muy agradables y la relacin es buena, pero tambin he vivido experiencias negativas y ello me ha llevado en ms de una ocasin a sentir desconfianza. Por ejemplo, hace un par de aos una persona de latinoamrica sola perseguir a un amigo mo (a una amiga mai), generalmente de noche y cuando iba sin compaa. Lo que nos contaba y lo que vivimos sus amigos nos llev a sentir miedo. (0901GA) A m muchos me dan pena. (212UA) En su modo de expresarse se ve que han tenido una vida difcil y los admiro por haber escapado de su pas en busca de una salida a su situacin. (512LP)
17 Y 18. DERECHOS Y RESTRICCIN DE DERECHOS Muchos alumnos (47) expresan que los inmigrantes tienen derechos en general, sin especificar cules son esos derechos. 26 mencionan derechos concretos (relacionados con la vivienda, la educacin, la sanidad, etc.) y 22 mencionan el derecho a conservar su cultura y sus costumbres. A menudo la formulacin est basada en el concepto de reciprocidad.

Los inmigrantes deberan tener nuestros mismos derechos. No debera importar que hayan llegado de un modo legal o ilegalmente. (1222LA) En general, opino que los inmigrantes deberan tener los mismos derechos y las mismas obligaciones que tenemos los dems. Si pedimos que en otros pases se nos trate con respeto, tambin nosotros debemos ofrecerles lo mismo a ellos. (1210A
I)

Ya s que tambin ellos tienen derecho a vivir como nosotros, pero en mi opinin la tendencia de la inmigracin hoy en da es terrible [] Ya s que hay que tratar igual a las personas que llegan del extranjero, pero si vienen aqu tambin ellos tendrn que cambiar sus hbitos de vida en cierta medida []. (0827IS)
Por otro lado, en 20 narraciones los alumnos se muestran a favor de la restriccin de los derechos de los inmigrantes, aduciendo que no deberan tener todos los derechos que tienen los autctonos o que stos ltimos deberan tener preferencia en ciertos aspectos, o bien que deberan tener los mismos derechos siempre y cuando cumplan ciertas condiciones (tener papeles, respetar las reglas, integrarse).

Por lo tanto, dira que un inmigrante debera tener los mismos derechos que un autctono si el inmigrante respeta todo lo que es de los ciudadanos y siempre y cuando haga todo lo que pueda por integrarse. (0829BU)
[] en mi opinin, todas las personas tenemos los mismos derechos y las mismas

obligaciones estemos donde estemos. Por lo tanto, el inmigrante que no tiene problemas para esta aqu, es decir, aquel que tiene sus papeles en regla, debera tener los mismos derechos que todos los dems, tanto en el trabajo como en la enseanza, en los servicios de salud, etc. (0424EL) Los inmigrantes tienen que tener sus derechos, en algunos aspectos como nosotros. En cambio, para conseguir trabajo, por ejemplo, nosotros deberamos tener algunas facilidades en comparacin con ellos porque se trata de nuestro pas. (0912MG)

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

107

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

[] en mi opinin, alguien que vive aqu debe tener ms derechos que alguien que viene de afuera. (0827IS) 19. OBLIGACIONES En lo que respecta a las obligaciones son 17 los alumnos que sealan que los inmigrantes tienen obligaciones (en general o sin concretar); 20 especifican que tienen la obligacin de integrarse; 22 mencionan la obligacin para con el euskera (de aprenderlo, de mostrar inters o respeto) y 39 hablan de la obligacin para con la cultura vasca. En multitud de textos las obligaciones aparecen unidas a los derechos especialmente las obligaciones para con la cultura y la lengua autctonas. Slo en un caso se menciona el espaol; el resto de las menciones hacen referencia al euskera. Frecuentemente, a la hora de citar las obligaciones, se hace uso de las frmulas de reciprocidad anteriormente mencionadas.

Obtener nuestros mismos derechos requiere a su vez el cumplimiento de ciertos deberes. Deberan acomodarse a nuestra sociedad, adquiriendo algunas costumbres, aprendiendo la lengua e integrndose por completo en la sociedad. (1222LA) Para finalizar, quiero decir s a la integracin si los que llegan de afuera aprenden nuestra lengua, respetan nuestra cultura, aceptan nuestras normas de convivencia y no imponen su religin y cultura. (1129AE) Por ltimo, en mi opinin, tambin los inmigrantes tienen que tener derecho a un trabajo digno, a un sueldo digno, a una vivienda Pero al mismo tiempo, deberan respetar la cultura de aqu, es decir, la cultura vasca y aprender la lengua materna de los de aqu, ya que de lo contrario, lo tenemos claro con el euskera. Si yo voy a otro pas no tendr oportunidad de aprender en euskera y tendr que adaptarme a la lengua y a la cultura de all; por eso, en mi opinin, tambin aqu debera ser igual.
(0505AU)

Tambin ellos deben actuar adecuadamente, respetando las reglas de aqu y comportndose debidamente; deben respetar nuestras costumbres, cultura, idioma aunque mantengan las suyas. (1011MG)

7. Discusin y conclusiones
En las siguientes lneas exponemos algunas conclusiones generales de nuestro estudio. En primer lugar, podemos afirmar que hemos visto confirmada la hiptesis que establecamos al comienzo de la investigacin. La participacin del alumnado es un elemento fundamental en la metodologa de HUHEZI y los alumnos exponen sus conocimientos previos, creencias y percepciones en las sesiones de formacin. An as, tal y como sospechbamos en el grupo de investigacin, los alumnos filtran sus declaraciones. As ha quedado demostrado que en los textos analizados emergen ciertas expresiones que no se manifestaban en el aula, especialmente aquellas que no son polticamente correctas: temores, miedo, prejuicios, malas experiencias... El discurso reflejado en los textos y el que se muestra en el aula no es, por lo tanto, el mismo y las investigadoras corremos el riesgo de centrar nuestra atencin especialmente en los aspectos conflictivos. Al analizar los textos podemos concluir que muchos narradores manifiestan actitudes negativas con respecto a los inmigrantes y la inmigracin. En ese sentido, es necesario resear que la cuantificacin de las manifestaciones ha resultado una herramienta indispensable para el equilibrio de dicha percepcin. Tal y como hemos visto anteriormente, el cmputo de las categoras nos indica que existe una gran variedad y que no podemos inferir la existencia de un predominio de actitudes negativas. Resulta evidente que no podemos referirnos al alumnado como si se tratara de un colectivo homogneo. En consonancia con lo dicho anteriormente, son ms las categoras que se pueden relacionar con actitudes positivas (1, 2, 3, 4, 5, 7, 8, 10, 11, 12, 13, 16, 17) que aquellas que se pueden relacionar con actitudes negativas (9, 14, 15, 19). Tal y como hemos sealado en un principio, las categoras no haban sido establecidas previamente, sino que fueron deducidas de los propios textos. Nuestro anlisis evidencia la pluralidad de pensamientos. Es necesario subrayar que en los textos se reflejan con frecuencia opiniones y actitudes contrapuestas: junto a una buena experiencia se relata una mala

108 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

experiencia, y tras enumerar los aspectos positivos de la inmigracin se citan aspectos negativos de la misma. Una parte del alumnado refleja conciencia sociopoltica. Muchos han expuesto cules son las razones para emigrar y las penosas condiciones que padecen en muchos sentidos quienes emigran. Al mismo tiempo, los textos rara vez reflejan un pensamiento complejo: son pocos los textos que recogen argumentos complejos o que buscan las razones que existen tras los acontecimientos y las actitudes. Por otro lado, numerosas manifestaciones son expresadas utilizando una frmula de reciprocidad. En lo que respecta a los aspectos negativos, cabe subrayar las referencias a la delincuencia y al machismo. En los textos analizados queda patente una preocupacin: el efecto negativo de la inmigracin en la supervivencia de la lengua y la cultura vascas. Gran parte del alumnado defiende que los inmigrantes deben aprender euskera y deben conocer y respetar la cultura vasca... o critican las actitudes negativas de los inmigrantes en ese sentido. Al mismo tiempo, no son pocos quienes afirman que los inmigrantes se integran (en general), pero casi la misma cantidad asegura que no se integran bien. Algunos de nuestros alumnos se basan en comentarios que oyen y en ancdotas, sin ser conscientes de su tendencia a generalizar. De todos modos, hay una cantidad significativa de alumnos que son conscientes de que existen actitudes (tanto por parte de ellos mismos como por parte de otras personas) que se basan en estereotipos y en generalizaciones y critican esas actitudes. Hay alumnos que reconocen su visin limitada, su falta de conocimiento y sus sentimientos negativos (temor, desconfianza...); reconocen que deben aprender y cambiar notablemente en lo que respecta a este tema. Hemos constatado que el texto ha sido una herramienta para la autoreflexin y para poner en marcha un cambio en las actitudes y las creencias. La lista de categoras ha resultado un instrumento eficaz para nuestro anlisis. Precisamente, la creacin de dichas categoras ha supuesto uno de los aspectos ms relevantes de dicho anlisis y creemos que nos resultarn de utilidad en otros que se puedan realizar en un futuro.

8. Conclusiones en el terreno didctico


En la materia denominada Educacin intercultural y desarrollo de valores que se imparte en la Facultad de Humanidades y Ciencias de la Educacin HUHEZI (Mondragon Unibertsitatea) y tal y como ocurre en cualquier otra materia, resulta fundamental el estmulo de un aprendizaje significativo y el hecho de partir de los conocimientos previos y las actitudes del alumnado. Sin lugar a dudas, esta investigacin ha sido de gran valor para aproximarnos de manera ms certera a los conocimientos previos y a las actitudes de los jvenes que cursan la carrera de Magisterio. Por otro lado, conviene recordar que quienes hemos tomado parte en la investigacin somos a la vez docentes universitarias y debemos reflexionar sobre nuestra prctica docente. Esa investigacin seala algunos temas que precisan ser objeto de intervencin en la citada materia para impulsar el desarrollo de la competencia intercultural de nuestro alumnado. Hemos detectado, entre otros, la preocupacin por el euskera, los estereotipos presentes, el concepto de integracin, las razones profundas de la inmigracin y la restriccin de los derechos. Merece la pena tener en cuenta estos aspectos en nuestra intervencin pedaggica. Tambin hemos advertido otros aspectos interesantes y que merecen mayor atencin: por ejemplo, la etnia gitana es mencionada en algunos textos, y casi siempre con connotaciones negativas. Los propios textos pueden constituir una herramienta pedaggica valiosa. Tanto algunos textos completos como ciertos pargrafos escogidos pueden ser el dispositivo de formacin para incentivar la reflexin entre los alumnos. Por ltimo, queremos hacer hincapi en el escaso contacto que tienen los alumnos con los inmigrantes, al igual que las experiencias positivas relatadas con relacin a esos contactos, en vista de lo cual convendra impulsar en el diseo de la formacin situaciones que favorezcan el contacto y la relacin con personas de origen extranjero.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

109

Amelia Barqun, Nerea Alzola, Mnika Madinabeitia & Ane Urizar

Referencias bibliogrficas
ALZOLA MAIZTEGI, N. (2004). Propuestas ticas en libroslbum de literatura infantil. Diseo y aplicacin de un modelo para el anlisis de valores. Bilbo: EHU. BOLIVAR, A., DOMINGO, J. & FERNNDEZ, M. (1998). La investigacin biogrficonarrativa en educacin. Gua para indagar en el campo. Granada: Grupo Force/Grupo Editorial Universitario. BOLIVAR, A., DOMINGO, J. & FERNNDEZ, M. (2001). La investigacin biogrficonarrativa en educacin. Enfoque y metodologa. Madrid: La Muralla. BRUNER, J. (1992). Actos de significado. Ms all de la revolucin cognitiva. Madrid: Alianza. BRUNER, J. (1994). Realidad mental y mundos posibles. Los actos de imaginacin que dan sentido a la experiencia. Madrid: Gedisa. BRUNER, J. & WEISSER, S. (1995). La invencin del yo: la autobiografa y sus formas. En D. R. OLSON & N. TORRANCE, Cultura escrita y oralidad. Barcelona: Gedisa, 177202. CALVO POBLACIN, G. F., CALVO FERNANDEZ, M. & ALEJO MONTES, F. J. (2002). Percepcin de la interculturalidad en los alumnos de 1 de Educacion Fsica de la Facultad de Formacin del Profesorado de Cceres. Revista electrnica Interuniversitaria de Formacin del Profesorado 5, 1. COLECTIVO IO (1996). La educacin intercultural a prueba: hijos de inmigrantes marroques en la escuela. Madrid: CIDE. COLECTIVO IO (1997). La diversidad cultural y la escuela. Discurso sobre atencin a la diversidad con referencia especial a las minoras tnicas de origen extranjero. Madrid: CIDE (documento no publicado). GARRETA BOCHACA, J. (2003). Espejismo intercultural: la escuela de Catalua ante la diversidad cultural. Madrid: CIDE. GONZLEZ MONTEAGUDO, J. (2007). Historias de vida y teoras de la Educacin: tendiendo Puentes. Encounters on Education, 8, 85107. JORDN, J. A. (1994). La escuela multicultural. Un reto para el profesorado. Barcelona: Paids. KOHLBERG, L., POWER, F. C. & HIGGINS, A. (1997). La educacin moral segn Lawrence Kolhberg. Barcelona: Gedisa. LPEZREILLO, P. & GONZLEZ GARCA, D. (2006). Las creencias del profesorado acerca del alumnado de diversa procedencia cultural, Formacin del profesorado: prctica escolar. Actas del Congreso Internacional de Educacin Intercultural (http://www.uned.es/congresointereducacion intercultural/Grupo_discusion_1/11.%20P.pdf; consulta: 20099). MEDRANO, C. (coord.) (2007). Las historias de vida. Implicaciones educativas. Buenos Aires: Alfagrama. MEDRANO, C., AIERBE, A. & CORTS, A. (2002). Hacia una comprensin de los mbitos de desarrollo personal desde el enfoque narrativo. Revista Espaola de Pedagoga ao LX, 223, 523542. MIDDLETON, V. A. (2002). Increasing Preservice Teachers Diversity Beliefs and Commintment. The Urban Review 34 (4), 343361. ORTIZ COBO, M. (2008). Inmigracin en las aulas: percepciones prejuiciosas de los docentes. Papers 87, 253268. POHAN, C. A. & AGUILAR, T. E. (2001). Measuring Educators Beliefs About Diversity in Personal and Professional Contexts. American Educational Research Journal 38 (1), 159182. RICOEUR, P. (2000). Del texto a la accin. Ensayos de hermenutica II. Buenos Aires: Fondo de Cultura Econmica de Argentina. RODRIGUEZ IZQUIERDO, R. M. (2005). Estudio de las concepciones de los estudiantes de magisterio sobre la diversidad cultural. Educar 36, 4959. RUIZ OLABUNAGA, J. I. (1999). Metodologa de la investigacin cualitativa (2 ed.). Bilbao: Deustuko Unibertsitatea.

110 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

El pensamiento del alumnado de magisterio sobre la inmigracin y los inmigrantes

SIQUS, C., VILA, I. & PERERA, S. (2009). Percepciones y actitudes del alumnado extranjero y del profesorado: un estudio emprico en las aulas de acogida de Catalua. Electronic Journal of Research in Educational Psychology 17, vol 7 (1), 103132. TODOROV, T. (1991). Crtica de la crtica. Barcelona: Paids. URIZAR, A. (2007). Mondragon Unibertsitateko (MU) Humanitate eta Hezkuntza Zientzien (HUHEZI)

Fakultateko Irakasle Ikasketerako 2. eta 3. mailako ikasleek kulturartekotasunaren inguruan duten pertzepzioa. Suficiencia investigadora (trabajo no publicado).
VECINA MARCHANTE, C. (2005). Profesores y alumnos inmigrantes. Dos protagonistas condicionados.

Convergencia con Europa y cambio en la universidad: XI Conferencia de Sociologa de la Educacin. Santander (Jatorria: http://dialnet.unirioja.es/servlet/extaut?codigo=1055324;
kontsulta: 20099).

En euskera no se distingue el gnero.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 95-111

111

REFERENCIA: Ochoa, Azucena & Peir, Salvador (2010). Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa). REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa)1
AzucenaOCHOACERVANTES SalvadorPEIRIGREGORI
Correspondencia: AzucenaOchoaCervantes Correoelectrnico: azus@uaq.mx Telfono: 4421901200(6315) Direccinpostal: FacultaddePsicologa UniversidadAutnomade Quertaro 76010(Mxico) SalvadorPeiriGregori Correoelectrnico: salvador.peiro@ua.es Telfono: 0034610811724(3664) Direccinpostal: FacultaddeEducacin UniversidaddeAlicante SanVicentedelRaspeig 03590Alicante(Espaa) Recibido:20deabrilde2010 Aceptado:18deoctubrede2010

RESUMEN
Enlosltimosaossehaincrementadolapreocupacinpor elclimadeconvivenciaqueseviveenloscentrosescolares. En este trabajo hemos realizado un estudio comparativo entre Mxico y Espaa para indagar acerca de las actuaciones de los profesores de Primaria, Secundaria y Preparatoria ante situaciones que alteran la convivencia escolar. Conesteobjetivo,seaplicuncuestionariode27tems.Los datos fueron procesados en un software creado por Peir (2000), de la Universidad de Alicante. Los resultados muestran que las actuaciones de los docentes, en ambos grupos,sonlimitadasparaafrontarsituacionesquepuedan generarladisconvivencia.

PALABRAS CLAVE: Convivencia escolar, Indisciplina en educacin,Actuacionesdocentes,Conflicto.

A comparative study of teachers performance in situations which alter school coexistence: The cases of Queretaro (Mexico) and Alicante (Spain)
ABSTRACT
In recent years there has been increased concern about the environment of peaceful coexistence at schools. In line with this concern we conducted a comparative study between Mexico and Spain. This study aims to explore the performance of teachers in primary, secondary and high school situations
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113-122

113

Azucena Ochoa & Salvador Peir

whichdisruptschoolcoexistence.Toachievethisobjectiveweuseda27itemquestionnaire.Thedata obtained were processed with software created by a member of the research team, Peir (2000, UniversidaddeAlicante).Theresultsshowthatteachers'performanceinbothgroupsarelimitedtobe ablehandlesituationsthatmaycauseincivility.

KEY WORDS: Schoollife,Disciplineineducation,Teachingperformance,Conflict.

1. Introduccin
Uno de los objetivos prioritarios de la educacin es formar en la convivencia pacfica y en aquellos valores que permitan a los jvenes integrarse responsablemente en esta nueva sociedad, y responder a los retos que los profundos cambios sociales estn planteando. La preocupacin por atender desde la educacin a los cambios sociales adopta formulaciones diferentes, pero muy coincidentes en lo sustancial. Educacin CvicoSocial, Educacin para la Paz, Educacin Intercultural, Formacin tica, Educacin en los Derechos Humanos y Educacin Moral son caras de una misma sensibilidad educativa. Si la educacin para la convivencia debe ser un objetivo bsico en los centros escolares, la Escuela debe ser una comunidad y un espacio de convivencia diseado y constituido para desarrollar valores, as como un clima motivante para dotar de sentido los procesos escolares de enseanza y aprendizaje. El reciente reporte de la OCDE (Talis, 2009) sobre la situacin del clima convivencial escolar no desdice los hallazgos de Peir (2001, 2002, 2003, 2005 y 2007) ni los de otros investigadores (REY & MARCHESI, 2005). Si bien estos ltimos refieren como problema principal la falta de respeto, nosotros sealamos la indisciplina como el fenmeno ms extendido (PEIR, 2005). Las investigaciones que se han llevado a cabo con el propsito de estudiar la percepcin que tiene los profesores de la conducta rebelde de sus estudiantes durante el desarrollo de la clase, bien en la Educacin Primaria (WHELDALL & MERRETT, 1988) o en Secundaria (HOUGHTON, WHELDALL & MERRETT, 1988), argumentan que la problemtica ms grande se da en el nivel bsico secundario. Las investigaciones de KaltialaHeino, Rimpel, Rantanen & Rimpel (2000); y Sourander, Helstel, Helenius & Piha 2000 han verificado que el incremento de las conductas contradictorias tiene lugar durante el primer ciclo de la Secundaria y su decremento sucede ms tarde, al final de esta fase educativa. Como tales hechos suceden en todas las asignaturas de cada rea curricular (ISHEE, 2004), los efectos son muy negativos para el logro de los fines del sistema educativo, pues los docentes no pueden explicar las lecciones y emplean gran parte de su tiempo en ser meros cuidadores. Segn la OCDE Talis, 2009 ,un 16% de los docentes emplean la mayor parte de su tiempo en cuidar a los estudiantes. Tal prdida de tiempo y energas se aprecia en que los directores de colegios de educacin secundaria en el 2004 dedicaban el 50% de su tiempo a resolver casos de vandalismo y, en el 2006, el 66,66% de su horario a proporcionar ayuda en los problemas de convivencia. La comentada situacin suele desestabilizar tanto a estudiantes como a maestros (FERNNDEZBALBOA, 1991; ESTEVE, 2006). Las conductas indisciplinadas de los estudiantes representan a menudo una fuente de tensin profesional, al ser cuestionado el trabajo realizado por el maestro (GRAHAM, 1992), as como promover una distraccin de los estudiantes no directamente implicados en los hechos. Tambin es inquietante el abandono de la profesin (ESTEVE, 2005; FERNNDEZBALBOA, 1991), situacin que afecta especialmente a los docentes primerizos (BORKO, LALIK & TOMCHIN, 1987).

2. Antecedentes de la investigacin
En los ltimos aos, se ha incrementado la preocupacin por la dinmica que se produce dentro de las aulas de los centros educativos de los diferentes niveles. Ms an, muchos de los docentes expresan lo deteriorada que se encuentra la convivencia escolar. Esta inquietud ha generado un gran nmero de investigaciones y la mayora de stas se concentran en el aspecto del bullying o acoso escolar (OLWEUS, 1978; RUGBY & SLEE, 1991; DODGE ET AL., 1992; HIRANO, 1992; WHITNEY & SMITH, 1993; DEBARBIEUX, 1997; FUNK, 1997). Por otra parte, Escmez (2001) analiz Los conflictos en la escuela secundaria obligatoria. Indag, a travs de entrevistas, si en los centros existan conflictos o violencia. En trminos generales, el 56% de los profesores piensa que en la actualidad hay ms conflictos que antes y el 44% que hay pocos o ninguno. Entre los factores asociados a los conflictos, los profesores destacan la falta de inters y motivacin del alumnado, as como la existencia de lagunas en los conocimientos previos de los

114 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa)

estudiantes. El 57% no se siente preparado para afrontar los conflictos que surgen en el aula, un 40% se siente desmotivado ante este asunto, mientras que un 7% manifiesta su deseo de abandonar la docencia, si pudiera, y un 10% afirma que el tema de los conflictos en el aula no es su responsabilidad. Con los datos presentados en este estudio, podemos constatar la importancia de la formacin que deberan de tener los docentes para lograr los propsitos educativos de su nivel. Peir (2001) plantea la importancia de un trabajo interdisciplinario para la investigacin que sirva para la prctica pedaggica. Ante la interrogante que l mismo plantea respecto a qu ocasiona los problemas de violencia, el mencionado investigador concluye que algunas de las causas son: deficiencia en los valores de las sociedades donde el sujeto se socializa primariamente, falta de legitimacin de los valores escolares, que estn en disintona con los de la sociedad donde se desenvuelve el educando, socializaciones primarias defectuosas, desempeo de la docencia con superespecializacin, con excesiva divisin de funciones, contenidos, tareas, burocratizacin y rigidez organizativa de las escuelas, y fijacin en el nico rol de entendimiento, pero unido a la inalcanzabilidad de los objetivos del ciclo o nivel. Garca (2001) realiza un recuento de las investigaciones y las polticas sobre la violencia escolar en varios pases occidentales. Aunque no es un trabajo exhaustivo, presenta los resultados de lo que se ha realizado en: Estados Unidos, en los pases del norte de Europa, en el Reino Unido e Irlanda, Italia, Grecia, Portugal, Alemania, Blgica, Holanda y Francia. No obstante, no se menciona a ningn pas de Amrica Latina; de ah la importancia de realizar investigaciones que nos permita acercarnos a la realidad de los docentes mexicanos. Larrosa (2002) realiz un estudio denominado Necesidades del profesorado y la responsabilidad de la administracin educativa. Las situaciones exploradas, relacionadas con las necesidades del profesorado, fueron agrupadas en los apartados: situaciones relacionadas con las exigencias del trabajo docente, situaciones relacionadas con el reconocimiento de la profesin, situaciones vinculadas con las relaciones interpersonales del centro y condiciones del aula o centro para propiciar el trabajo. Los resultados indican que el porcentaje de insatisfaccin de los profesores que contestaron la encuesta es muy elevado y que afecta considerablemente el clima escolar. El trabajo que presenta Larrosa resulta relevante, pues este factor puede ser crucial para mantener un buen clima de convivencia en el aula. En Espaa se han puesto en marcha programas de intervencin con la intencin de promover la convivencia en los centros escolares (DAZAGUADO, 1996; ORTEGA, 1997; ORTEGA ET AL.; FERNNDEZ, 1998; CARBONELL, 1999; TRIANES & HERNNDEZ, 2001: citados en PEIR, 2009). La mayora de los estudios hacen referencia al hecho de que los actores que provocan las situaciones que generan violencia y de que no exista una buena convivencia son los alumnos. Sin embargo, poco se ha cuestionado la organizacin de la institucin en s, sus formas de gobierno, mecanismos de participacin y la participacin misma de los actores, es decir, docentes, alumnos, directivos, padres, otras instituciones, etc. En Mxico, el estudio de la convivencia escolar se ha realizado a partir de la indagacin de la violencia escolar. Velsquez (2005) realiz una investigacin con estudiantes de nueve centros de Bachillerato del Estado de Mxico, a quienes se les pidi que narraran episodios violentos que haban vivido durante su vida preescolar. En los resultados, la autora destaca los episodios violentos por parte de los pares. Igualmente manifiesta que los maestros utilizaban regaos, insultos, intimidaciones, humillaciones, castigos e incluso golpes. Asimismo, Chagas (2005) presenta los resultados de una investigacin sobre violencia entre alumnos. El estudio se realiz en una escuela primaria mexicana. Se entrevist al director, a los profesores y alumnos. Se utilizaron cuestionarios abiertos y cerrados. La investigadora presenta lo que denomina representaciones sociales de los profesores sobre la violencia que ejercen los nios y cmo stas son contradictorias cuando resuelven los conflictos, tanto en el aula como entre ellos mismos. La investigadora concluye que se observa una falta de coherencia que afecta a la transmisin de valores hacia los alumnos, generando confusin respecto de la responsabilidad sobre sus actos e influyendo en el tipo de relaciones que establecen los nios con sus iguales. El Instituto Nacional para la Evaluacin en Educacin (INNE) tambin realiz una investigacin denominada Disciplina, violencia y consumo de sustancias nocivas para la salud en escuelas primarias y secundarias de Mxico (AGUILERA, MUOZ & OROZCO, 2007). El estudio estuvo conformado por dos acercamientos, uno a travs de los datos recabados por los exmenes de la calidad y logro educativo, que se aplicaron a alumnos y a docentes de Educacin Primaria, y otro en el que se realiz un acercamiento cualitativo a travs de entrevistas con alumnos y docentes de veinte centros secundarios para describir su funcionamiento, organizacin y problemticas. Entre los hallazgos ms importantes
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

115

Azucena Ochoa & Salvador Peir

hay que destacar que la magnitud de la violencia manifestada por los estudiantes es relativamente baja. Por ltimo, hay una diferencia de opinin entre alumnos y profesores en cuanto a los problemas de convivencia entre estudiantes. Por un lado, los maestros tienden a minimizarlo, y por otro, los alumnos perciben que los maestros no los atienden, sobre todo cuando se trata de acciones que pudieran parecer leves, como las burlas. Desde otra perspectiva, Zamora & Zern (2010) realizaron un estudio para caracterizar el sentido actual de la autoridad pedaggica en escuelas chilenas. Si bien los autores no tienen el objetivo de estudiar los problemas de convivencia en las aulas, argumentan que uno de los factores para que se presenten tensiones entre profesores y alumnos tiene que ver con dimensiones socioculturales como el acceso y la cobertura de la educacin bsica en los pases latinoamericanos; las formas de acercamiento y produccin de la cultura por parte de los jvenes, pues la Escuela ya no es la nica institucin que socializa a los jvenes, y la tendencia al empoderamiento de los adolescentes. As que, las relaciones entre los docentes y los alumnos se desestabilizan, pues el sistema vertical con el que funciona la Escuela ha entrado en crisis. A partir de los estudios revisados podemos distinguir los siguientes aspectos estudiados: factores asociados a la violencia, desmotivacin del profesorado, falta de preparacin del profesorado, manifestaciones de violencia en la escuela, actuaciones del profesorado, incongruencia entre los valores educativos y los valores sociales y punto de vista de los docentes en relacin al conflicto. Cabe sealar que los aspectos sealados no se han investigado en la misma dimensin y profundidad en Mxico, comparativamente con lo realizado en Espaa. Podemos advertir que estudiar la violencia o el acoso entre iguales es insuficiente, pues existen otros factores que intervienen en la dinmica escolar, en particular el rol tan importante que juegan los docentes para mantener un clima adecuado en el aula, no slo por su preparacin sino tambin por la actitud hacia los conflictos. Por lo cual, consideramos que la convivencia educativa debera estudiarse poniendo atencin no slo en los estudiantes: es necesario indagar acerca de lo que el profesorado hace o no para atender las situaciones que pueden generar conflictos. Con relacin a esto, cabe aclarar que no se sugiere que los profesores sean los nicos responsables de mantener un clima de convivencia adecuado; sin embargo, como ya se ha sealado, es un factor condicionante. Algunas investigaciones proponen las habilidades que habra que desarrollar, en los alumnos, para un adecuado desarrollo emocional, como la empata, expresin de sentimientos, comprensin de normas y convenciones, educar en valores (DAZAGUADO, 1996; ORTEGA, 2000; ORTEGA & DEL REY, 2006). Todo ello exige un modelo de profesor diferente al que estableci la formacin del sistema escolar modernista. Por consiguiente, es difcil proponer mejoras para la convivencia escolar sin dejar a un lado las prcticas docentes que, en muchos casos, son las que no propician la convivencia. Esto requiere que es necesario que se estudie el modo de proceder por parte de los equipos docentes actuales. A partir de esta reflexin terica, surgen las siguientes interrogantes, que guan el desarrollo de esta investigacin: Qu hacen los profesores de Quertaro y Alicante cuando se presenta una situacin que altera la convivencia en el aula?, cmo resuelven estos conflictos?, existen diferencias entre las acciones que llevan a cabo los docentes de Primaria, Secundaria y Bachillerato?, existen diferencias entre las acciones que realizan los profesores de Quertaro y los profesores de Alicante?

3. Actuaciones de los docentes ante situaciones que alteran la convivencia escolar


3.1. OBJETIVO Conocer las maneras de proceder de los docentes de Primaria, Becundaria y bachillerato ante las conductas que alteran la convivencia educativa. 3.2. INSTRUMENTO Para abordar esta problemtica se utiliz el cuestionario elaborado por Peir i Gregori (2000). Este instrumento consta de 27 tems, donde se describen conductas que pueden alterar la convivencia en el aula o en el centro. Dichas conductas reflejan aspectos que se podran considerar leves, como cuando los alumnos conversan en clase, y tambin actos que se podran considerar graves, como abuso sexual o xenofobia, entre otros. Las opciones de respuestas (14) estaban establecidas previamente y

116 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa)

describan las actuaciones que los profesores tenan, generalmente, ante conductas que pudieran alterar la convivencia en el aula. Los docentes seleccionaban la respuesta que consideraban que se correspondan con sus actuaciones ante la conducta descrita. Este instrumento se puede consultar en la pgina web http://violencia.dste.ua.es 3.3. POBLACIN Para esta investigacin se utiliz un estudio de caso (VZQUEZ, 1981), ya que todos los procesos culturales (HAMEL ET AL., 1993) del grupo o la comunidad se producen dentro de las escuelas o las familias. Esta metodologa proporciona una forma sistemtica de observar acontecimientos, hacer la recoleccin de datos, su anlisis y la comunicacin de resultados (SWISHER ET AL., 1984), lo que nos permite tener una comprensin de lo que sucede y por qu sucede de esta forma, as como lo que se debera tener en cuenta para futuras investigaciones. Esta estrategia permite realizar la investigacin en el contexto real en donde suceden los hechos (LIPKA, 1991). Los resultados del estudio de estos casos son vlidos slo para tales, pero significan una aproximacin al fenmeno. En un trabajo anterior se consider la comparacin slo de docentes de Secundaria. En esta investigacin se presentan los niveles de Primaria, Secundaria y Preparatoria. Como se trata de un estudio comparativo, se trabaj con treinta y tres docentes de la ciudad de Quertaro (Mxico) y treinta y tres de la ciudad de Alicante (Espaa); once de cada nivel, sesenta y seis participantes en total. 3.4. PROCEDIMIENTO El cuestionario fue entregado a los profesores para que lo cumplimentaran empleando el tiempo que consideraran conveniente. Los investigadores acudieron a los centros a entregar personalmente los cuestionarios. Una vez concluidos, se procedi a recogerlos y procesar la informacin. Los resultados se procesaron en el software elaborado exprofeso para ello. Una vez procesados los datos, y dada la cantidad de reactivos de que consta el cuestionario, se procedi a elegir la respuesta ms representativa de cada pregunta. Para elegir esta respuesta, se siguieron bsicamente dos criterios: el primero que se concentraran el mayor nmero de respuesta de los dos grupos y, el segundo, que se apreciaran diferencias entre los grupos. Dado el espacio para incluir el nombre de la respuesta, se procedi a establecer abreviaturas a cada opcin. Cabe sealar que el cuestionario constaba de catorce opciones; sin embargo, slo las que aparecen a continuacin fueron elegidas por los docentes.

4. Resultados
La Tabla 1 representa la frecuencia de eleccin de actuaciones de los 27 tems de los que constaba el cuestionario. As, tenemos que la actuacin que eligieron los docentes en primer trmino fue hablar a solas con los culpables, seguido de hablar con su familia y comunicarlo al director. A las que recurren en menor medida son derivar al psicopedagogo y dar un parte oficial. Llama la atencin que en el nivel bachillerato eligieron la opcin echarlos de clase en uno de los tems.

Opcin/Nivel educativo Hablar a solar con los culpables HS Hablar con su familia HF Comunicarlo al director CD Aprovechar la situacin para un tema especial TE Recurrir a expertos sociales ES Derivar al psicopedagogo D Psic No contest N/C Doy un parte oficial PO Echarlos de clase Ech C

Primaria 8 7 2 3 2 2 3 0 0

Secundaria 12 3 4 5 2 0 0 1 0

Bachillerato 9 3 5 2 2 2 1 2 1

Total 29 13 11 10 6 4 4 3 1

TABLA 1. Frecuencias de las opciones elegidas por los docentes de las dos ciudades en los tres niveles educativos.

Una de las diferencias que se advierte entre niveles es el caso de hablar con su familia (HF), ya que esta opcin fue elegida en mayor medida por los docentes de nivel Primaria. Podramos inferir a

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

117

Azucena Ochoa & Salvador Peir

partir de este dato un distanciamiento entre las familias a medida que los adolescentes avanzan en la escolaridad. Otra de las diferencias entre niveles tiene que ver con las opciones comunicarlo al director (CD) y dar un parte oficial (PO), pues a medida que aumenta el nivel educativo que atienden los docentes hay una mayor tendencia a elegir estas opciones. A partir de estos resultados se puede afirmar que los docentes de ambas ciudades cuentan con una limitada gama de actuaciones cuando se presentan situaciones que pueden alterar la convivencia educativa. A continuacin, y debido a la extensin del cuestionario, slo presentaremos los resultados de los tems en donde hubo coincidencia en la opcin de respuesta de los tres niveles educativos.
Nivel educativo Reactivo y respuesta Desercin HF Hostilidad HS Insulto HS Negacin HS Robo CD Vandalismo CD

Primaria Qro. Mx. 63 18 78 18 45 9 Alc. Esp. 54 72 18 45 81 54

Secundaria Qro. Mx. 27 36 36 27 9 27 Alc. Esp. 63 55 45 54 36 54

Bachillerato Qro. Mx. 0 36 72 27 9 18 Alc. Esp. 45 27 9 54 45 27

TABLA 2. Porcentajes de respuesta de los tems donde se observaron coincidencias

en los tres niveles educativos estudiados.

En la parte superior de la Tabla 2 observamos los niveles educativos y los dos grupos respectivos. Del lado izquierdo tenemos el reactivo y la respuesta en donde tuvieron coincidencia los tres grupos. Los reactivos en donde se presentaron las coincidencias fueron: desercin, hostilidad, insulto, negacin, robo y vandalismo. En el caso del primer reactivo la respuesta elegida por los tres grupos fue la de hablar con su familia (HF); para los reactivos hostilidad, insulto y negacin la respuesta elegida por los tres grupos fue la de hablar a solar con los culpables (HS); y para los reactivos robo y vandalismo la respuesta fue comunicarlo al director (CD). En el caso del reactivo desercin los resultados muestran algunas diferencia entre los niveles. En el caso de la ciudad de Quertaro (Mxico), a medida que avanza el nivel que atienden los docentes disminuye la respuesta HF. En el caso de Alicante (Espaa), el porcentaje ms elevado se presenta en el nivel secundario. Este resultado puede deberse a que los centros escolares de este nivel en la ciudad de Alicante cuenten con plan de convivencia que establezca esta accin al presentarse una situacin como la que marc en el tem. En los porcentajes del tem hostilidad cuya respuesta fue hablar a solas con los culpables (HS) se observanen los tres niveles ciertas diferencias, presentndose mayores porcentajes en los niveles de primaria y secundaria en comparacin con el de bachillerato. En el tem que indaga las actuaciones de los docentes en el caso que se presentaran insultos, la opcin de respuesta elegida fue hablar a solas con los culpables (HS). En el caso de los docentes de Primaria y Bachillerato, el grupo de Quertaro presenta mayores porcentajes en comparacin con el grupo de Alicante. Para el reactivo negacin de hechos la respuesta elegida por los docentes de los tres niveles fue, al igual que los dos reactivos inmediatos anteriores, la de hablar a solas con los culpables (HS). Podemos

118 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa)

observar que en los tres niveles educativos el grupo de Alicante presenta mayores porcentajes en comparacin con el grupo de Quertaro. Otro reactivo en donde se encontraron coincidencias entre los tres grupos fue el de robo, en donde los tres niveles coincidieron en sealar la opcin comunicarlo al director (CD). Nuevamente observamos que en los tres grupos los docentes de Alicante presentan un mayor porcentaje en comparacin con los docentes de Quertaro. En el reactivo vandalismo tambin se observaron coincidencias en las respuestas de los tres niveles, siendo la respuesta comunicarlo al director CD en la que coincidieron. Observamos tambin en este reactivo que los docentes de Alicante presentan un mayor porcentaje de respuesta en los tres niveles educativos. A partir de lo anterior, podemos inferir que los docentes de Alicante estn siguiendo un procedimiento de actuacin en el caso de que se presente una situacin de robo o vandalismo. Sin embargo, en los casos de los reactivos hostilidad, insulto y negacin de hechos, dada la opcin elegida (HS) habra que profundizar acerca de cmo se da ese hecho entre docentes y alumnos. Este hecho podra deberse a que muchos de los docentes no cuentan con las herramientas para afrontar conflictos? Este dato ha sido hallado en otros estudios, segn los cuales el 57% de los docentes de la ESO no se sienten preparados para afrontar los conflictos que surgen en el aula y un 40% se sienten desmotivados ante este asunto (ESTEVE, 2006). Pareciera con estas respuestas que los docentes de estos grupos actan en solitario, pues a pesar de que en el cuestionario se contemplaban otras opciones como recurrir a expertos sociales o derivar al psicopedagogo o, incluso, que escribieran libremente alguna otra opcin, la mayora opta por hablar a solas con los culpables o comunicarlo al director.

5. Discusin
Sin involucrar la consideracin del cuestionario sobre necesidades de competencias pedaggicas, ubicado en el sitio web referido en apartados anteriores, consideramos que hay una mayor variedad de procedimientos aplicables para atajar, prevenir o aminorar las situaciones que atentan al clima convivencial. Dados los resultados podemos afirmar que los docentes de este estudio aplican una gama limitada de actuaciones ante situaciones que pueden generar disconvivencialidad. Esto nos hace pensar que los docentes pudieran estar poco capacitados al respecto de cmo promover la convivencia en el espacio escolar. En este sentido, otro autor ha confirmado que los propios docentes perciben que les falta preparacin para afrontar conflictos y se sienten desmotivados ante este asunto (ESTEVE, 2006). Por otro lado, pareciera que los docentes minimizan ciertos actos como la hostilidad, el insulto o la discriminacin, ya que la actuacin que dicen realizar es hablar a solas con los culpables, pudiendo con esto generar una confusin en la responsabilidad de los actos que se comenten por parte de los estudiantes, ya que pareciera que para los docentes merece el mismo trato quien insulta que quien discrimina. Los docentes suelen simplificar los procesos de actuacin pedaggica debido, entre otras cosas, a: a) desconocimiento de las causas y la transformacin de los problemas; b) actuacin por intuicin, prcticas acostumbradas... hasta que llega a pensar no se puede hacer nada, y c) defensa ante la agresin: controlarlos, aislarlos, expulsin al pasillo o a su casa.

6. Conclusiones
1. De acuerdo a los datos presentados, podemos decir que las actuaciones de los docentes se limitan a hablar a solas con el culpable, hablar con la familia, recurrir a expertos sociales, dar un parte oficial, comunicar al director, derivar al psicopedagogo, aprovechar la situacin para un tema especial y echarlos de clase. Esto implica caer en la trampa de la simplicidad educacional. 2. Existen pocas diferencias entre los grupos estudiados. Si bien en el caso de Alicante hay un mayor nmero de respuestas, es interesante observar que, ante las situaciones planteadas, las actuaciones docentes son semejantes. Esto nos hace pensar, en el caso de Alicante, que es probable que los docentes no se sientan implicados o que, pese a su importancia, el tema de la convivencia no se haya incluido en el Proyecto del Centro, pues se supone que en este documento debe existir un procedimiento especfico para afrontar situaciones de esta
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

119

Azucena Ochoa & Salvador Peir

naturaleza. Por su parte, en el caso de Quertaro, hasta la fecha la convivencia educativa no es un tema que preocupe a los docentes y a los centros. Pese a que es un fenmeno que existe, los proyectos escolares siguen girando en torno a la comprensin lectora y el razonamiento matemtico. 3. Aunque el cuestionario contemplaba catorce opciones, las respuestas se concentran slo en los aspectos antes mencionados, a pesar de que, adems, haba una opcin para que si as se deseaba se incluyera otra actuacin que no estuviera contemplada, lo cual no sucedi. Esto nos permite concluir que las herramientas tericometodolgicas de los docentes para afrontar situaciones que pueden alterar la convivencia educativa son limitadas. 4. Se observa una cierta incongruencia entre la situacin y la actuacin, pues, dadas las respuestas, los docentes actan de manera similar en el caso que se presente una discriminacin que en el caso de hablar en clase. Por ello, creemos que es imprescindible que los centros y las universidades refuercen la formacin de los docentes en relacin con la convivencia educativa y el domino de herramientas y tcnicas para enfrentar adecuadamente las situaciones de conflicto. Los docentes deben comprender el sentido de la educacin.

Referencias bibliogrficas
AGUILERA, A. MUOZ, G. & OROZCO A. (2007). Disciplina, violencia y consumo de sustancias nocivas a la salud en primarias y secundarias. Publicacin del Instituto Nacional para la Evaluacin de la Educacin. Consultado el 12 de enero de 2010 en http://www.inee.edu.mx/images/stories/ Publicaciones/ Recursosyprocesos/Disciplina/Partes/disciplina06.pdf BORKO, H., LALIK, R. & TOMCHIN, E. (1987). Students Teachers' Understandings of Successful and Unsuccessful Teaching. Teaching and Teacher Education 3, 7790. CHAGAS, R. (2005). Los maestros frente a la violencia de sus alumnos. Revista Mexicana de Investigacin Educativa, 10: 27, 10711082. DEBARBIEUX, E. (1997). La violencia en la escuela francesa: Anlisis de la situacin, polticas pblicas e investigaciones. Revista de Educacin, 313, 7993. DAZAGUADO, M. J. (1996). Programas de educacin para la tolerancia y la prevencin de la violencia en los jvenes. Madrid: Ministerio del Trabajo y Asuntos Sociales. DODGE, K. COIE, J. PETTIT, G. & PRICE, J. (1990). Peer status and aggression in boys groups: Development and contextual analyses. Child Development, 61, 12891309. ESCAMEZ, J. (2001). Los conflictos en la Educacin Secundaria. En PEIR, S.(Coord.), Primeras jornadas sobre violencia en educacin. Espaa: Club Universitario. ESTEVE, J. M. (2005). Bienestar y salud docente. UNESCO: Proyecto Regional de Educacin para Amrica Latina y el Caribe. ESTEVE, J. M. (2006). La profesin docente en Europa: perfil, tendencias y problemtica. La formacin inicial. Revista de Educacin, 340, 1940. FERNNDEZBALBOA, J. M. (1991). Beliefs, Interactive Thoughts, and Actions ff Physical Education Student Teachers Regarding Pupil Misbehaviours. Journal of Teaching in Physical Education, 11, 5978. GARCA, C. (2001). La violencia en centros educativos de Norteamrica y diferentes pases de Europa. Medidas polticas tomadas para la convivencia escolar. Revista Interuniversitaria de Formacin del Profesorado, 41, 167177. GRAHAM, G. (1992). Teaching Children Physical Education. Champaign, IL: Human Kinetics. FUNK, W. (1997). Violencia escolar en Alemania. Revista de Educacin, 313, 5378. HAMEL, J., DUFOUR, S. & FORTIN, D. (1993). Case study methods. Newbury Park, CA: Sage. HIRANO, K. (1992). Bullying and victimization in Japanese classrooms. Paper presented at the 5th. European Conference on Developmental Psychology. Sevilla, Espaa.

120 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

Estudio comparativo de las actuaciones de los profesores ante situaciones que alteran la convivencia escolar: el caso de Quertaro (Mxico) y Alicante (Espaa)

HOUGHTON, S., WHELDALL, K. & MERRETT, F. (1988). Classroom Behaviour Problems Which Secondary School Teachers Say they Most Troublesome. British Educational Research Journal, 14, 297 312. KALTIALAHEINO, R.; RIMPEL, RATOREN & RIMPEL (2000).Bullying at School: An Indicator of Adolescents at Risk for Mental Disorder. Journal of Adolescence, 23, 661674. ISHEE, J. H. (2004). Perceptions of Misbehaviour in Middle School Physical Education. Journal of Physical Education, Recreation and Dance, 75, 9. LARROSA, F. (2002). Las necesidades del profesorado y las responsabilidades de la administracin educativa. En PEIR, S. (Coord.), Segundas jornadas sobre violencia en educacin. Espaa: Club Universitario. LIPKA, J. (1991). Toward a Culturally Based Pedagogy: A Case Study of One Yup'ik Eskimo Teacher. American Anthropological Association. OCDE (2009). Informe Talis. La creacin de entornos eficaces de enseanza y aprendizaje. Sntesis de los primeros resultados. Consultado el 9 de febrero de 2010 en www.ocde.org/dataoecd/3/35/ 43057468.pdf OLWEUS, D. (1998). Conductas de acoso y amenaza entre escolares. Madrid: Morata. ORTEGA, R. (Coord.) (2000). Educar la convivencia para prevenir la violencia. Espaa: Antonio Machado Libros. ORTEGA, R. & DEL REY, R. (2006). Construir la convivencia. Espaa: Edeb. PEIR, S. (2001). Por una educacin promotora de la cohesin institucional. Consecuencias interdisciplinarias para la investigacin. En Peir, S. (Coord.). Primeras jornadas sobre violencia en educacin. Espaa: Club Universitario, 85102. PEIR, S. (Coord.) (2002). Segundas jornadas sobre violencia en educacin. Espaa: Club Universitario. PEIR S. (2003). La educacin familiar como modelo para contrarrestar la violencia escolar. Revista Panamericana de Pedagoga 4, 232253. PEIR, S. (2005). Indisciplina y violencia escolar. Alicante. Instituto Alicantino de Cultura. PEIR, S. (2007). Factores disconvivenciales y calidad educativa. En ROIG, R. ET AL., Investigar el cambio curricular en el espacio Europeo de Educacin Superior. Marfil: Alcoy. 309324. PEIR, S. (2009). Valores educativos y convivencia. Espaa: Club Universitario. PRIETO, G. (2005). Violencia escolar y vida cotidiana en una escuela secundaria. Revista Mexicana de Investigacin Educativa, 10: 27, 10051026. REY, R. & MARCHESI, A. (2005). La opinin de los profesores sobre la convivencia en los centros. Centro de Innovacin Educativa CIEFUHEM e Instituto de Evaluacin y Asesoramiento Educativo IDEA. RIGBY, K. & SLEE, P. (1991). Bullying among Australian school children: Reported behavior and attitudes towards victims. Journal of Social Psychology, 131, 615627. SOURANDER, A., HELSTEL, HELENIUS & PITIA (2000). Persistence of Bullying from Childhood to Adolescence: A Longitudinal 8Year FollowUp Study, Child Abuse and Neglect. The International Journal, 24, 873881. SWISHER, R. & MCCLURE, C. R. (1984). Research for decision making, methods for librarians. Chicago: American Library Association. VZQUEZ, G. (1981). N=1. Un nuevo paradigma de investigacin pedaggica. Revista Espaola de Pedagoga, 39, 151. VELSQUEZ, L. (2005). Experiencias estudiantiles con la violencia en la escuela. Revista Mexicana de Investigacin Educativa, 10: 26, 739764. WHELDALL, K. & MERRETT, F. (1988). Which Classroom Behaviours for Primary School Teachers Say they Find Most Troublesome? Education Review, 40, 1327. WHITNEY, I. & SMITH, P. (1993). A survey of the nature and extent of bullying in junior/middle and secondary schools. Educational Research, 35, 325.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

121

Azucena Ochoa & Salvador Peir

ZAMORA, G. & ZERN, A. (2010). Caracterizacin y sentido actual de la autoridad pedaggica en escuelas chilenas de sectores de pobreza. Revista Espaola de Pedagoga, 245, eneroabril, 96 116.
1 Este trabajo fue elaborado durante la estancia posdoctoral de la Dra. Ochoa en la Universidad de Alicante, por esto se agradece al CONACYT (Mxico) y al Dr. Peir, la oportunidad de investigar en esta lnea de trabajo.

122 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 113122

REFERENCIA: Siz, MariaConsuelo; Flores, Valle & Romn, JosMara (2010). Metacognicin y competencia de aprender a aprender en Educacin Infantil: Una propuesta para facilitar la inclusin. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Metacognicin y competencia de aprender a aprender en Educacin Infantil: Una propuesta para facilitar la inclusin
MaraConsueloSIZ ValleFLORES JosMaraROMN
Correspondencia: MaraConsueloSizManzanares ValleFloresLucas JosMaraRomnSnchez Correoelectrnico: mcsmanzanares@ubu.es Telfono: +34947258074 Fax: +34947258861 Direccinpostal: FacultaddeHumanidades yEducacin UniversidaddeBurgos C/Villadiegos/n 09001Burgos Recibido:27deagostode2009 Aceptado:10denoviembrede2010

RESUMEN
Esteestudiopretendeenprimerlugarunacercamientoa las investigaciones actuales sobre el constructo metacognicin; en segundo trmino, analiza su correspondencia con corrientes curriculares relacionadas conelconceptodecompetencia;yenltimolugar,efecta unaobservacindelacompetenciadeaprenderaaprender enelsegundociclodeEducacinInfantilenelmarcodeuna escuela inclusiva. Los resultados indican que los nios de cuatroycincoaosnotienenadquiridaslashabilidadesde: saber qu, saber cmo y saber cundo, aunque si pueden regular sus conductas a travs del habla del adulto. Por lo queseranecesariomejorarsudesarrollodesdeprogramas deintervencin.

PALABRAS CLAVE: Habilidades metacognitivas, Habilidades cognitivas, Competencias en Educacin Infantil, Aprenderaaprender.

Metacognition and the learning to learn competence in Infant Education: A proposal promoting inclusion
ABSTRACT
Themainaimofthisstudyistoreviewcurrentresearchonthemetacognitionconstruct.Italsoaims atanalysingtherelationshipbetweenmetacognitionandcurricularapproachesrelatedtotheconcept of competence. It further describes the learning to learn competence in the last years of Infant Educationwithintheframeofaninclusiveschool.Theresultsshowthatchildren(aged57years)have notacquiredtheseskills:knowingwhat,knowinghow,andknowingwhen.However,theycanregulate theirbehavioursthroughlanguageintheirinteractionwithadults.Weconcludethatitisnecessaryto implementinterventionprogramsthatpromotetheyounglearnersdevelopment.

KEY WORDS: Metacognitiveskills,Cognitiveskills,CompetencesinInfantEducation,Learningtolearn.


ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

123

MariaConsuelo Siz, Valle Flores & JosMara Romn

1. Introduccin y antecedentes
Con relacin al trmino metacognicin desde la perspectiva de la Psicologa Cognitiva podemos diferenciar dos lneas de trabajo reconocidas por la comunidad cientfica. La lnea del procesamiento de la informacin, que recoge los trabajos neopiagetianos de Flavell (1971) orientados al anlisis de las habilidades metacognitivas en su relacin con los procesos de metamemoria, y los estudios ms dirigidos al anlisis de los procesos de regulacin de Brown (1977). En la actualidad, sta ltima corriente parte del trmino autorregulacin y se vincula a factores emocionales, motivacionales y sociales analizando tres elementos importantes (WHITEBREAD, COLTMAN, PINO, SANGSTER, GRAU, BINGHAM, ALMEQDAD & DEMETRIOU, 2009):

El conocimiento metacognitivo
La Monitorizacin metacognitiva y el autocontrol La Monitorizacin y el control de emociones y estados motivacionales durante las tareas de aprendizaje (EFKLIDES, 2006).

Fines cognitivos (tareas)

Experiencias metacognitivas

Conocimiento metacognitivo (de la persona, la tarea y las estrategias)

Acciones cognitivas (estrategias)

FIGURA 1: Adaptacin del modelo de Flavell (1981) por Nisbert & Sucksmith, 1990: Relaciones entre tareas, estrategias y Metacognicin (SIZ, 2000: 54).

Los trabajos de Flavell (1981) permitieron diferenciar en el conocimiento metacognitivo variables de: la persona, la tarea y la estrategia a utilizar. Dicho conocimiento poda ser declarativo (saber qu) o procedimiental (saber cmo y cundo utilizar una serie de estrategias), abriendo la posibilidad al aprendizaje del mismo, factor este esencial en el contexto educativo (FLAVELL, 1985). Histricamente tambin los trabajos de Bown (1987) relacionaron la metacognicin con la capacidad de autocontrol y autorregulacin que el propio sistema cognitivo tiene sobre s mismo, lo que se vincul con los heursticos de resolucin de problemas, en los que el desarrollo del autocontrol y de los procesos de planificacin juegan un papel esencial. El conocimiento metacognitivo as entendido se va desarrollando con la edad: a medida que los nios crecen van aumentando tanto el tipo como la complejidad de las estrategias que conocen y pueden emplear (NISBERT & SHUCKSMITH, 1990; HALFORD, 1993; CASE, 1985). No obstante, los nios pequeos fallan en la utilizacin de este tipo de estrategias, lo que puede venir explicado desde la diferencia entre conocer y utilizar. stos pueden conocer la existencia de ciertas estrategias, pero no emplearlas de forma autnoma a no ser que el adulto est regulando est actividad, es decir, les est orientando en el desarrollo de los procesos de planificacin. Es lo que se ha denominado diferencia de aplicacin (BROWN, 1987). Flavell (1981) considera que dicho dficit se debe a que la capacidad de responder a fines cognitivos se va desarrollando con la edad, la cantidad de conocimientos que el sujeto va adquiriendo, la organizacin y generalizacin de dichos conocimientos, el incremento de las conexiones entre mediosfines y el propio conocimiento metacognitivo. Se ha encontrado cmo los nios pequeos pueden participar en la adquisicin de estrategias metacognitivas, pero tienen problemas en la transferencia de dichas estrategias a situaciones nuevas (BLTE, RESING, MAZER & VAN NOORT, 1999). A modo de sntesis, se puede sealar que el

124 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

Metacognicin y competencia de aprender a aprender en Educacin Infantil: Una propuesta para facilitar la inclusin

desarrollo metacognitivo se produce a lo largo del desarrollo evolutivo del sujeto (FLAVELL, 1971; 1981) y la instruccin potencia la enseanza de estrategias cognitivas y metacognitivas en contextos educativos (BROWN, 1977). La dificultad se situara en la observacin de los procesos de metacognicin. Existen teoras que sealan que los nios no desarrollan habilidades metacognitivas hasta los 810 aos (VEENMAN & BEISHUIZEN, 2004; VEEMAN & SPAANS, 2005). Otros autores (BLTE, RESING, MAZER & VAN NOORT, 1999) encuentran estrategias metacognitivas en nios de cuatro aos, subrayando que el problema radica en la transferencia de las estrategias a situaciones nuevas. Las discrepancias en los mismos se deben a las limitaciones en la evaluacin de las habilidades de metacognicin y de planificacin, ya que se relacionan con el desarrollo de las habilidades de lenguaje y de memoria de trabajo (VEENMAN & SPAANS, 2005; WHITEBREAD ET AL., 2009). Lo cierto es que los nios en estas edades (36 aos) no tienen totalmente adquiridas las habilidades metacognitivas (planificacin y autorregulacin). Muchos estudios sugieren la importancia de orientar el desarrollo y/o adquisicin de las mismas desde las aulas a travs de la puesta en marcha de programas de entrenamiento metacognitivos curricularmente integrados (SIZ, 1994; SIZ & ROMN, 1996; SIZ, 2000; TESOURO CID, 2006). Asimismo, otros trabajos (PRAMLING, 1993; MUOZ, 2004; PRAMLING & PRAMLING, 2009) han puesto de manifiesto que el desarrollo de los dilogos metacognitivos en las aulas de educacin infantil (5 a 7 aos) facilita la adquisicin de las capacidades metacognitivas (metacognitivas propiamente dichas y de planificacin). Pero para ello es necesario que el profesor utilice como herramienta de trabajo la observacin desde el anlisis de tareas (SIZ & ROMN, 2010). Dicho anlisis servir tanto para la evaluacin de competencias curriculares, en este caso relacionadas con el aprender a aprender, cmo en el inicio de la intervencin educativa para ayudar a los sujetos a adquirir y a desarrollar competencias relacionadas con la resolucin de tareas. Desde contextos ms curriculares, el informe De Seco de 2006 hace referencia a la necesidad de ensear competencias de aprender a aprender. Las competencias en contextos curriculares requieren facilitar en los nios habilidades de saber hacer, lo que pasa por la adquisicin de aprendizajes reflexivos, intuitivos y crticos (PREZ GMEZ, 2008); obviamente opuestos a los mecnicos, no experimentales e irreflexivos. Todo ello implica efectuar cambios tanto en las formas de ensear como en las de aprender centrados en el desarrollo de los mecanismos metacognitivos (conocer lo que se sabe y lo que no; conocer las estrategias cognitivas se utilizan para aprender; y desarrollar los procesos de planificacin desde los procesos de evaluacin continua de las formas de hacer). Adems de todo lo sealado desde mbitos psicolgicos y pedaggicos, hay que tener en cuenta cmo en nuestro pas en los ltimos aos se escolariza en la mayora de los centros a poblacin procedente de otras culturas, lo que conlleva un compromiso de inclusin social. Las ltimas investigaciones en marcos inclusivos ponen de manifiesto la relacin entre las capacidades de resolucin de problemas y, por ende, metacognitivas y el mayor o menor riesgo de desarrollar situaciones de exclusin social. Es decir, si posibilitamos desde la escuelas habilidades y estrategias en los nios de resolucin de problemas efectuaremos una tarea de prevencin de posibles situaciones de exclusin social (SHATZ, DIESENDRUCK, MARTINEZBECK & AKAR, 2003; AYALA, 2005; MISTRY, BIESANZ, CHIEN, HOWES & BENNER, 2008). Atendiendo a los planteamientos anteriores esta investigacin pretende ser un estudio piloto con los siguientes objetivos: Comprobar si existen diferencias entre las habilidades de planificacin y metacognitivas atendiendo a la variable edad (sujetos de 4 y 5 aos). Comprobar si existen relaciones entre las habilidades metacognitivas y de planificacin. Identificar estrategias de intervencin en procesos de metacognicin y de planificacin que puedan ser tiles a los profesores de Educacin Infantil para orientar mejor su prctica diaria.

Mtodo
PARTICIPANTES Se trabaj con una muestra de 22 sujetos (12 nias y 10 nios) escolarizados en un colegio de la zona centro de Burgos en 2 curso del Segundo Ciclo de Educacin Infantil (media de edad de 4,3 meses) y 21 sujetos (8 nias y 13 nios), de los cuales dos tenan un origen rabe, uno rumano y dos

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

125

MariaConsuelo Siz, Valle Flores & JosMara Romn

sudamericanos, en 3 curso del Segundo Ciclo de Educacin Infantil (media de edad de 5,4 meses), tres tenan un origen rumano y dos sudamericano. El centro fue elegido por su disponibilidad a participar en proyectos de innovacin educativa y en programas de inclusin social. INSTRUMENTOS 1. Dentro de la Prueba de clasificacin por dos criterios (formacin de conceptos) se eligi la tarea de formacin de conceptos de las Escalas McCarthy de Aptitudes y Psicomotricidad para nios (MSCA), en el tem 6 (se les daba la instruccin a los nios y/o nias: ahora mira a ver cuntas piezas grandes y amarillas puedes encontrar). Los sujetos tenan que clasificar en funcin de dos criterios (tamao y color). Se eligi esta tarea por ser habitual dentro de las actividades curriculares en la etapa de Educacin Infantil. Para medir las habilidades metacognitivas y de planificacin se emple la EOECM, (SIZ, CARBONERO & ROMN, 2010). sta es una escala tipo Likert de 1 a 5 (1: nunca; 2: casi nunca; 3: a veces; 4: casi siempre; y 5: siempre) y consta de 21 tems de observacin, divididos en 4 dimensiones: atencin, lenguaje receptivo y expresivo, procesos de planificacin y procesos metacognitivos. En este estudio slo se observaron las dos ltimas dimensiones (planificacin y metacognicin). La fiabilidad total de la escala es un alfa de Cronbach de .60.

2.

PROCEDIMIENTO Como instrumento de observacin de las estrategias metacognitivas y de planificacin se utiliz

la Escala de observacin de estrategias cognitivas y metacognitivas (EOECM) de Siz, Carbonero & Flores (2010), mientras los sujetos realizaban la tarea de Clasificacin por dos criterios (formacin de conceptos de las Escalas McCarthy de Aptitudes y Psicomotricidad para nios (MSCA). Las evaluaciones
se realizaron de forma individual en una sala diferente del aula por parte de un observador externo y experimentado. DISEO El primer estudio es un diseo preexperimental sin grupo control, en el que la VI es las habilidades de planificacin y metacognitivas y la VD la edad de los sujetos (4/5 aos). En el segundo estudio se utiliza un diseo descriptivocorrelacional transversal sobre una variable no manipulada experimentalmente (edad de los sujetos 4/5 aos).

Anlisis estadsticos
Para comprobar si existan diferencias significativas entre los sujetos de cuatro y cinco aos, en la utilizacin de las estrategias de planificacin y metacognitivas, dadas las caractersticas de la muestra, se utiliz la prueba no paramtrica U de MannWhitney. Y para comprobar relacin entre la utilizacin de las habilidades metacognitivas y de planificacin se emple un anlisis correlacional productomomento de Pearson, adems de estadsticos descriptivos. Todos estos anlisis se efectuaron con el paquete SPSS en su versin 16.

Resultados
El primer objetivo era comprobar si existan diferencias entre las habilidades de planificacin y metacognitivas atendiendo a la variable edad (sujetos de 4 y 5 aos). Como podemos observar en las tablas 1 y 2, no existen diferencias significativas en la utilizacin de estas habilidades atendiendo a la variable edad. Estos datos pueden explicarse entendiendo que los procesos tanto metacognitivos como de planificacin en nios de cuatro y cinco aos se estn desarrollando, y las diferencias respecto de la variable edad no son apreciables en estas edades (FLAVELL, 1985; BROWN, 1977).

Grupo Cuatro aos Cinco aos

Rango 21,40 21,60

U 208,50

Probabilidad ,960

TABLA 1. Resultados del anlisis intergrupos en la dimensin: habilidades de metacognitivas de la EOECM.

126 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

Metacognicin y competencia de aprender a aprender en Educacin Infantil: Una propuesta para facilitar la inclusin

Grupo Cuatro aos Cinco aos

Rango 23,33 19,67

U 182,000

Probabilidad ,312

TABLA 2: Resultados del anlisis intergrupos en la dimensin: habilidades de planificacin de la EOECM.

El segundo objetivo era comprobar si existen relaciones entre las habilidades metacognitivas y de planificacin. Como podemos ver en la tabla 3, s existen correlaciones significativas al nivel 0,01 entre las habilidades metacognitivas y las de planificacin (r=.928), lo que seala la importancia de trabajar el desarrollo de dichas capacidades de forma coordinada (SIZ & ROMN, 1996; SIZ & ROMN, 2010).

1 1.Metacognicin 2. Planificacin 1 .928(**)

2 .928(**) 1

TABLA 3. Correlaciones entre las puntuaciones en habilidades de metacognicin y de planificacin. ** Correlacin significativa al nivel 0,01 (dos colas).

El tercer objetivo era identificar estrategias de intervencin en procesos de metacognicin y de planificacin que puedan ser tiles a los profesores de Educacin Infantil para orientar mejor su prctica diaria en el trabajo de habilidades metacognitivas y de planificacin en los nios. Para estudiarlo se efectu un anlisis de las respuestas de los sujetos en las dimensiones 3 y 4 de la EOECM, con el fin de detectar qu habilidades metacognitivas y de planificacin no se haban adquirido o bien precisaban incrementarse. Como se puede observar en la tabla 4, los nios de cuatro aos en planificacin precisan incrementar el desarrollo de: la regulacin de su conducta a travs del habla del adulto (tem 2, media=2,61); mejorar los procesos de planificacin (tem 3, media=2,38); establecer una estructura jerrquica de previsiones (tem 4, media=2,33); y realizar planificaciones estructuradas antes de iniciar los procesos de resolucin (tem 5, media=2). Respecto de las habilidades metacognitivas necesitan: reflexionar sobre el proceso de resolucin de una tarea (tem 1, media= 2,23); corregir las respuestas errneas con una ligera mediacin del adulto (tem 3, media= 2,14); corregir las respuestas errneas de forma autnoma (tem 3, media=2,14); conocer qu estrategias cognitivas emplear para resolver una tarea dada (tem 4, media=2,19); y saber cundo emplear las estrategias cognitivas (tem 5, media=2,19). Con relacin a los nios de cinco aos, respecto de las habilidades de planificacin, precisan incrementar el desarrollo de: la regulacin de su conducta a travs del habla del adulto (tem 2, media=2,33); mejorar los procesos de planificacin (tem 3, media=2,28); establecer una estructura jerrquica de previsiones (tem 4, media=1,52); y realizar planificaciones estructuradas antes de iniciar los procesos de resolucin (tem 5, media=1,70). Referente a las habilidades metacognitivas necesitan: reflexionar sobre el proceso de resolucin de una tarea (tem 1, media= 2,57); corregir las respuestas errneas con una ligera mediacin del adulto (tem 2, media= 2,61); corregir las respuestas errneas de forma autnoma (tem 3, media=2,38); conocer qu estrategias cognitivas emplear para resolver una tarea dada (tem 4, media=2,33); y saber cundo utilizar las estrategias cognitivas (tem 5, media=2,33).

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

127

MariaConsuelo Siz, Valle Flores & JosMara Romn

Dimensin 3: Procesos de Planificacin 1. Acciones sin meta.

Edad 4 aos 5 aos

M 3,14 3,09 2,61 2,33 2,38 2,28 2,33 1,52 2 1,70

DT 0,72 1,17 0,58 1,31 0,86 1,34 1,1 1,12 1,3 1,14

2. Acciones dirigidas por el habla del adulto.

4 aos 5 aos

3. Acciones autnomas sin planificacin. 4. Acciones con planificacin pero sin jerarqua de previsin. 5. Acciones con planificacin. Dimensin 4: Procesos Metacognitivos 1. Reflexin sobre el proceso de resolucin. 2. Correccin de una respuesta errnea con mediacin del adulto. 3. Correccin espontnea de una respuesta errnea. 4. Conocimiento de las estrategias cognitivas de resolucin. 5. Sabe cundo utilizar las estrategias cognitivas.

4 aos 5 aos 4 aos 5 aos 4 aos 5 aos

4 aos 5 aos 4 aos 5 aos 4 aos 5 aos 4 aos 5 aos 4 aos 5 aos

2,23 2,57 2,14 2,61 2,14 2,38 2,19 2,33 2,19 2,33

0,76 1,32 0,72 1,28 0,79 1,39 0,98 1,42 0,98 1,42

TABLA 4: Medias (M) y desviaciones tpicas (DT) en las dimensiones 3 y 4 de EOECM (SIZ, CARBONERO & FLORES, 2010). Medias de las puntuaciones en una escala tipo Likert, donde 1 sera la puntuacin mnima y 5 la mxima.

Conclusiones
En primer lugar se hace hincapi en la importancia de realizar una observacin sistemtica de habilidades metacognitivas y de planificacin en los nios de estas edades (BROWN, 1987), ya que se ha demostrado la relacin entre dichas habilidades y el desarrollo del aprendizaje (EFKLIDES, 2006). Las conclusiones de la mencionada observacin ayudarn al profesorado en la deteccin de aquellas estrategias que precisan instaurarse y/o incrementarse (BLTE ET AL., 1999; VEENMAN & BEISHNIZEN, 2004), con el fin ltimo de desarrollar propuestas de intervencin curricular que permitan orientar el trabajo del profesor hacia programas de desarrollo metacognitivo (SIZ & ROMN, 1996; SIZ & ROMN, 2010). Todo lo cual cobra una especial significacin para el desarrollo de una escuela inclusiva (SHATZ ET AL., 2003; AYALA, 2005) y el aprendizaje exitoso en contextos de atencin a la diversidad. Si bien los resultados de esta investigacin deben de tomarse con prudencia, ya que el tamao de la muestra y los diseos utilizados no permiten un control exhaustivo de las amenazas sobre la fiabilidad y validez, los datos encontrados apuntan al dficit en algunas de las estrategias metacognitivas y de planificacin relacionadas con las competencias de aprender a aprender en estas edades: estrategias de planificacin y estrategias de resolucin de problemas. Esto sugiere, como ya se ha indicado anteriormente, la puesta en marcha de programas de intervencin en las aulas que faciliten la adquisicin y desarrollo de este tipo de estrategias, buscando siempre su insercin en los currculos educativos desde edades tempranas (SIZ, 2000; SIZ & ROMN, 1996; SIZ & ROMN, 2010). El desarrollo de dichas competencias previsiblemente ayudar a los alumnos y alumnas a desarrollar estrategias de autorreflexin, autocorreccin y deteccin de las estrategias cognitivas y metacognitivas ms adecuadas para la resolucin de tareas. En este proceso es esencial que la intervencin

128 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

Metacognicin y competencia de aprender a aprender en Educacin Infantil: Una propuesta para facilitar la inclusin

instruccional se comience en edades tempranas, ya que se facilitar la construccin de aprendizajes significativos y reflexivos. Por todo lo cual se considera necesario continuar en futuras investigaciones desarrollando instrumentos cada vez ms precisos de observacin de las habilidades metacognitivas y de planificacin en Educacin Infantil, as como poniendo en marcha programas de instruccin curricular que ayuden al profesorado en el entrenamiento de sus alumnos en la adquisicin y desarrollo de dichas habilidades (SIZ, 1996; SIZ & ROMN, 2010), en aras de facilitar la inclusin de todo el alumnado.

Referencias bibliogrficas
AYALA, L. (2005). La monitorizacin de la desigualdad y la exclusin social: hacia un sistema integrado de indicadores. Documentacin Social 137, 169191. BLTE, A. W., RESING, W. C. M., MAZER, P. & VAN NOORT, D. A. (1999). Young childrens organitational strategies on a samedifferent task: A microgenetic study and training study. Journal of Experimental Child Psychology, 74, 2143. BROWN, A. L. (1975). The development in memory: Knowing, Knowing about knowing, and knowing how to know. En H. W. Reese (ed.), Advances in child development and behaviour Vol. 10. New York: Academic Press, 103152. BROWN, A. L. (1977). Development, Schooling and acquisition of Knowledge about Knowledge. En R. C. ANDERSON, R. J. SAPIRO & W. E. MONTAGUE, Schooling and acquisition of Knowledge. Hillsdale, N. J: Erlbaum, 241258. BROWN, A. L. (1987). Metacognition, executive control, selfregulation and other more mysterious mechanisms. En F. E. WEINERT & H. KLUWE (ed.), Metacognition, motivation and understanding. Hillsdale NJ: Lawrence Erlbaum Associates, 65116. CASE, R. (1985). Intellectual development: Birth to adulthood. New York: Academic Press. DE SECO (2006). Las competencias clave para el bienestar personal, econmico y social. www.deseco.admin.ch/bfs/deseco/en/index/03/02.parsys.78532.downloadList.94248.Downlo adFile.tmp/2005.dscexecutivesummary.sp.pdf. EFKLIDES, A. (2006). Metacognition and affect: What can metacognitive experiences tell us about the learning process?. Educactional Research Review, 1, 314. FLAVELL, J. H. (1971). Firsts Discucssants comments: what is memory development the development of?. Human Development, 14, 272278. FLAVELL, J. H. (1981). Cognitive monitoring. En W. P. DICKSON (ed.), Childrens Oral Comunications Skills. New York: Academic Press. PREZ GMEZ, A. I. (2008). Competencias o pensamiento prctico?. La construccin de los significados de representacin y accin. En GIMENO, J. (ed.), Educar por competencies, qu hay de nuevo?. Madrid: Morata, 59102. HALFORD, G. S. (1993). Childrens understanding: The development of mental models. Hillsdale, N. J.: Lawrence Erlbaum Associates. MCCARTHY, D. (1977). Escalas McCarthy de Aptitudes y Psicomotricidad para nios. Madrid: TEA. MISTRY, R. S., BIESANZ, J., CHIEN, N., HOWES, C. & BENNER, A. D. (2008). Socioeconomic status, parental investments, and the cognitive and behavioral outcomes of lowincome children from immigrant and native households. Early Childhood Research Quarterly, 23 (2), 193212. MUOZ, J. (2004). Enseanzaaprendizaje de estrategias metacognitivas en nios de Educacin Infantil. Burgos: Universidad de Burgos. NISBERT, J. & SHUCKSMITH, J. (1990). Estrategias de aprendizaje. Madrid: Santillana. PRAMLING, I. (1993). Metacognicin y estrategias de aprendizaje. En C. MONEDERO (ed.), Estrategias de aprendizaje: procesos, contenidos e interaccin. Barcelona: Domnech, 3146.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

129

MariaConsuelo Siz, Valle Flores & JosMara Romn

PRAMLING, N. & PRAMLING, I. (2009). The prosaics of figurative language in preschool: some observations and suggestions for research. Early Child Development and Care 179 (3), 329 338. SIZ, M. C. (1994). Adaptacin y Validacin de un Programa de Desarrollo SociCognitivo en nios con Deprivacin SocioAmbiental. Tesis Doctoral. Valladolid: Secretariado de publicaciones e Intercambio Cientfico de la Universidad de Valladolid [Microficha]. SIZ, M. C. (2000). Entrenamiento metacognitivo en el aula: Un procedimiento curricularmente integrado. En JESSNICASIO GARCA (ed.), De la instruccin a las necesidades curriculares. Barcelona: OikosTau, 5364. SIZ, M. C. & ALONSO, P. (2008). Anlisis de tareas como estrategia cognitiva de evaluacin. En M. C. SIZ, A. CANTERO, J. J. VELASCO & J. L. CASILLAS (ed.), La Orientacin como recurso educativo y social. Burgos: Universidad de Burgos. Servicio de Publicaciones, 115. SIZ, M. C, CARBONERO, M. A. & FLORES, V. (2010). Anlisis tareas tradicionalmente cognitivas y de teora de la mente en nios de 4 y 5 aos. Psicothema, 22 (49), 772777. SIZ, M. C. & ROMN, J. M. (1996). Programa de entrenamiento cognitivo para nios pequeos. Madrid: CEPE (Segunda edicin). SIZ, M. C. & ROMN, J. M. (2010). Programa de desarrollo de habilidades mentalistas en nios pequeos. Madrid: CEPE. SHATZ, M., DIESENDRUCK, G., MARTINEZBECK, I. & AKAR, D. (2003). The influence of language and socioeconomic status on childrens understanding of falsebelief. Developmental Psychology, 39, 717729. TESOURO CID, M. (2006). Ensear a aprender a pensar en los centros educativos, incluso en las actividades de evaluacin. Revista Electrnica Interuniversitaria de Formacin del Profesorado, 9 (1), 114. VEENMAN, M. V. J. & BEISHUIZEN, J. J. (2004). Intellectual and metacognitive skills of novices while studying texts under conditions of text difficulty and time constraint. Learning and Instruction, 14, 621640. VEENMAN, M. V. J. & SPAANS, M. A. (2005). Relation between intellectual and metacognitive skills: Age and task differences. Learning and Indivudual differences, 15, 159197. WHITEBREAD, D., COLTMAN, P., PASTERNAK, D. P., SANGSTER, C., GRAU, V., BINGHAM, S., ALMEQDAD, Q. & DEMETRIOU, D. (2009). The development of two observational tools for assessing metacognition and selfregulated learning in young children. Metacognitive Learning, 4, 6385.

130 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 123130

MUJERES Y EDUCACIN: ESCENARIOS DE AYER Y DE HOY

REFERENCIA: Gonzlez Prez, Teresa (2010). Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas.


TeresaGONZLEZPREZ

Correspondencia: TeresaGonzlezPrez Correoelectrnico: teregonz@ull.es Telfono: 922319209 Fax: 922319010 Direccinpostal: UniversidaddeLaLaguna FacultaddeEducacin CampusCentral DepartamentodeHistoriay FilosofadelaCiencia Avda.Trinidad,s/n. 38204SanCristbaldeLaLaguna Tenerife(Espaa) Recibido:3deoctubrede2010 Aceptado:10denoviembrede2010

RESUMEN
La irrupcin de las mujeres en la Escuela, como alumnas y comoenseantes,comenzmuytmidamenteenlaEspaa delsigloXVIII,sibiennofuehastafinalesdelsigloXIX,conla Ley Moyano (1857), cuando se estableci la obligatoriedad de la instruccin primaria pblica para las nias. Pero las polticaseducativasnosloposibilitaronprogresivamentela incorporacinylapermanenciadelasniasenlainstitucin escolar. Tambin se hizo efectivo el ingreso de las mujeres en la profesin docente, ingreso que en un principio quedabareducidoalaenseanzaprimariayqueresponda ms a una cuestin de utilidad que a un inters social por darlesalasmujereslaoportunidaddemejorarsuformacin parasuincorporacinalmercadolaboral.Enestetrabajonos proponemos analizar la trayectoria de la formacin inicial de lasmaestrasespaolas,diseadasegnelprogramacurricular concretadoendiferentesplanesdeestudioalolargodelsiglo XIX.

PALABRAS CLAVE: Maestras, Espaa, Ley Moyano,


Formacininicial,Currculum,Desigualdad.

Learning to teach in the nineteenth century. Initial training of Spanish female school teachers
ABSTRACT
The emergence of women in Spanish schools, as students and as teachers, started very timidly in the eighteenthcentury,althoughitwasnotuntilthelatenineteenthcentury,whentheMoyanoLaw(1857) waspassed,thatcompulsorypublicprimaryeducationforgirlswasestablished.Educationpoliciesnot onlyprogressivelyenabledtheincorporationandcontinuityofgirlsatschool,italsoallowedwomento entertheteachingprofession.Itwasatfirstlimitedtoprimaryeducationandamatterofutilityrather thanasocialinterestinofferingwomentheopportunitytoimprovetheirtrainingtogetintothelabour market. In this paper we analyse the trajectory of Spanish female school teachers' initial training, designedaccordingtothecurriculumindifferentsyllabithroughoutthenineteenthcentury.

KEY WORDS: Femaleteachers,Spain,MoyanoLaw,Initialtraining,Curricula,Inequality.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

133

Teresa Gonzlez Prez

Introduccin
En Espaa la incorporacin de las mujeres a la educacin no estuvo exenta de dificultades. Hasta el siglo XIX la escuela fue un espacio social restringido al gnero masculino. El sistema educativo construy un modelo educativo partiendo de las desigualdades entre sexos y hubo muchas reticencias con respecto a las nias, porque ms bien se consideraba que las perjudicaba (BALLARN, 2001). A pesar de la polmica, la incorporacin de las mujeres a la enseanza sistemtica fue una realidad, aunque sin apartarse del aprendizaje acorde con la condicin femenina. El discurso del saber en la sociedad tradicional se apoyaba en las buenas costumbres, el cuidado personal y la domesticidad. Un imaginario que se proyect tanto en manuales escolares como en libros de lectura, difundiendo el prototipo femenino, fijando las esferas y espacios de influencia, partiendo de la dicotoma pblico y privado en relacin a ser hombre o mujer. El programa educativo no inventaba nada, mantena la tradicin reforzando roles y estereotipos sexuados. Para ello se fijaron unas materias especficas para las nias y jvenes, las denominadas enseanzas del hogar, que en la prctica se centraban en las disciplinas domsticas y las reglas de urbanidad (BALLARN, 2000). Cada cultura y cada sociedad tienen sus propios imaginarios. Buena parte de esos imaginarios han sido construidos en pocas pretritas desde la masculinidad y encorsetaban la representacin femenina restringiendo su participacin pblica. En efecto, los imaginarios construidos desde la cultura masculina representaban a las mujeres ajenas a la vida pblica, negadas, estereotipadas o invisibilizadas. Las maestras tampoco escaparon a ello, aunque a travs de su ejercicio laboral fueron pioneras en ganar espacio pblico. Cruzaron la frontera que las situaba entre la tradicin y la modernidad para cumplir su rol sin romper los estereotipos sociales. La formacin inicial diferenciada y segregada estuvo vigente en las instituciones normalistas femeninas espaolas durante casi toda la centuria decimonnica. En concreto hasta 1881, cuando se fij un plan de estudios oficial, aunque las labores representaban ms de un tercio del horario escolar. Las escuelas de magisterio, desde la segunda mitad del siglo XIX y hasta la dcada de los aos veinte del siglo XX, fueron los centros ms importantes de cultura femenina y los nicos estudios no elementales donde la presencia de las mujeres era aceptada (CAPEL, 1986). La multiplicacin geogrfica de estas escuelas y su carcter casi exclusivamente femenino se explica en base al hecho de que la enseanza primaria era el nico sector de las profesiones liberales cualificadas que se les permita ejercer a las mujeres y, en este sentido, la carrera de magisterio monopolizaba las inquietudes culturales de este sexo. Los contenidos intelectuales que se les impartan armonizaban con las ideas ms tradicionales sobre los parmetros que deban regir la educacin femenina, dada la parcela hacia la que dirigan las actividades las alumnas y las atribuciones pedaggicas que a nivel escolar se le conferan a las mujeres, en virtud de ese carcter innato de educadoras. Las escuelas normales, como opcin de estudio, se constituyeron en un lugar atrayente para las mujeres con inquietudes intelectuales, por lo que en poco tiempo la docencia primaria pas a ser mayoritariamente femenina. En el siglo XIX formaron parte de esa exigua minora profesional femenina, y, a la vez, constitua la ocupacin mayoritaria en el magisterio porque hasta comienzos del siglo XX slo se les permita el acceso a la enseanza infantil, primaria y al magisterio. En las primeras dcadas del siglo XX las mujeres alcanzaron no slo los niveles de feminizacin del magisterio; tambin consiguieron idnticos porcentajes de escolarizacin que los hombres y el acceso a las diferentes modalidades educativas, es decir, a la enseanza secundaria y universitaria.

1. Algunos datos sobre los orgenes de la formacin de maestras


Las maestras a comienzos del siglo XIX eran prcticamente analfabetas: apenas posean unos rudimentarios conocimientos. A veces saban leer pero no escribir, y en cambio eran expertas en catecismo, en coser y bordar. Unos conocimientos considerados en aquel entonces suficientes para atender a las escuelas de nias. La instruccin se opona a la feminidad; por ello, el objetivo no era formar a las mujeres intelectualmente, sino prepararlas en modales, hacerlas virtuosas, tiles, sumisas y buenas. Argumentos que sirvieron de base para disear la educacin de las mujeres, y a su vez se emplearon para su proyeccin en las disposiciones legislativas. Los modelos educativos femeninos del siglo XIX afirmaban la diferencia social y curricular. Se apoyaban en el discurso de inferioridad que defendan las teoras cientficas, relativo a las diferencias psicobiolgicas detectadas entre hombres y mujeres (BALLARN, 2000: 83). No slo la formacin de las maestras era deficiente, sino que la mayora ejercan sin haber obtenido la titulacin correspondiente. Por ejemplo, en 1835 buena parte de las

134 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133-143

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas

maestras carecan de ttuloi. En 1839 el primer Reglamento de exmenes para la obtencin del ttulo de maestra fij que haba que hacerlo en privado ante la Comisin Provincial, a diferencia de los maestros que era un examen pblico. Se les exigan las materias de labores, religin y moral, lectura, escritura y nociones de aritmtica. En definitiva, unas exigencias que marcaban menos conocimientos que los requeridos a los maestros. Con posterioridad, en el Reglamento de exmenes de 1850 aumentaron las exigencias para los maestros pero no as para las maestras, a las que no se les peda el conocimiento de los mtodos de enseanza. En 1850 se contaba con 4.066 maestras, de las cuales solamente 1.871 ejercan su profesin con ttulo, cobrando un tercio menos que los maestros, de acuerdo al Real Decreto de 1847. La escasez de maestras tituladas dificult la constitucin de comisiones de examen; por ello, este Reglamento dispuso que el Gobernador poda nombrar a dos seoras instruidas en el supuesto de no haber maestras. En general este dato evidencia la psima situacin educativa en el estado espaolii. Al margen de las diferencias geogrficas en estas fechas, prcticamente el 90% de la poblacin femenina era analfabeta. La creacin de las escuelas normales para maestras mejor la formacin inicial. Los estudios de magisterio eran la nica opcin de estudio y a la vez de ejercicio profesional para las mujeres, pero con marcadas diferencias curriculares respecto a la formacin de maestros. Hacia la mitad del siglo las maestras incorporadas al sistema educativo atendan las escuelas de prvulos, tanto de nios como de nias. Encargadas de la escolarizacin infantil, su funcin responda al modelo de maestra maternal (SAN ROMN, 1997), aunque la legislacin y el currculum segregado las excluy de las escuelas de nios. La normativa que regulaba el funcionamiento de las escuelas normales de maestros se fue adaptando para las escuelas normales de maestras, excepto en el currculum con la inclusin de labores propias del sexo y la exclusin de Agricultura. La primera institucin que se cre para atender la formacin inicial de las maestras a tenor de lo que prescriba la ley Moyano de 1857iii fue la Escuela Normal Central (Madrid) en 1858. La Escuela Normal Central fue el centro piloto que sirvi de prototipo y su plan de estudios se extendi a otras escuelas normales. Aunque dicha ley, en su artculo 114, determinaba que el gobierno deba de procurar el establecimiento de Escuelas Normales de Maestras para mejorar la instruccin de las nias, lo dej al arbitrio de las Diputaciones Provinciales y stas no siempre se implicaron en su establecimiento, por lo que en muchas provincias no se cre ninguna. De este modo, las aspirantes a maestras que pretendan la titulacin deban examinarse libres de todas las asignaturas de la carrera, incluso deban superar la prueba de ingreso y, adems, acreditar el haber realizado las prcticas en una escuela pblica femenina. Sin embargo, no se cumpla y en realidad las materias instrumentales se relegaban dando prioridad a las materias de labores y religin. Las materias no profesionales eran las protagonistas de su formacin y, realmente, reciban una intensa preparacin en las materias relacionadas con el hogar. De manera que las materias relacionadas con las actividades del hogar ocupaban la mayor parte del curriculum y de las instrumentales (Matemticas, Lengua) slo reciban unos conocimientos rudimentarios. Adems, estaban ausentes del programa de estudios materias cientficas como las Ciencias Naturales, la Fsica y la Geometra. El currculum formativo era bastante reducido y por esta causa reciban una preparacin nfima. El resultado era una maestra con mediano dominio de las tcnicas de lectura y escritura, unos escasos conocimientos en aritmtica y una notable habilidad para las labores del hogar; todo ello revestido de cierto de barniz pedaggico. Estas maestras solan prepararse con otras maestras para luego examinarse como alumnas libres en la normal, aunque tambin haba algunos colegios privados de seoritas que instruan a las jvenes aspirantes al ttulo. Consecuencia de la escasa preparacin de las maestras era que en las escuelas primarias las nias slo reciban una mediocre formacin, reducida al aprendizaje de los dogmas de la religin catlica, al superficial conocimiento de las materias instrumentales y una relativa habilidad manual para las labores en tela. Aadir adems que la citada ley Moyano, en su artculo 102, estableca para los pueblos con nmero de habitantes inferiores a 500 que podan tener una escuela desempeada por pasantes o adjuntos que nicamente necesitaban un certificado de aptitud o moralidad que expeda la Junta Local. El nmero de maestras era cuantitativamente inferior al de los maestros dadas las restricciones que sufran las mujeres. Las estadsticas informan que en 1855 las maestras representaban el 23,6%. Se trataba de un porcentaje en ascenso, pues en 1885 se haba incrementado hasta alcanzar el 41,4%. La legislacin encorsetaba a nias y maestras restringiendo su preparacin y, a la vez, discriminndolas frente a la instruccin impartida a los nios y a los maestros (FLECHA, 1997). Ms tarde la recepcin de las corrientes de pensamiento europeas influy en la evolucin de los planteamientos educativos, hecho que implic importantes cambios (ESCOLANO, 2002). La modernizacin educativa introdujo innovaciones en algunos centros y reactiv la prctica docente.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

135

Teresa Gonzlez Prez

Ejemplo de ello fue la difusin de la pedagoga de Frebel vinculada a la renovacin de la enseanza de prvulos. En 1873 se adscribi la Clase de Pedagoga segn el sistema Frebel a la Asociacin para la Enseanza de la Mujer. La Escuela de Institutrices (1869) y la Asociacin para la Enseanza de la Mujer (1870) fueron centros seeros para la formacin de las espaolas y ejercieron notable influencia pedaggica en la Escuela Normal Central de Maestras de Madrid (COLMENAR, 1994: 48). En 1874 se dot una ctedra de Pedagoga de Frebel en la referida Escuela Normal Central. Era el efecto de la renovacin pedaggica y la toma de conciencia de las limitaciones de la formacin inicial que condujeron a innovaciones, como la reforma de la Escuela Normal Central de Maestras en 1882, al tiempo que se les confiaba a las maestras la enseanza de prvulosiv (COLMENAR, 1983). Con la reorganizacin de los estudios se convirti en el primer centro oficial femenino; la ampliacin curricular mejor el perfil profesional para elevar la formacin de la mujer espaola a nivel europeo (COLMENAR, 1994: 49). La Escuela Normal Central atenda la formacin inicial de las maestras y su papel tuvo trascendencia en la sociedad de la poca dadas las escasas instituciones que se ocupaban de la educacin de las mujeres (COLMENAR, 1983). Y aunque ofreci ttulo oficial a las mujeres, la cultura que proyectaba era muy escasa. La cualificacin profesional de las egresadas era muy limitada, ya que con un simple examen podan obtener el ttulo de maestra. Dichos exmenes para valorar sus conocimientos se realizaban ante un tribunal conformado por hombres. El tribunal femenino juzgaba las labores y eran sumamente exigentes frente a la actitud generosa de los otros examinadores (BALLARN, 2001). Prcticamente durante todo el siglo XIX la formacin de maestras se caracteriz por su precaria preparacin, inferior a la de los maestros, porque la mayor parte del horario escolar lo ocupaba la enseanza de las labores (GONZLEZ, 1994: 180). El bajo nivel cultural y pedaggico en la formacin inicial se mantuvo hasta finales de la centuria y, an en 1880, no se estudiaban en ella Ciencias Naturales, Fsica, Geometra ni nociones de Comercio e Industria (DOMNGUEZ, 1991: 24). La creacin de las escuelas normales de maestras no sigui un ritmo uniforme en el estado espaol, a pesar de los numerosos alegatos a favor, entre ellos, los de Pablo Montesino. Por la indudable incidencia social de las egresadas como futuras educadoras de las nuevas generaciones, eran establecimientos necesarios para la formacin de maestras y no siempre hubo una respuesta positiva desde las administraciones locales. Se invirti mucho tiempo en solicitudes, peticiones e informes, hecho que dificult y retras el establecimiento de los centros femeninos. No obstante lo anterior, fueron extendindose de forma paulatina por la geografa espaola, por la necesidad de dotar a las provincias y a sus capitales respectivas de establecimientos propios donde las estudiantes pudieran realizar los estudios para el ejercicio de la enseanza. El problema de la financiacin retard su instauracin porque en el siglo XIX estaban financiadas por las Diputaciones de cada provincia y hasta comienzos del siglo XX no se incorporaron a los presupuestos generales del estado manteniendo por lo general una vida lnguida (NAVARRO, 2002: 33). En muchas provincias el proceso de instalacin fue muy lento y se retras bastante su creacin, algunas hasta finales del siglo XIX, como fue el caso de Burgos en 1896 (Navarro, 1989), y otras lo hicieron en la centuria siguiente (GONZLEZ, 1997), como sucedi en Tenerife (1902) y Gran Canaria (1927). Tambin hubo otras Diputaciones que se adelantaron a las recomendaciones de la normativa Moyano y desarrollaron su iniciativa de organizar una escuela normal de maestras. A este respecto sealar las escuelas normales de maestras de Navarra (1847), Badajoz y Logroo (1851); lava, Cceres y Zaragoza (1856). En otras provincias respondieron en tiempo y forma, por ejemplo, Cdiz, Segovia, Teruel y Guadalajara en 1857; Ciudad Real, Cuenca, Granada, Huesca, Madrid, Sevilla y Salamanca en 1858. En Ciudad Real se cre por Real Decreto de 24 de febrero de 1858, aunque comenz a funcionar en el curso 18601861. Alicante y Oviedo en 1859. Zamora y Murcia en 1860; vila, Barcelona, Crdoba, Mlaga, Pontevedra, Valladolid en 1861; Albacete y Tarragona en 1862; La Corua y Guipzcoa en 1865; Valencia en 1866; Baleares en 1872 y Soria en 1876 (VEGA, 1988). Una cronologa fundacional muy heterognea, que recoge mltiples fechas a lo largo de la segunda mitad de la centuria. Sin embargo, fue habitual que se pospusiera la creacin dependiendo de los recursos econmicos disponibles en las arcas pblicas, hecho que indica que no fue prioritario su establecimiento. Tampoco descuid la administracin espaola la formacin de maestras en sus posesiones de ultramar; as por, Real Decreto de 19 de junio de 1890 cre una escuela normal de maestras en Cuba (HUERTA, 1996) y otra escuela normal de maestras en Puerto Rico (HUERTA, 1996).

2. Reformas de finales de siglo


La precaria formacin recibida en las normales fue objeto de denuncia por parte de muchos sectores crticos y, frente a la atona de los centros, se plantearon medidas de renovacin. Una de ellas

136 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133-143

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas

fue la iniciada en 1882 con innovacin dentro del plan de formacin de maestras que ofreca la Escuela Normal Central de Maestras (ESCOLANO, 2002). En 1882 se les encomendaba en exclusiva la atencin a los prvulos. Adems, las reformas legislativas permitieron a las maestras la direccin de las Escuelas de Prvulos. La Real Orden de 8 de junio de 1881 estableca un plan de estudios para la Escuela Normal Central de Maestras con idntico programa curricular que para los centros masculinos. Adems, el profesorado de las escuelas normales de maestras era masculino hasta 1882, cuando se estableci el grado Normal (MELCON, 1992) y las mujeres pudieron optar a la titulacin. Por las Reales Ordenes de 17 de junio y 25 de julio de 1881 se hizo extensivo dicho plan a todas las escuelas normales del Estado, de manera que a partir de 1881 el plan de estudios de las escuelas normales era idntico para los alumnos y las alumnas. Segn la normativa ambos deban cursar las mismas asignaturasv. Sin embargo, con ciertos matices, porque prevalecan las materias consideradas femeninas y as una tercera parte del horario semanal lo dedicaban a las materias de hogar. Para la obtencin del ttulo de maestra superior las aspirantes deban superar idnticas materias del grado elemental y labores. Ese espacio social lleg a considerarse propio para las mujeres hasta tal modo que en 1882 se les asign legalmente en exclusiva la educacin infantil (prvulos), una exclusividad que se mantuvo hasta 1977 (VIAO, 2004). En estos aos las maestras lucharon por mejorar sus condiciones laborales frente a los maestros y reclamaron igual salario. De este modo, la desigualdad salarial se resolvi en virtud de la Ley de nivelacin salarial, de 6 de julio de 1883, en la que el gobierno reconoci la equiparacin salarial con los maestros. Segn los datos oficiales, las tasas de analfabetismo eran muy elevadas en el estado espaol, con marcadas diferencias entre el norte especialmente en las reas ms industrializadas y el sur, as como entre las zonas urbanas y rurales. Para el caso de las mujeres los ndices de analfabetismo eran superiores. Las estadsticas informan de que en el ao 1872 alrededor de un 10% de las mujeres saban leer y escribir, lo cual se traduca en unos saldos muy altos de analfabetas. El nmero de maestras tituladas no era suficiente para atender la escolaridad de las nias; lo cual demuestra el insuficiente nmero de maestras y el desempeo de estas tareas por parte de personas no idneas y mal preparadas para cumplir tal cometido. En 1882 las mujeres superaban el 81,20% y los hombres el 61,50 % de los ndices de analfabetismo. Ante estas elevadas cifras y la actitud negligente del gobierno por la educacin femenina, la Asociacin para la Enseanza de la Mujer canaliz su actividad efectuando campaas a favor de la instruccin de la mujer. Por esta causa, en 1877 se aplic el artculo 114 de la Ley de Instruccin Pblica de 1857, referida al establecimiento de Escuelas Normales de Maestrasvi, si bien no se obtuvo el resultado esperado porque el gobierno conservador adopt medidas restrictivas. En esta centuria el magisterio fue una de las escasas alternativas culturales y laborales para las mujeres. Este hecho se vio plasmado en la obtencin del ttulo de maestra elemental, donde ellas representaban una entidad numrica superior a la de los maestros. En cambio, suceda a la inversa con la titulacin superior, donde los maestros ostentaban el mayor porcentaje de los ttulos. Entre otras razones, las maestras se conformaban con el ttulo de maestra elemental viendo compensadas sus aspiraciones profesionales y culturales. Los contenidos que se les exigan en los exmenes a las alumnas normalistas eran inferiores a los de los alumnos, lo cual no deja de ser indicativo de la falta de inters social por la educacin femenina. Evidentemente en el siglo XIX localizamos los orgenes de la feminizacin del magisterio porque era una de las pocas profesiones que se les permitan desempear (SAN ROMN, 1997). Ms tarde, la reforma emprendida por el ministro de Fomento Germn Gamazo en 1898 consigui equiparar los estudios de maestra con los de maestro, aunque prevaleciendo algunas diferencias curriculares. El citado ministro, al plantearse la reorganizacin de las escuelas normales, se cuestion el carcter de estas instituciones: si deban ser centros de cultura general y tcnica o establecimientos tcnicos nicamente. Sin embargo, puntualiz que para el caso de las normales de maestras: La cuestin est resuelta en Espaa por la necesidad; pues siendo escaso el nmero de centros de instruccin para la mujer, muchas jvenes acuden a las Normales de Maestras sin buscar los fines, ni las utilidades de la profesin; y en cuanto a las Normales de Maestros, se resuelve aceptando la primera solucin de ser centros de cultura general y tcnica, pues la cultura general de Maestro ha de tener ciertas condiciones de solidez, aunque no de extensin, y de carcter educativo, que no se encuentra fcilmente en otras instituciones de enseanzavii. Con esta exposicin, el ministro puso de relieve dos cuestiones bsicas referidas a la educacin femenina. La primera denota la carencia de instituciones educativas femeninas, y la segunda la

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

137

Teresa Gonzlez Prez

importancia de la preparacin de los maestros frente a la formacin de segundo orden de las maestrasviii. As, el Real Decreto de 23 de septiembre de 1898 fij las asignaturas propias de las escuelas normales elementales de maestros. Tales materias se incluan igualmente en el plan de estudios fijado para las maestras, pero con algunas modificacionesix. A nivel de la disposicin terica se aproximaban, pero en la prctica las labores continuaban manteniendo su protagonismo en el currculum en perjuicio de los conocimientos pedaggicos, cientficos y literarios (GONZLEZ, 1994: 181). De este modo, hasta finales de siglo, la preparacin cientfica que reciban las maestras era incompleta. Se les introduca de forma sucinta en la aritmtica, en la geometra y ciencias naturales. Dentro de la limitacin de las enseanzas las materias literarias ocuparon un lugar preferente, pero las disciplinas pedaggicas tuvieron una reserva horaria inferior a la del resto de las materias. Tenan una deficiencia semejante a la que experimentaron los estudios de maestro. Con el Plan de Estudios de 1898 se pretenda equiparar el programa de formacin de maestros y maestras, aunque no se consigui. No obstante, mejor la formacin de las maestras y las escuelas normales contaron con un nmero creciente de alumnas matriculadas y tituladas, lo que favoreci el proceso de feminizacin de la docencia en los primeros niveles educativos. En el ltimo cuarto del siglo XIX las escuelas normales de maestras eran los centros adecuados para que se formaran las mujeres y tambin para ensayar otras modalidades de instituciones que facilitaran su formacinx. Segn lo dictado en los reales decretos de 21 de septiembre de 1902 funcionaban escuelas de magisterio femeninas repartidas por la geografa espaola, pero el Decreto de 30 de marzo de 1905 las subdivida en tres grados: central, superiores y elementales. Las escuelas superiores de maestras se hallaban en las capitales de distrito universitario y en Alicante, Badajoz, Bilbao, Burgos, Cceres, Ciudad Real, Guadalajara, Crdoba, Corua, Mlaga, Palencia, Palma de Mallorca, Teruel y Toledo. Las Escuelas Elementales de Maestras en vila, Baleares, Cuenca, Cdiz, Tenerife, Castelln, Guipzcoa, Huesca, Len, Lrida, Logroo, Murcia, Pamplona, Pontevedra, Segovia, Soria y Zamora. Hasta 1914 se mantuvo la divisin de los estudios y de las instituciones de magisterio en elementales y superiores.

3. El magisterio a comienzos del siglo XX


En el primer tercio del siglo XX el total numrico de la matrcula normalista de alumnas ascendi notablemente. En la segunda dcada de la centuria su entidad numrica se equipar a la de los aspirantes al ttulo de maestros (VIAO, 2004). A partir de esas fechas no se puede ignorar la presencia femenina en los estudios de magisterio: en muchos casos sus tasas solan ser superiores a las masculinas. Las escuelas normales eran los centros de formacin de maestras y en muchos lugares los nicos centros de enseanza a los que podan optar las mujeres. Las normales destacaron por su compromiso con la formacin de maestras y la educacin femenina, pero mantuvieron la visin de la mujer dentro de los parmetros que marcaba la mentalidad de la poca. El marcado acento sexista de la sociedad espaola se reflejaba igualmente en el desarrollo curricular y en la formacin de maestras, pues ellas seran las educadoras de las futuras generaciones de mujeres y el orden vigente no se poda alterar, aunque se consideraba importante la instruccin. De ese modo se entenda que una tercera parte del horario semanal lo dedicaran a las materias de hogar. Para la obtencin del ttulo de maestra superior las aspirantes deban superar idnticas materias del grado elemental y labores. En el plan de estudios de 1903 las lecciones empleadas en las Labores por las alumnas se compensaron con las dedicadas a los Trabajos Manuales y Ejercicios Corporales por los alumnos. En las primeras dcadas de la centuria se abrieron otras posibilidades de formacin para las mujeres y a la vez de ejercer otras actividades. As por ejemplo, se crearon las titulaciones de Matrona (1911), Taqugrafas y Mecangrafas (1916) y Enfermeras (1917). Las mencionadas titulaciones eran consideradas apropiadas para el perfil profesional de las mujeres y adecuadas para desempear su rol social. Tanto la formacin recibida como su actividad profesional no podan oponerse a los estereotipos culturales ni romper con el orden establecido ni con las expectativas femeninas. Adems, el 8 de marzo de 1910 una Real Ordenxi autorizaba el acceso de las mujeres a la Universidad y a los institutos (FLECHA, 1996). Otro avance importante a considerar fue la creacin de la Escuela de Estudios Superiores del Magisterio fundada en 1909 (Real Decreto de 3 de junio de 1909). Esta institucin tuvo un eco inusitado porque represent la renovacin en la formacin del profesorado normalista, a la que se permiti ingresar a las mujeres. Muchas de las mujeres que se formaron en esta institucin actuaron de forma decisiva impulsando la educacin para las mujeres (GONZLEZ, 1994: 184). Las egresadas que impartieron sus enseanzas en las distintas escuelas normales impulsaron la vida acadmica y renovaron prcticas metodolgicas. Especialmente las alumnas aspirantes al ttulo de maestras se

138 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133-143

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas

beneficiaron de la docencia que ejercieron las profesoras procedentes de la escuela de Estudios Superiores del Magisterio. En relacin con lo indicado, tambin permitieron a las que se formaban en dicha institucin el acceso a las plazas de Inspeccin, de manera que a partir de 1913 las mujeres pudieron ser inspectoras de enseanza primaria. Los cambios legislativos y la evolucin de la normativa favorecieron a las mujeres en todos los niveles educativos. Los progresos se reflejaron en el incremento de la escolarizacin de las nias. A nivel cuantitativo la escolarizacin de las nias en el curso 19091910 representaba el 47,1% y en torno a 1930 se nivel con la escolarizacin de los nios. No obstante, se mantenan diferencias en el currculum y el absentismo, pues las nias faltaban ms a la escuela o se retiraban antes porque contribuan al trabajo en el hogar familiar ayudando a las madres en el cuidado de los hermanos pequeos y/o en las faenas domsticas. En la medida que transcurra el tiempo los gobernantes entendieron la importancia de la formacin para las mujeres y la repercusin de la actividad de las maestras en la sociedad. El currculum evolucion y, de forma paulatina, se diversific el nmero de materias, ampliando tanto los contenidos metodolgicos como cientficos. Pero aunque mejor su nivel, las aspirantes a maestras no se vieron privadas de las Enseanzas del Hogar ni del rol domstico que reforzaban los programas de formacin acadmica. En 1914, el ministro Francisco Bergamn decret un nuevo Plan de Estudios, dejando claro el cometido social de la mujer: Las Escuelas Normales de Maestras servirn adems para proporcionar a las

mujeres que deseen adquirirla una cultura superior a la que se da en las Escuelas de Primera enseanza (Artculo 1 del Real Decreto de 3 de agosto de 1914).
El rgimen de enseanza estableca la separacin de sexos, impartiendo la docencia en instituciones independientes. Pero hubo casos en los que se admiti a alumnos y/o alumnas por carecer de centro especfico de formacin. Si bien se admita el rgimen de coeducacin ,las enseanzas continuaron siendo diferenciadas. La coeducacin representaba una novedad, ya que este sistema no fue implantado en las escuelas normales hasta el Plan de Estudios de 1931. Sin embargo, este sistema de organizacin escolar se vena practicando en otros centros educativos, tales como la Universidad y las Escuelas de Comercio. Algunas normales, ante la carencia de centro masculino o femenino, admitieron alumnado en rgimen de coeducacin; esto suceda ms en las provincias perifricas y no hubo objeciones a esta modalidad de enseanza. Por el contrario, en algunas regiones histricas del estado la coeducacin no result bien acogida, lo cual era reflejo de la mentalidad conservadora de algunos sectores del pas (CEREZO, 1990). De este modo, los alumnos normalistas disfrutaron de las modalidades de enseanza en rgimen de coeducacin aunque la enseanza normalista fue diferenciada por sexos, funcionando regularmente escuelas normales femeninas y masculinas. En 1931, con la entrada en vigor del Plan Profesional, las escuelas normales de maestras y de maestros se unificaron; no as el programa formativo, pues se mantuvo la materia de Labores para las alumnas y los Trabajos Manuales para los alumnos. Sin embargo, se elev la preparacin y categora del magisterio siendo el mejor plan de estudios de aquellas fechas. De acuerdo con la Orden de la Direccin General de Primera Enseanza de 30 de octubre de 1931, las escuelas normales de maestras se fusionaron con las escuelas normales de maestros, constituyendo un centro nico de enseanza mixta como Escuela del Magisterio Primarioxii. El rgimen de coeducacin no siempre fue bien acogido; entre los sectores conservadores no contaba con el antecedente favorable. Las maestras, a pesar de la feminizacin de la enseanza, con su tarea no transformaron el orden vigente ni pensaban en un mundo diferente; todo lo contrario, legitimaron en las aulas el discurso sexista, reproducan y perpetuaban las desigualdades de gnero, salvo excepciones (CORTINA, 2006). En general, ese comportamiento se repeta en diferentes lugares pero fueron modelos de mujeres que aportaron otras perspectivas en las zonas donde ejercieron su profesin.

4. Conclusiones
Una de las instituciones ms importantes del sistema educativo fue la creacin de las escuelas normales para formar maestros y maestras. Desde finales del siglo XVIII se planificaba su creacin, pero hasta 1839 no se inaugur la primera escuela normal para maestros y hasta la segunda mitad de la centuria no se crearon las escuelas normales para maestras. Paralelamente a la puesta en marcha de la legislacin educativa liberal, el magisterio, que constitua el horizonte acadmico femenino con mayor consideracin y aceptacin social, experiment cambios notables pero insuficientes. La historia de las maestras an es una historia por contar. Forma parte de esa historia invisible, pues poco sabemos de la

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

139

Teresa Gonzlez Prez

prctica de su oficio. La maestra artesana que desempe su profesin entre precariedades, escasamente motivada por la sociedad decimonnica pero con mucha creatividad para sortear las dificultades materiales. La formacin de maestras responde al modelo gestado en cada momento histrico, refleja el sentir socioeducativo impulsado por el objetivo de progreso, en su dimensin social, con la intencin de mejorar la instruccin y reducir las tasas de analfabetismo. La importancia concedida a la formacin inicial de las aspirantes al oficio de maestras, dentro del sistema educativo, ha condicionado el diseo de perfiles y programas, al tiempo que ha reclamado atencin de los gestores pblicos, si bien el nivel de exigencias ha marchado paralelo a la evolucin de la sociedad y la educacin espaola. Cabe preguntarse en qu condiciones didcticas y materiales se formaron, cmo aprendieron a ensear; y la misma pregunta puede aplicarse a su posterior ejercicio profesional. La pobreza formativa qued patente en su desarrollo curricular y las continuas reformas de los planes de estudio implicaban que la preparacin no era suficiente, toda vez que las remodelaciones pretendan mejorar. Igualmente es preciso reconocer, en la amplia singladura de la historia de la formacin de maestras, la labor del equipo humano de profesoras que compona las escuelas normales, que entregaron lo mejor de su saber y se empearon en la tarea lo mejor que saban, y no slo con su prctica educativa sino en la proyeccin cultural y social. Pese al compromiso de ensear se amoldaron a las creencias culturales, no rompieron con los estereotipos sexuales y, en general, reprodujeron el orden vigente. No obstante, las primeras egresadas de las escuelas normales fueron autnticas pioneras en su lugar de procedencia, dada su iniciativa de acceder a novedosos estudios y, en cualquier caso, casi los nicos a los que una mujer poda aspirar en esa poca. En el tiempo en el que les toc vivir era inusual que una mujer mostrara alguna inquietud intelectual porque sus expectativas se cean al matrimonio. Pero an ms difcil en un entorno rural y pobre, de donde procedan buena parte de las aspirantes, que tuviera otro horizonte que no fuera el trabajo y la dedicacin incondicional a la esfera domstica. En este contexto de precariedad en lo material y de adversidad en cuanto al ambiente educativo, desconocemos las circunstancias concretas que propiciaron que hijas de campesinos y obreros humildes, como eran la inmensa mayora, emprendieran sus estudios de Magisterio. Probablemente la dimensin social del magisterio y a la vez la posibilidad de profesionalizarse para ganarse el sustento y mejorar sus condiciones de vida atrajo preferentemente a las hijas de las clases populares a estos estudios. En cambio, otras mujeres de ascendencia burguesa tambin estudiaron magisterio sin pretensiones laborales, no para profesionalizarse sino como forma de adquirir cierta cultura. Las maestras proyectaron con sus enseanzas su sabidura y abrieron otros horizontes a las nuevas generaciones. Las nias se miraban en el espejo de la escuela y observaban a otro modelo de mujer que era el que representaban sus maestras, muy distinto al de otras mujeres de su entorno. Pese a que estaban sometidas a rgidas normas morales y muy vigiladas por las autoridades, las maestras fueron el primer grupo con una identidad femenina diferente. Eran mujeres autnomas y viajaban a otros pueblos, aunque en el siglo XIX muchas lo hacan todava acompaadas para evitar la censura social. No obstante, en una buena maestra se valoraba la conducta moral, el honor, la obediencia, el pudor, la humildad, la discrecin y vestir con decoro, hasta el extremo de que la Escuela Normal Central de Maestras funcionaba bajo la supervisin de la Junta de Damas de Honor y Mrito. Tambin las maestras podan tener su propia familia, ser esposa y madre, sin escapar por ello al control social ni apartarse de los requisitos exigidos para el ejercicio profesional. Las escuelas de magisterio, con la salvedad del interregno republicano, tuvieron unas expectativas estrechas hasta avanzado el siglo XX. Sin embargo, para las mujeres fueron durante largo tiempo los templos del saber, porque las leyes restringan su acceso al mundo acadmico. Las maestras egresadas de las escuelas normales fueron las eruditas que llegaron a las reas rurales, muchas de ellas alejadas y marginadas de la geografa espaola. En un pasado no tan lejano, las maestras fueron artfices de transformaciones, ellas representaban el progreso en la Espaa rural y en las reas populares urbanas. Con saberes limitados ensearon a leer, escribir, contar, doctrina cristiana, algunos conocimientos elementales de materias bsicas, adems de coser y bordar a las nias. Transmitan contenidos pero tambin mensajes morales e ideolgicos, adoctrinaban en valores y consignas, incluso acuando modelos de nios y nias, segn mandaban los cnones de la poca. Renovacin o tradicin, dependiendo del momento. La progresiva feminizacin del magisterio se observa claramente al analizar los datos cuantitativos en las diferentes fechas. Adems de la diferencia cuantitativa, en la profesin tambin es preciso considerar las diferencias curriculares (por ejemplo, Pedagoga para las maestras y Labores/Enseanzas del Hogar) as como los sesgos de gnero. La presencia de las maestras lo ha sido siempre en mayor porcentaje en los niveles ms bajos del sistema educativo. La modernizacin de

140 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133-143

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas

Espaa se ha reflejado en el descenso de los ndices de analfabetismo y el aumento de la escolarizacin de nias y nios, hecho en relacin directa con la expansin del magisterio y la formacin de las mujeres. La consolidacin de la profesin de maestras junto a los cambios normativos impuls el acceso de las mujeres a otros estudios y profesiones.

Referencias bibliogrficas
VILA FERNNDEZ, ALEJANDRO (2007). La formacin de los maestros. En Espaa: una deuda histrica. Historia de la educacin, 26, 327340. BALLARN DOMINGO, PILAR (2001). La educacin de las mujeres en la Espaa contempornea. Madrid: Sntesis. BALLARN DOMINGO, PILAR (2000). La construccin de un modelo educativo de utilidad domstica. En DUBY, G. & PERROT, M. (Dir.). Historia de las Mujeres, Vol. IV. Madrid: Taurus, 626627. CAPEL MARTNEZ, ROSA M (1986). El trabajo y la educacin de la mujer en Espaa. Madrid: Ministerio de la Cultura, Instituto de la Mujer. CEREZO MANRIQUE, JUAN FRANCISCO (1990). La formacin de maestros en Castilla y Len. Salamanca: Diputacin de Salamanca. COLMENAR ORZAES, CARMEN (1994). Espacio y tiempo escolar en la Escuela Normal Central de Madrid durante la poca de la Restauracin. Revista Complutense de Educacin, vol. 5 (2), 4758. COLMENAR ORZAES, CARMEN (1989). Proyeccin social de la Escuela Normal Central de Maestras de Madrid durante la Restauracin espaola. Revista Interuniversitaria de Historia de la Educacin, 8, 261274. COLMENAR ORZAES, CARMEN (1983). Contribucin de la Escuela Normal Central de Maestros a la educacin femenina en el siglo XIX (18581887). Revista Interuniversitaria de Historia de la Educacin, 2, 105112. CORTINA, REGINA & SAN ROMN, SONSOLES (2006).Women and Teaching. Global Perspectivas on the Feminization of a Profesin. New York: Palgrave Macmillan. ESCOLANO BENITO, AGUSTN (2002). La educacin en la Espaa contempornea: polticas educativas, escolarizacin y cultura pedaggicas. Madrid: Biblioteca Nueva. DOMNGUEZ CABREJAS, ROSA M (1991). Perspectiva histrica de los planes de estudio de Magisterio. Revista Interuniversitaria de Formacin del Profesorado, n 12,1732. FLECHA GARCA, CONSUELO (1997). Las mujeres en la legislacin educativa espaola. Enseanza Primaria y Normal en los siglos XVIII y XIX. Sevilla: Gihus. FLECHA GARCA, CONSUELO (1996). Las primeras universitarias en Espaa. Barcelona: Narcea. GONZLEZ PREZ, TERESA (1997). La formacin de maestras en la poltica educativa decimonnica. El caso de Canarias. Bordn, 49 (3), 317326. GONZLEZ PREZ, TERESA (1994). Trazos histricos sobre la formacin de maestros. Revista Interuniversitaria de Formacin del Profesorado, n 21,175198. HUERTA MARTNEZ, ANGEL (1996). La formacin de maestros de primeras letras en Sevilla y Cuba durante el siglo XIX. Sevilla: ICE/Universidad de Sevilla. MELCON BELTRN, JULIA (1992). La formacin del profesorado en Espaa (18371914). Madrid: Centro de Publicaciones del Ministerio de Educacin y Ciencia. MORENO, JUAN MANUEL (1966). La formacin de los maestros para la enseanza primaria. Bordn, n 138139, 85107. NAVARRO GARCA, CLOTILDE (2002). La figura del maestro en la Escuela de la Repblica. Revista Interuniversitaria de Formacin del Profesorado, 43, 2137. NOGUERA ARRN, JUANA (1984). La Escuela Normal de Tarragona, 18431931. Barcelona: Universidad de Barcelona.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

141

Teresa Gonzlez Prez

NAVARRO JURADO, ALFONSO (1989). Creacin de la escuela normal de maestras de Burgos. Bordn 41, n 1, 177190. RUIZ BERRIO, JULIO (1980). Estudio histrico de las instituciones para la formacin de profesores. Granada: Actas del VII Congreso Nacional de Pedagoga: La investigacin pedaggica y la formacin de profesores, 1, 99120. SAN ROMN GAGO, SONSOLES (1997). Las primeras maestras. Barcelona: Ariel. VEGA GIL, LEONCIO (1988). Las escuelas normales de Castilla y Len (18381900). Salamanca: Amaru. VEGA GIL, LEONCIO (1986). La eficacia interna de la formacin de maestras en el siglo XIX. Revista Interuniversitaria Historia de la Educacin, Salamanca, n 5, 2 35250. VIAO FRAGO, ANTONIO (2004). Escuela para todos. Educacin y Modernidad en la Espaa del siglo XX. Madrid: Marcial Pons.
i

Boletn Oficial del Ministerio de Comercio, Instruccin y Obras Pblicas. Parte no oficial. Resea de la Instruccin pblica en Espaa desde 1834, Tomo II, artculo II. En referencia a los maestros y maestras recoga lo siguiente: en 1835 haba ms de las dos terceras partes de maestros sin ttulo: en el da son 5.937 los

maestros que carecen de l, y 6.847 los que lo tienen; habiendo adems 1.241 maestras con ttulo, y 1.264 sin l
ii

La Revista de Instruccin Pblica (Madrid, 1858: 27) bajo el rtulo El Profesorado public lo siguiente: "La instruccin primaria, cuyos elementos fundamentales deben ser la moralidad y la religin, no existe en muchos miles de pueblos; en los que existe, es en la mayor parte de ellos slo para nios, como si las mujeres no formasen parte de la sociedad. El citado texto evidencia una de las desigualdades educativas entre hombres y mujeres. La ley Moyano fue la primera ley de instruccin pblica,que regul el sistema educativo espaol y a la vez estableci las diferencias curriculares entre ambos sexos. Una diferencia que se mantuvo vigente hasta la promulgacin y aplicacin de la Ley General de Educacin (1970). En el articulado de la enseanza primaria quedaba muy bien especificado: En las enseanzas elemental y superior de las nias se omitirn los estudios de que tratan el prrafo sexo del artculo 2 Breves nociones de Agricultura, Industria y Comercio y los prrafos primero y tercero del artculo 4 Principios de Geometra, de Dibujo lineal y de Agrimensura y Nociones generales de Fsica y de Historia Natural, reemplazndose con: Primero. Labores propias del sexo; Segundo. Elementos de Dibujo aplicado a las mismas labores; Tercero. Ligeras nociones de Higiene domstica. El Decreto de 17 de marzo de 1882 asignaba a las maestras la enseanza de prvulos. Por Decreto de 13 de agosto de 1882 se reform el currculum y se incorporaron materias de carcter enciclopdico. Coleccin Legislativa de Reales Ordenes de Instruccin Pblica. Tomo I (1896: 735 y 739). Madrid. Imprenta de Joaqun Baquedano. Ley de Instruccin Pblica de 1857. Captulo II. De las Escuelas Normales de primera enseanza. "Art. 114. El

iii

iv

vi

Gobierno procurar que se establezcan Escuelas Normales de Maestras para mejorar la instruccin de las nias".
vii

Exposicin del ministro Germn Gamazo a la Reina Regente del Real Decreto de 23 de septiembre de 1898, referido a la reforma de las Escuelas Normales. Real Decreto de 23 de septiembre de 1898. Artculo 19. Organizacin, distribucin y administracin de las Escuelas Normales. Las materias fijadas en el plan de estudios para los maestros eran las siguientes: Doctrina cristiana e historia sagrada Lengua castellana Geografa e historia Aritmtica y geometra Dibujo y caligrafa Fsica, qumica, historia natural y trabajos manuales Fisiologa, higiene y gimnasia Pedagoga y prctica de la enseanza con nociones de legislacin escolar. Las asignaturas mencionadas tendrn en las escuelas elementales de maestras menor extensin que en la de maestros, y adems se diferenciaran en lo que a continuacin se indica: El dibujo se aplicar principalmente al corte de prendas usuales, y los estudios de Ciencias fsicas y naturales, a la higiene Con las lecciones de Historia Natural se explicaran los conocimientos ms importantes de fisiologa humana El trabajo manual consistir en labores de papel, cartn y tela, y en quehaceres domsticos que se pueden aplicar fcilmente en la Escuela Normal La Pedagoga comprender necesariamente algunas nociones sobre la enseanza especial de prvulos, y las lecciones de Legislacin escolar llevaran un complemento de economa domstica Las lecciones de labores y de corte sern de costura, hechura y compostura de prendas ms usuales. El ministro Alejandro Pidal y Mon reconoca ese carcter especfico de las instituciones femeninas por excelencia y as lo recoga en el Real Decreto de 3 de septiembre de 1884 referido a la reorganizacin la Escuela Normal Central de Maestras, cuyo texto transcribimos: "Laudable es el propsito de procurar

viii

ix

principalmente por los medios de la educacin la mejora de la condicin social de la mujer; pero para llevar a

142 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133-143

Aprender a ensear en el siglo XIX. La formacin inicial de las maestras espaolas

cabo tan notable pensamiento, es mucho ms prctico y sensato fomentar las Escuelas y fundaciones creadas para estas enseanzas especiales, distintas del Magisterio, que desorganizar las Escuelas Normales convirtindolas en Centros donde se lleven a cabo todos los ensayos y tanteos encaminados a abrir para la mujer diferentes carreras profesionales, distrayendo de esta suerte a la Escuela Normal del objeto principal a que responde su creacin, y que reduce a la formacin de un buen Magisterio de primera enseanza".
xi

En la Gaceta de Madrid de 9 de marzo de 1910, n 68, Tomo I, se public dicha autorizacin. Ilmo. Sr.: La

R.O. de 11 de junio de 1888 dispone que las mujeres sean admitidas a los estudios dependientes de este Ministerio como alumnas de enseanza privada, y que cuando alguna solicita matrcula oficial se consulte a la Superioridad para que sta resuelva segn el caso y las circunstancias de la interesada. Considerando que estas consultas, si no implican limitacin de derecho, por lo menos producen dificultades y retrasos de tramitacin, cuando el sentido general de la legislacin de Instruccin Pblica es no hacer distincin por razn de sexos, autorizando por igual la matrcula de alumnos y alumnas. S.M. el Rey (q. D. g.) se ha servido disponer que se considere derogada la citada R.O. de 1888 y que por los Jefes de los Establecimientos docentes se concedan, sin necesidad de consultar a la Superioridad, las inscripciones de matrcula en enseanza oficial o no oficial solicitadas por las mujeres siempre que se ajusten a las condiciones y reglas establecidas para cada clase y grupo de estudios. De R.O. lo digo a V.I. para su conocimiento y dems efectos. Dios guarde a V.I. muchos aos. Madrid, 8 de marzo de 1910. ROMANONES.
xii

Orden de la Direccin General de Primera Enseanza de 30 de octubre de 1931, para formar la Normal del Magisterio Primario.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 133143

143

REFERENCIA: Rubalcaba Prez, Carmen (2010). Primero pasos de la Escuela Normal Femenina de Santander, 1915. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Primeros pasos de la Escuela Normal Femenina de Santander, 1915


CarmenRUBALCABAPREZ
Correspondencia: CarmenRubalcabaPrez Correoelectrnico carmen.rubalcaba@gestion.unican.es Telfono: +34942201136 Direccinpostal: Despachon113 reaCC.yTcnicasHistoriogrficas EdificioInterfacultativo UniversidaddeCantabria AvenidaLosCastros,s/n E39005Santander (Cantabria) Recibido: 24deenerode2010 Aceptado:18deoctubrede2010

RESUMEN
La Escuela Normal de Magisterio de Santander (1844) ha sido uno de los centros educativos ms influyentes de Santanderyeselmsantiguodelosqueestnactualmente integradosenlaUniversidaddeCantabria.Lafundacin,en el ao 1915,de la Escuela Normal Femenina permiti a las mujeresalcanzarunapreparacinmayordelaquehastaese momento podan aspirar. A pesar de su importancia en la vida escolar y cultural de la regin, es muy poco lo que se conoce de la historia de este centro docente. Este trabajo tienecomofinalidadaportardatossobrelafundacindela Escuelaen1915:profesorado,alumnosyactividades.

PALABRAS CLAVE: Docente de escuela primaria, Escuela, Mujerestudiante,InstitucionesdeEnseanza,Educacinde lamujer.

First Steps of the Escuela Normal Femenina (Female School of Education) in Santander, 1915
ABSTRACT
TheOrdinarySchoolofEducationofSantander(1844)hasbeenoneofthemostinfluencingeducational institutions in Santander (Spain) and is the oldest one currently within the Universidad de Cantabria (Spain).ThisSchoolwasfoundedin1915andallowedwomentoachieveabettereducationthanthat theycouldgainuntilthen.Despiteitsimportanceintheeducationalandculturallifeoftheregion,we knowverylittleaboutitshistory.InthisarticleweanalysethehistoryofthefoundationofthisSchoolin 1915,focusingonitsteachers,studentsandactivities.

KEY WORDS: Primary school teachers, Schools, Female students, Educational institutions, Womens'
education.

1. Introduccin y antecedentes
En 1986, Antonio Molero Pintado afirmaba que la bibliografa sobre los centros de formacin de maestros en Espaa era ciertamente escasa y que no se dispona de un tratado completo que estudiase pormenorizadamente la vida de estas Instituciones que llenaron con pleno derecho buena parte de las
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (1), 145153

145

Carmen Rubalcaba Prez

preocupaciones educadoras espaolas de los siglos XIX y XX (MOLERO PINTADO, 1986: 15). Ms de
veinte aos despus la realidad de esa aseveracin contina, desgraciadamente, vigente. Entre esos centros cuya historia queda an por estudiar se encuentra la Escuela Normal de Magisterio de Santander (1844), que ha sido a lo largo de su devenir uno de los centros educativos ms influyentes de Santander y es el ms antiguo de los que estn actualmente integrados en la Universidad de Cantabria. La fundacin, en el ao 1915, de la Escuela Normal Femenina permiti a las mujeres alcanzar una preparacin mayor de la que hasta ese momento podan aspirar, pues el grado mximo de estudios impartidos en la regin eran los de Secundaria y la posibilidad de estudiar fuera de ella se cerraba a las mujeres, a quienes normalmente no se les permita salir fuera de su lugar de origen para hacerlo. Por otra parte, los estudios de Magisterio se contemplaban en esta poca como un medio de proporcionar a las mujeres que deseaban adquirirla una cultura superior a la que se da en las escuelas de primera enseanza (REAL DECRETO, 1914, art. 1). A pesar de su importancia en la vida escolar y cultural de la regin, es muy poco lo que se conoce de la historia de esta institucin, como sucede, por otra parte, con un gran nmero de escuelas normales del resto del pas. A mediados de la dcada de los aos noventa, coincidiendo con el ciento cincuenta aniversario del establecimiento de escuelas normales en las principales capitales de provincia espaolas, surgieron diversas publicaciones sobre las mismas. No obstante, no resulta posible en muchas ocasiones dibujar un retrato detallado que contribuya a ampliar la imagen sobre la formacin del magisterio espaol en el mundo contemporneo. Los sucesivos cambios de sede de las escuelas, la incuria en la que se encuentran muchos archivos universitarios, la destruccin de documentacin debido a accidentes o a expurgos incontrolados, o los avatares sufridos durante la Guerra Civil por los locales que albergaban las escuelas, entre otros factores, han coadyuvado a la escasez de trabajos, y no resulta extrao que la alusin a la falta de fuentes sea una constante en las distintas publicaciones sobre el tema.

2. Antecedentes histricos: la Escuela Normal masculina (18441915)


La preparacin especfica de los aspirantes al ejercicio del Magisterio comenz a principios del siglo XIX, aunque en Espaa no se consolid hasta 1839, fecha de la creacin del primer centro dedicado a la formacin de maestros: la Escuela Normal Central del Magisterio de Instruccin Primaria con sede en Madrid. En ella se formaron los primeros maestros encargados de organizar centros similares en cada provincia. En los aos siguientes las escuelas normales se extendieron por todas las provincias. En Santander ese momento inaugural en la formacin del magisterio se produjo cinco aos ms tarde, cuando el 1 de diciembre de 1844 abri sus puertas la Escuela de Magisterio de Santander, bajo la direccin de don Jos Arce Bodega (MADARIAGA & VALBUENA, 1971: 31). El Instituto Cntabro se haba creado poco antes y el Real Instituto Militar Pestalozziano, nacido en el seno de la Sociedad Cantbrica, haba desaparecido. Era la undcima escuela normal que se abra en Espaa y qued instalada en los locales del antiguo convento de Santa Clara, donde se encontraban tambin el Instituto Cntabro o Cantbrico. A finales de la dcada de los cincuenta se traslad a la plaza de las Escuelas, n 6, donde permaneci hasta 1900. La Escuela Prctica, el equivalente a lo que luego se conocera como Escuela Aneja, estuvo alojada en el mismo lugar. Se desconoce dnde estuvo el Seminario de Internos que, bajo la inmediata inspeccin de la Comisin Provincial de Instruccin Primaria y dirigido por Valentn Pintado, acoga tanto a los aspirantes a maestros como a los de primera enseanza que asistiesen a la Escuela Prctica e incluso a los alumnos de segunda enseanza que la recibiesen en el Instituto Cntabro. El 25 de octubre de 1844 se public el reglamento que estableca, a lo largo de ocho captulos, las normas que haban de seguirse para su funcionamiento. Podran asistir al Seminario los aspirantes a maestros que deseen

recibir la enseanza en la Escuela Normal, los jvenes que aspiren a instruirse en la escuela prctica de la misma para recibir la primera enseanza y los alumnos de segunda enseanza que hayan de recibirla en el Instituto Cntabro (GUTIRREZ GUTIRREZ, 1996: 267).
En la Escuela Normal de Maestros de Santander se otorgaba el ttulo de maestro elemental en un ao, y en dos aos el de Escuelas Superiores (VALBUENA & MADARIAGA, 1975: 243). En los dos primeros aos de funcionamiento de la nueva institucin docente se formaron veintitrs maestros. El nmero de alumnos matriculados no debi de ser elevado, puesto que los ingresos de tasas no cubran el presupuesto de gastos (ALEGRA AGUADO, 1985).

146 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

Primeros pasos de la Escuela Normal Femenina de Santander, 1915

En 1901, por Real Decreto de 17 de agosto, se refundieron en los institutos los estudios elementales de maestros establecindolos en todos ellos, dejando slo las escuelas elementales y superiores de maestras y las superiores de maestros incorporadas tambin a los institutos, pero conservando su unidad orgnica (Real Decreto, 1901, Cap. III: De las escuelas de maestros y maestras). Esto provoc la desaparicin de la Escuela Normal de Magisterio de Santander, cuyos estudios, segn indicaba la legislacin vigente, se incorporaron al Instituto, que pas a llamarse Instituto General y Tcnico de Santander y que adquiri una nueva estructura, ya que albergaba las enseanzas de Bachillerato, Magisterio de Enseanza Primaria y Estudios Elementales de Comercio y de Agricultura, enseanzas agrupadas con el nombre comn de Estudios Generales (MADARIAGA & VALBUENA, 1971: 38).

3. Establecimiento de la Escuela Normal Femenina, 1915


La incorporacin de las enseanzas normalistas a los institutos generales y tcnicos levant fuertes protestas desde las revistas del magisterio y desde los sectores sociales dedicados a la enseanza, ya que la preparacin de los docentes primarios, al quedar diluida dentro del plan de enseanzas medias, perda su especificidad pedaggicoprofesional. La respuesta a estas crticas se dio desde mbitos oficiales con la reforma de 1914, a travs del Real Decreto de 30 de agosto sobre reorganizacin de las escuelas normales, promulgado por un ministro liberal e institucionista, Francisco Bergamn Garca (POZO ANDRS, SEGURA REDONDO & DIEZ TORRE, 1986: 166167). Este nuevo plan proporcionaba a las escuelas normales una organizacin algo ms adecuada para la formacin de un profesorado primario competente. Las nuevas escuelas normales deban constar, adems de las ctedras correspondientes, de una escuela prctica graduada a cargo de un regente y bajo la autoridad e inspeccin del director o de la directora de la Normal, que deba servir de modelo para las dems escuelas de primera enseanza, tanto pblicas como privadas (REAL DECRETO, 1914, art. 8, 9 y 10) y una biblioteca y un museo pedaggico, adems del material de enseanza necesario para los estudios (Real Decreto, 1914, art. 11). Para poder matricularse en una Escuela Normal era necesario haber cumplido los quince aos, no padecer enfermedad contagiosa y ser aprobado en el examen de ingreso, que consista en un ejercicio oral y otro escrito sobre las materias que constituan la enseanza de las escuelas primarias. Las aspirantes que deseaban ingresar en las escuelas normales de maestras deban realizar, adems, un ejercicio de labores (REAL DECRETO, 1914, arts. 13, 14 y 25). Los estudios se desarrollaban a lo largo de cuatro cursos. Al terminar el ltimo y al solicitar la admisin a los ejercicios de revlida, los alumnos deban presentar en la secretara de la Escuela Normal una Memoria con el resultado de sus observaciones durante el tiempo de prcticas (REAL DECRETO, 1914, arts. 25, 26 y 27). Las enseanzas impartidas se complementaban con exposiciones, conferencias, excursiones y otros medios educativos que deba organizar la Junta de profesores. El restablecimiento de las escuelas normales desaparecidas vino acompaado en el caso de Santander por la creacin de una Escuela Normal Femenina, que daba satisfaccin a un deseo latente desde el ltimo tercio del siglo diecinueve (ALEGRA AGUADO, 1985). La Escuela Normal de Maestras de Santander se cre por Real Decreto de 11 de junio de 1915, iniciando su singladura en la finca y chalet de tres plantas, propiedad de la Diputacin Provincial, situados al final de la calle Magallanes, finca de Numancia, donde ya se encontraban funcionando las Escuelas del Oeste inauguradas por la Reina Regente Doa Cristina en 1900 y donde permanecieron hasta la fecha de 1965 en que se inaugur el edificio de la calle Cisneros. La idea de su creacin parti del doctor Madrazo y fue su promotor entre los medios polticos Luis de Hoyos Sainz, catedrtico de la Escuela Superior de Magisterio de Madrid y originario de Santander (GMEZ OCHOA & HOYO APARICIO, 1987: 232). Esta Escuela Normal de Maestras de Santander, que desde 1945 se denomin Escuela de Magisterio, dependi de la Universidad de Valladolid hasta su integracin en la de Santander, en 1972. El primer claustro de la Escuela Normal Femenina estuvo constituido por tres profesoras provenientes de la Escuela de Estudios Superiores del Magisterio de Madrid, donde haban formado parte de la cuarta promocin de la Escuela (19121915), establecida en 1909. De ellas, Margarita Cutanda Salazar y Carmen de la Vega Montenegro haban sido la primera y la tercera respectivamente de la Seccin de Letras, y Margarita Comas Camps la primera de la de Ciencias (MOLERO PINTADO & POZO ANDRS, 1989: 204). Las tres fueron nombradas para sus cargos por R. O. de 6 de julio de 1915, en virtud de concurso entre maestras normales procedentes de la Escuela de Estudios Superiores del Magisterio. Al no existir Escuela Normal en Santander, el director del Instituto General y Tcnico de la

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

147

Carmen Rubalcaba Prez

ciudad fue el encargado de dar posesin de sus cargos a las profesoras y personal subalterno de la recin creada Escuela Normal (Libro de posesiones de la Escuela Normal Femenina). El primero de septiembre de 1915 Margarita Cutanda Salazar tom posesin como profesora numeraria de Pedagoga y su Historia y Rudimentos de Derecho y Legislacin escolar, Margarita Comas Camps como profesora de Fsica, Qumica e Historia Natural y, por ltimo, Carmen de la Vega Montenegro de Gramtica y Literatura castellana con ejercicios de lectura. Con posterioridad se integraron como profesoras otras normalistas que haban estudiado tambin en la Escuela de Estudios Superiores del Magisterio, altamente influida por la Institucin Libre de Enseanza. Entre ellas y aunque pertenecientes a diferentes pocas cabe citar: Juana Fernndez Alonso, Juana Sicilia Martn (Segunda promocin, 19101913); Emilia Merino Martn, Josefa Trivio Mrida, Adela Medrano Laguna (Cuarta promocin, 19121915); M Carmen Alonso Garca (Sptima promocin, 1915 1918); Ceferina Gmez Cosso, Julia Garca Fernndez Castan (Octava promocin, 19161919); Primitiva Amparo Otero Lucio (Novena promocin, 19171920); Mara Milln del Val (Duodcima promocin, 19201924) (MOLERO PINTADO & POZO ANDRS, 1989: 201214). Algunas de las profesoras de la Escuela Normal desarrollaron la mayor parte de su actividad docente en la Escuela Normal de Santander y participaron, como Margarita Comas, Carmen de la Vega o Adela Medrano, de manera repetida en actividades cientficas y culturales desarrolladas en la ciudad; otras la prosiguieron en otras instituciones, como es el caso de Julia Garca Fernndez Castan que dirigi durante un largo periodo de tiempo la Escuela Normal de Maestras Central del Reino (ESCUELA NORMAL DE MAESTRAS CENTRAL DEL REINO, 1958). En el transcurso de la primera sesin de claustro de la nueva institucin normalista se acord que la primera en ser nombrada para el cargo, Margarita Cutanda Salazar, se encargase de la direccin del centro y la segunda, Margarita Comas Camps, de la secretara. De igual manera, se decidi que para dar cumplimiento a la R. O. de 26 de agosto del mismo ao que autorizaba a la Escuela a verificar exmenes de ingreso y enseanza no oficial durante el mes de septiembre se abriese desde ese momento, 1 de septiembre, la fecha de la matrcula correspondiente (LIBRO DE ACTAS DE CLAUSTRO, 1 de septiembre de 1915). En sesin de claustro de 9 de septiembre de 1915 se resolvi que los mencionados exmenes de ingreso y de enseanza no oficial se iniciasen el da 16 y se estableci el cuadro de tribunales correspondiente (LIBRO DE ACTAS DE CLAUSTRO, 9 de septiembre de 1915). Los conocimientos de las jvenes aspirantes a normalistas no deban ser muy amplios ya que, en una de las primeras reuniones que mantuvo el claustro de profesoras para preparar los exmenes de ingreso, se acord que se tuviese ese ao ms benevolencia que en lo sucesivo atendidas las circunstancias en que se hallan las seoritas aspirantes. Se recomend tener ms en cuenta la manera

de ser intelectual y moral de las alumnas que el caudal de conocimientos ms o menos slidos que puedan poseer. Las carencias culturales de las alumnas deban de ser grandes, sobre todo a los ojos de
las profesoras provenientes todas, en ese momento, de la Escuela Superior del Magisterio, vistas las materias en las que se hacia ms hincapi en las enseanzas iniciales: lectura y escritura, las cuatro reglas, costura y doctrina cristiana. A los tribunales de alumnas no oficiales sin embargo se les comunic que seran en lo posible todo lo rgidos que deban ser despus (LIBRO DE ACTAS DE CLAUSTRO, 20 de septiembre de 1915). A lo largo del mes de octubre las profesoras de la Escuela Normal se reunieron en diversas ocasiones con la finalidad de establecer los horarios, programas y orientacin de las clases. Se decidi que stas se desarrollasen en dos sesiones, maana y tarde, ya que la sesin nica, cinco horas por la maana, poda ser nociva para la salud de las alumnas (LIBRO DE ACTAS DE CLAUSTRO, 6 de octubre de 1915). Se estableci tambin que el tiempo mximo que cada alumna tuviera que dedicar en su casa a los trabajos de clase no superase la hora y media o dos horas y que las vacaciones fuesen para ellas verdaderamente de descanso (LIBRO DE ACTAS DE CLAUSTRO, 11 de octubre de 1915). Las clases dieron comienzo el da 25 de octubre en medio de una gran penuria material, ya que ni siquiera se contaba con el material indispensable. As y todo se decidi que para no prolongar ms la espera perjudicial para todos en la que la Escuela se encontraba, las clases se diesen como fuera posible conformndose cada profesora con lo que tenga (LIBRO DE ACTAS DE CLAUSTRO, 19 de octubre de 1915). Lo reducido del primer grupo de alumnas de la Escuela Normal de Maestras de Santander facilit el conocimiento mutuo entre profesoras y alumnas, y as lo testimonia el inters personal que el profesorado mostraba hacia la situacin de distintas alumnas y que las actas de sesiones de claustro reflejan. Por ejemplo, el da 6 de noviembre de 1915 aparece en el Libro de actas de claustro la siguiente nota: (...) se habla de una alumna que est en situacin angustiosa, condolindose todos de

148 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

Primeros pasos de la Escuela Normal Femenina de Santander, 1915

no poderle ayudar por ahora; se trata de las alumnas que tienen pendientes las asignaturas del curso anterior lo cual hace que por exceso de trabajo cumplan mal, es un defecto de la ley que se tratar de remediar en parte modificando el horario, despus de Navidad ya que ahora no es prudente un cambio
(LIBRO DE ACTAS DE CLAUSTRO, 6 de noviembre de 1915). Paulatinamente las alumnas fueron aumentando su caudal de conocimientos y esta evolucin ha quedado plasmada en las expresiones de las profesoras que integraban el claustro y que certificaban sus progresos: [Los profesores de la Escuela Normal] pasan a cambiar impresiones sobre las alumnas. En general, van mejorando pero queda mucho que hacer; [Los profesores de la Escuela Normal] pasan a

cambiar impresiones sobre las alumnas. Se conviene que han mejorado en general desde la ltima vez que hablamos de ellas, pero as y todo queda mucho que hacer; Se pasa a tratar de las alumnas quedando [las profesoras] bien impresionadas, pues van mejorando (LIBRO DE ACTAS DE CLAUSTRO, 29 de
febrero y 29 de abril de 1916, y 21 de enero de 1917). Se haba establecido que, al menos, una vez cada tres meses se reunieran las profesoras y alumnas en la Escuela para conversar, celebrar conferencias y juegos. Las profesoras disponan de las tardes de los sbados para realizar sus trabajos prcticos, juegos y para alguna ocupacin de carcter ameno y realizada como en familia (LIBRO DE ACTAS DE CLAUSTRO, 25 de enero de 1916).

4. Profesorado
Las profesoras que animaron los primeros pasos de la Escuela Normal Femenina del Magisterio de Santander procedan de la Escuela Superior de Magisterio de Madrid y, dos de ellas, Margarita Comas Camps y Margarita Cutanda Salazar, haban sido becadas por la Junta de Ampliacin de Estudios para realizar investigaciones y estancias en el extranjero. Margarita Cutanda Salazar era natural de Toledo, donde haba nacido el da 2 de septiembre de 1879 (Expedientes de profesorado). Estudi en la Escuela Superior del Magisterio de Madrid, donde fue la primera de la Seccin de Letras y de la lista general de clasificaciones de su cuarta promocin (1912 1915). Por R. O. de 6 de julio de 1915 y en virtud de concurso entre maestras normales procedentes de la Escuela Superior del Magisterio, fue nombrada para el cargo de profesora numeraria de Pedagoga y su Historia y Rudimentos de Derecho y Legislacin escolar y tom posesin el 1 de septiembre de 1915. En la sesin de claustro celebrada en esta misma fecha se decidi que se encargase de la direccin del centro, lo que hizo durante varios aos, constituyndose as en la primera directora de la Escuela Normal Femenina de Santander (LIBRO DE ACTAS DE CLAUSTRO, 1 de septiembre de 1915). En 1927 Margarita Cutanda envi una instancia a la Junta de Ampliacin de Estudios solicitando una beca y a travs de la peticin que realiz y de los documentos que adjunt se puede obtener ms informacin sobre su trayectoria profesional. La profesora Cutanda envi su solicitud de pensin a la Junta ya que deseaba estudiar cuestiones relacionadas con aspectos ambientales de la educacin como la familia, la religin, la poca, el sexo, etc. puesto que crea que la educacin dependa no slo de lo esencial del hombre sino tambin de lo circunstancial. Le interesaba especialmente el planteamiento que sobre coeducacin y orientacin social tenan las instituciones educativas extranjeras y deseaba ampliar estudios en Francia especialmente en LEcole des Roches, en Blgica Centros de Orientacin social y Residencia de Bruselas y Lieja y en las Landerziehungsheim alemanas de Munich (MARN ECED, 1991, 103104). Margarita Cutanda haba sido y todava lo era en 1927 directora de las Escuelas Solvay de la compaa belga del mismo nombre y, por ello, deba de conocer las corrientes pedaggicas vigentes en Blgica, uno de los pases a los que quera acudir a perfeccionarse. Como mritos que acompaaban su solicitud de pensin present su trabajo como colaboradora y directora del Comedor de la Junta de Proteccin a la Infancia y de la Junta de Beneficencia, sus estudios en Alemania durante tres aos, principalmente en la ciudad de Hamburgo, y sus visitas a centros educativos en Pars, Berln, Colonia y Berna. Esta primera peticin de beca le fue denegada y volvi a solicitarla en 1928, ao en que por R. O. de 7 de agosto le fue concedida. La duracin de la pensin era de tres meses, prorrogables a diez y los pases que le concedan visitar eran aquellos que haba solicitado: Francia, Blgica, Alemania y Suiza. Posteriormente se le permiti que permaneciese tambin algn tiempo en Italia. Le fue concedida primero la rehabilitacin y despus la prrroga, por lo que Margarita Cutanda disfrut de una larga beca, desde octubre de 1928 a julio de 1929 (MARN ECED, 1991: 103104). Durante su viaje por Francia, Blgica, Alemania y Suiza en 1929 mantuvo correspondencia con la Escuela Normal de Santander donde era profesora, y a travs de estas cartas se pueden conocer algunos de los problemas que vivan los pensionados, como las dificultades econmicas y la incertidumbre sobre la renovacin de las pensiones o becas.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

149

Carmen Rubalcaba Prez

El dos de febrero de 1929 escribe Margarita Cutanda a la Escuela Normal de Magisterio de Santander que no sabe nada sobre la resolucin de su peticin de rehabilitacin de beca que haba solicitado, por lo que solicita a la Escuela que le comunique cualquier dato sobre el asunto. En carta con fecha del 14 de febrero de 1929 informa a la Directora de la Escuela Normal que ya le ha sido rehabilitada la pensin de que vena disfrutando desde haca siete meses y gracias a la correspondencia epistolar se puede seguir el recorrido realizado por la profesora Cutanda a travs de Europa: Bruselas, Leipzig, Ginebra (Expedientes de profesorado). Sobre su labor como becada no han quedado notas de trabajo ni correspondencia con la Junta. A pesar de ello, Teresa Marn Eced opina que debi cumplir muy bien con sus deberes en el extranjero ya que, de no ser as, no se le habra concedido prrroga (MARN ECED, 1991: 104). Otra profesora de la Escuela Normal de Santander procedente de la Escuela Superior del Magisterio de Madrid y que fue a su vez pensionada por la Junta para Ampliacin de Estudios fue Margarita Comas Camps. Natural de Alayor (Menorca), donde naci en 1897, Maestra de primera enseanza normal, seccin de Ciencias, termin su carrera en la Escuela Superior del Magisterio en 1915 con el nmero uno en la Seccin de Ciencias de la cuarta promocin. Senta gran inters por los estudios pedaggicos, especialmente por la didctica de las ciencias naturales, lo que la llev a realizar distintas visitas a centros docentes extranjeros. En septiembre del ao 1911 y durante cuatro meses, visit parte de Francia, Blgica y Suiza (Expedientes de profesorado). Durante el curso 19111912, cuando todava era estudiante, fue repetidora lo que hoy en da se conoce como lectora de espaol en la ciudad francesa de Albi, donde obtuvo el ttulo de lengua francesa, Brevet, para la enseanza primaria, gracias a una ayuda que le haba concedido la Junta para Ampliacin de Estudios (Expedientes de profesorado). Sobre esta estancia en Albi y su labor all, escribe Teresa Marn Eced (1991: 93): Haba cumplido con escrupulosa conciencia su deber, haba demostrado cualidades

pedaggicas muy relevantes, tanto desde el punto de vista cultural como desde el punto de vista metodolgico y disciplinar y se haba ganado fcilmente a las alumnas y a toda la Escuela Normal con su simpata, su carcter, su franqueza y la rectitud de su conducta.
De vuelta a Espaa, en 1915, fue nombrada profesora numeraria de Fsica, Qumica e Historia Natural de la Escuela Normal de Maestras de Santander propuesta por el Claustro de profesores de la Escuela de Estudios Superiores del Magisterio y Secretaria del mismo centro por acuerdo del claustro de uno de septiembre del mismo ao. En el curso 1919 a 1920, visit durante un mes varios centros de enseanza en Pars (Expedientes de profesorado). Su expediente cuajado de sobresalientes y matrculas de honor ttulo de Bachiller en Ciencias con Sobresaliente y Premio Extraordinario, el de Bachiller en Artes con Sobresaliente, el de Maestra de Primera Enseanza Superior con Sobresaliente, de Profesora Normal en la Seccin de Ciencias con el nmero uno, nmero uno en las oposiciones de ingreso en la Escuela de Estudios Superiores del Magisterio, su ttulo de lengua francesa, su inquietud profesional que le haba llevado a realizar numerosos cursos Curso del Museo Pedaggico con Edmundo Lozano, cursillo de Mineraloga prctica organizado por la Junta de Ampliacin de Estudios bajo la direccin del Dr. Calafat, prcticas en el Laboratorio de Psicologa Marina de Baleares bajo la direccin del Dr. Fuste, los informes positivos de personalidades como Carracido, Casares y Hermenegildo Giner de los Ros, relacionadas con la Junta de Ampliacin de Estudios, llevaron a sta a concederle, en septiembre de 1920, una beca de nueve meses en Inglaterra. All, durante el curso 1921 a 1922, estudi Fsica y Qumica, hizo prcticas en el Bedford College, asisti a cursos de Metodologa de las Ciencias en el London Training College y visit las principales escuelas londinenses de enseanza primaria, secundaria y de magisterio, estudiando la didctica empleada en la enseanza de las ciencias fisicoqumicas y naturales (Expedientes de profesorado; DELGADO CRIADO, 1985: 59; MARN ECED, 1991: 9495). Al finalizar los nueve meses solicit prrroga de la pensin a la Junta, pero le fue denegada. Desde 1921 en que regres a Espaa, ense en la Escuela de Santander hasta 1922 y posteriormente en la de Tarragona, de la que lleg a ser Directora; estudi en la Universidad, obtuvo el ttulo de Licenciada en Ciencias Naturales y se examin de las asignaturas de Doctorado (CARREO RIVERA, 1996: 297; MARN ECED, 1991: 95). Debido a que su tesis no era posible hacerla en Tarragona donde trabajaba, al carecer la ciudad de laboratorios especializados, solicit a la Junta, en octubre de 1925, una nueva pensin por un ao en los Laboratorios de Psicologa de la Universidad de Pars. El cinco de marzo de 1926 comenz a disfrutar de su condicin de pensionada y emprendi sus trabajos en el Laboratorio Evolution des tres organisme, cuyo director era el profesor Caullery. Esta situacin se prolong hasta 1928 en que termin su beca (Expedientes de profesorado; MARN ECED, 1991: 96).

150 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

Primeros pasos de la Escuela Normal Femenina de Santander, 1915

A su regreso a Espaa, la profesora Comas Camps se doctor en Ciencias en Madrid y reemprendi de nuevo en Espaa sus actividades docentes, en esta ocasin en la Escuela Normal y en la Universidad Autnoma de Barcelona, en la que ense Biologa Infantil y Metodologa. Durante toda su vida mantuvo la vinculacin con la Institucin Libre de Enseanza de Madrid, con la que colabor en las empresas por ella alentadas, como la Revista de Pedagoga, a cuyo equipo de redaccin perteneci y cuya editorial le public muchas de sus obras y artculos (DELGADO CRIADO, 1985: 59). Defendi de manera entusiasta la pedagoga de vanguardia representada por el movimiento de la Escuela Activa, cuyos mtodos difundi en sus escritos. Al iniciarse la Guerra Civil espaola, abandon Barcelona y se instal provisionalmente en Bilbao. En 1937 se afinc definitivamente en Gran Bretaa, donde continu con sus actividades docentes. Su estancia en este pas le permiti familiarizarse con sus instituciones y difundir los mtodos de enseanza de las ciencias naturales en su obra La biologa en la enseanza media y superior de Inglaterra (1957) (CARREO RIVERO, 1996: 297). Ense biologa en Foxhole y en Dartington Hall. Muri en Exeter en el ao 1972 (DELGADO CRIADO, 1985: 59). Carmen De la Vega Montenegro es la tercera de las profesoras que participaron en la fundacin de la Escuela Normal Femenina de Magisterio de Santander (Expedientes del profesorado). Naci en Madrid el da 28 de enero de 1884. Fue profesora numeraria de Gramtica y Literatura Castellanas de la Escuela Normal de Maestras de Santander desde 1915, y en 1928 Directora de la misma. Entre sus ttulos se encontraban los de Maestra de Primera Enseanza Elemental, Maestra de Primera Enseanza Superior, Maestra de Enseanza Normal procedente de la Escuela Superior del Magisterio tercera de su cuarta promocin, 19121915 y Enfermera de la Cruz Roja. Entre sus premios y condecoraciones se contaban el pergamino de gratitud de la Ciudad de Santander por ser Directora de la Casa de Damas enfermeras durante la epidemia de gripe de 1918, tercer premio en el concurso de folklore organizado por el Ateneo de Santander en 1928, medallas de segunda clase de la Cruz Roja espaola (1919), medalla de primera clase de oro de la Cruz Roja espaola (1928) y medalla de la Paz de Marruecos (1928). La profesora De la Vega desarroll una considerable actividad literaria e imparti diversas conferencias, varias sobre temas literarios y algunas editadas en Santander, San Sebastin y Burgos en sociedades culturales. Fue presidenta de la Comisin internacional del Homenaje a Concha Espina y vicepresidenta de la Solemnidad Pedaggica en 1921.

5. Biblioteca
Las profesoras de la Escuela de Santander consideraron de gran importancia la existencia de una biblioteca que, por otra parte, el Real Decreto de 30 de agosto de 1914 que reorganizaba las Escuelas Normales haca constar como necesaria en una Escuela Normal y dedicaron una de las sesiones de claustro a tratar de su funcionamiento. Se decidi que permaneciera abierta los mircoles por la tarde, de tres a cuatro, y los sbados por la maana de once menos diez a once y media. Las alumnas no podran sacar libro alguno sino por indicacin de alguna profesora y el mximo de ejemplares que podran prestarse sera de dos. No podran sacarse de la Escuela los diccionarios ni la Enciclopedia Espasa que se leera en el despacho de la escribiente. Los libros cuyas lminas o lecturas hicieran falta para una clase, se deban pedir con veinticuatro horas de antelacin (Libro de actas de claustro, 11 de enero de 1916).

6. Excursiones
El claustro de la Escuela Normal de Maestras de Santander contempl la realizacin de experiencias que en aquella poca resultaban bastante innovadoras como las excursiones, influidas sus profesoras con mucha seguridad por el proyecto educativo difundido por la Institucin Libre de Enseanza. No hay que olvidar que la Escuela de Estudios Superiores del Magisterio donde la mayora de estas primeras normalistas de la escuela santanderina se formaron deba en gran parte su existencia al proyecto ideolgico educativo difundido por los institucionistas, que tambin influy considerablemente en la ley de 1914, origen de la reforma de las Escuelas Normales. Se estableci que las excursiones se realizasen en sbado y que cada mes se dejase una tarde de sbado completamente libre, sin excursin ni reunin de ninguna clase ya que se deseaba que las alumnas tuviesen tiempo por la tarde para estar en familia, hacer compras o cualquier otra cosa que
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

151

Carmen Rubalcaba Prez

les interese. Cada profesor dispondra de la tarde de un sbado cada nueve semanas, para cada curso y si varios profesores unan sus grupos podan realizarse excursiones de manera ms frecuente. Las profesoras podan salir de la Escuela con sus alumnas durante el tiempo que duraba una clase, unos cincuenta minutos. El grupo deba ser reducido, unas diez alumnas, pudiendo ir ms si lo acompaaban varias profesoras. Se haba establecido que fuese una profesora por cada diez alumnas en ciudad y una por cada seis fuera de ella. Se deba dar aviso a la direccin la vspera. Las alumnas deban viajar por lo menos en segunda clase y era indispensable el permiso de los padres para que se separasen del grupo, y lo que nicamente estaba permitido en el momento en que deban volver a sus casas.
Una de las profesoras deba ser la encargada de dirigir la excursin, aunque contara con las dems profesoras que la acompaasen a la hora de ajustar el itinerario a las necesidades de las enseanzas que se hubieran de dar en la excursin. Durante la explicacin de una profesora, las dems no deban intervenir sino que se consideraran como ayudantes. Dos das antes de realizarse la excursin, la profesora que la hubiese de dirigir deba presentar un proyecto en la direccin del centro especificando detalladamente las horas de salida, entrada, trenes, gastos, distancia, circunstancias generales (lugares que se visitaran o estado de los caminos, por ejemplo). Se haca especial hincapi en que las alumnas no se fatigasen, hubiese tiempo de descansar o de realizar algn juego, prefiriendo, no limitarse a ver cosas, sino a verlas con tranquilidad de espritu, para apreciar el ambiente caracterstico de lo que observan. Se recomendaba que la profesora que se hubiese encargado de dirigir la excursin dejase en la Escuela un pequeo resumen de la excursin realizada (Libro de actas de claustro, 25 de enero de 1916).

7. Reflexiones finales
Si se desea conocer la evolucin histrica de la educacin en Espaa en el mundo contemporneo, se hace imprescindible profundizar en el conocimiento ms detallado de la historia de las Escuelas Normales de Magisterio; no en vano en ellas se formaron los maestros durante casi doscientos aos y jugaron un papel importante en el descenso del analfabetismo. En el caso de las mujeres, adems, permitieron a muchas de ellas continuar sus estudios, tener una independencia econmica y sobre todo intelectual. La Escuela Normal de Maestras de Santander se fund con profesorado altamente preparado formado en la Escuela Superior del Magisterio de Madrid, interesado en el movimiento de renovacin pedaggica que se estaba experimentando en toda Europa y que particip de los planteamientos metodolgicamente renovadores propugnados por la Institucin Libre de Enseanza, a la que varias profesoras se encontraban ligadas. En la provincia de Santander, por ejemplo, de los cuatro pensionados por la Junta de Ampliacin de Estudios tres, al menos, fueron profesoras de la Escuela Normal que aprovecharon esas estancias para completar su formacin. En la detallada reglamentacin de la manera en que se deba realizar las excursiones, en el inters por la naturaleza y por el entorno tanto campestre como ciudadano se percibe la influencia de las nuevas corrientes pedaggicas que se estaban difundiendo por el pas en este periodo. La Escuela Normal de Santander se afirm en la provincia mediante actuaciones en diferentes niveles: como centro de perfeccionamiento profesional y de renovacin didctica a travs del estudio de problemas educativos y como institucin de difusin cultural, mediante conferencias y campaas. Fue un agente dinamizador de la cultura en la regin, principalmente en Santander, ya que en esta provincia no exista Universidad y la Escuela Normal, junto con el Instituto y otros centros educativos, como los de Comercio y Nutica, era una de las instancias educativas ms altas.

Referencias bibliogrficas
ALEGRA AGUADO, ROSARIO (1985). Universidad de Santander. En la Gran Enciclopedia de Cantabria, Santander, tomo VIII. CARREO RIVERO, MYRIAM (1996). Margarita Comas Camps. En JULIO RUIZ BERRIO (dir.), La educacin en Espaa. Textos y Documentos. Madrid: Actas. DELGADO CRIADO, BUENAVENTURA (1985). Comas Camps, Margarita (18971972). En AGUSTN ESCOLANO BENITO (coord.), Historia de la Educacin, Vol. II. Madrid: Anaya.

152 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

Primeros pasos de la Escuela Normal Femenina de Santander, 1915

ESCOLANO BENITO, AGUSTN (1983). Las Escuelas Normales. Siglo y medio de perspectiva histrica. En Cinco lecturas de historia de la educacin. Salamanca: Instituto de Ciencias de la Educacin, Universidad de Salamanca, 79102. ESCUELA NORMAL DE MAESTRAS CENTRAL DEL REINO (1958). Fiestas Jubilares, 18581958. Madrid: Nuevas Grficas. ESPAA, REAL DECRETO (1901) de 17 de agosto de 1901, organizando los Institutos Generales y Tcnicos. ESPAA, REAL DECRETO (1914) de 30 de agosto de 1914, reorganizando las Escuelas Normales. EXPEDIENTES DE PROFESORADO DE LA ESCUELA NORMAL FEMENINA DE SANTANDER, Secretara de la Facultad de Educacin de la Universidad de Cantabria. GMEZ OCHOA, FIDEL & HOYO APARICIO, ANDRS (1987). Universidad y sociedad. Quince aos de la Universidad de Cantabria. Santander: Universidad de Cantabria, 232. GUTIRREZ GUTIRREZ, CARMEN CLOTILDE (1996). El sistema educativo en la Cantabria del Antiguo al Nuevo Rgimen: niveles de enseanza y estudiantes, (17001860) (tesis indita). Santander. LIBRO DE ACTAS DE CLAUSTRO DE LA ESCUELA NORMAL FEMENINA DE SANTANDER (19151931), Secretara de la Facultad de Educacin de la Universidad de Cantabria. LIBRO DE POSESIONES DE LA ESCUELA NORMAL FEMENINA DE SANTANDER (19151964), Secretara de la Facultad de Educacin de la Universidad de Cantabria. MADARIAGA, BENITO & VALBUENA, CELIA (1971). El Instituto de Santander. Santander: Institucin Cultural de Cantabria, Diputacin Provincial de Santander. MARN ECED, TERESA (1991). Innovadores de la educacin en Espaa. Becarios de la Junta para Ampliacin de Estudios. Cuenca: Universidad de CastillaLa Mancha. MOLERO PINTADO, ANTONIO (1986). Prlogo. En MARA DEL MAR POZO ANDRS, MANUEL SEGURA REDONDO & ALEJANDRO R. DEZ TORRE, Guadalajara en la historia del Magisterio Espaol. 1839/1939 Cien aos de formacin del profesorado. Alcal de Henares: Universidad de Alcal de Henares, 1518. MOLERO PINTADO, ANTONIO & POZO ANDRS, M DEL MAR (1989): Relacin de alumnos de la Escuela clasificados por promociones. En ANTONIO MOLERO PINTADO & M DEL MAR POZO ANDRS (eds.),

Escuela de Estudios Superiores del Magisterio (19091932). Un precedente histrico en la Formacin Universitaria del Profesorado Espaol. Madrid: Universidad de Alcal de Henares,
201214. POZO ANDRS, M DEL MAR, SEGURA REDONDO, MANUEL & DEZ TORRE, ALEJANDRO R. (1986). Guadalajara en la historia del magisterio espaol: 1839/1939 cien aos de formacin del profesorado. Alcal de Henares: Universidad de Alcal de Henares. RUIZ BERRIO, JULIO (1992). Alfabetizacin y modernizacin social en la Espaa del primer tercio del siglo XX. En ANTONIO ESCOLANO BENITO (dir.), Leer y escribir en Espaa: doscientos aos de alfabetizacin. Madrid: Fundacin Germn Snchez Ruiprez, 91110. VALBUENA, CELIA & MADARIAGA, BENITO (1975). Panorama general de la enseanza en la provincia de Santander (siglos XVIXIX). En Los antiguos centros docentes espaoles. San Sebastin: Patronato Jos Mara Quadrado (C.S.I.C.), 231247.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 145153

153

REFERENCIA: Luengo, M Rosa & Gutirrez, Prudencia (2010). Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada


MRosaLUENGOGONZLEZ PrudenciaGUTIRREZESTEBAN

Correspondencia: MRosaLuengoGonzlez rosaluen@unex.es PrudenciaGutirrezEsteban pruden@unex.es Direccinpostal: FacultaddeEducacin Avda.deElvass/n CampusUniversitario 06006Badajoz Telfono:924289501 Recibido:3demarzode2010 Aceptado:18deoctubrede2010

RESUMEN
El tema del uso del tiempo por las mujeres ha ocupado no slo nuestros pensamientos, sino el elaborado por muchas otras que lo han estudiado en profundidad y con ello han contribuidoalareformulacindelmismo. En este artculo se revisa la relacin de las mujeres y el tiempo desde una perspectiva de gnero y se analizan los usos del tiempo en Educacin. Especialmente el de las maestras, quienes han de cumplir con un triple rol en su relacinconeltiempo,comomujeres,madresymaestras. Asimismo, se ofrecen experiencias y acciones positivas que permitenconciliarlasdistintasesferasvitalesdelaspersonas, en concreto la profesional y la familiar, equilibrando el uso desigual,quehacemosmujeresyvarones,deltiempo.

PALABRAS CLAVE: Mujeres,Tiempo,Educacin,Maestras.

Tangled in time. Women, time and education: A conditioned relationship


ABSTRACT
Theissueof the useoftimebywomenhasnotonlytakenplaceinourthoughtsbutithasalsobeen developed by many other women, who have studied it in depth and have thereby contributed to its reformulation. Thisarticlereviewstherelationshipbetweenwomenandtheuseoftimefromagenderperspectiveand discusses the use of time in Education. In particular, we focus on how time Is used by female school teachers, who must fulfill a triple role in their relationship with time, as women, as mothers and as teachers. Finally,experiencesandpositiveactionsareofferedwhichallowharmonizingtheirdifferentspheresof life,mainlytheworkandfamilyspheres,aimingtobalancetheunequaluseoftimebymenandwomen.

KEY WORDS: Women,Time,Education,Femaleteachers.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

155

M Rosa Luengo & Prudencia Gutirrez

Introduccin
Las investigadoras feministas han abordado desde hace algn tiempo los estudios de y sobre las mujeres, sacando a la luz algunos de los problemas que se hacan invisibles y por lo tanto no contaban ni requeran ninguna solucin. Ellas han aportado, adems, una forma distinta de estudiarlos y sta no es otra que la perspectiva de gnero, en la cual se adopta una mirada nueva, diferente; en esencia, es la mirada de las mujeres, la mirada que tiene en cuenta factores hasta entonces ocultos y que no aplica los estndares androcntricos, por lo cual rompe con lo establecido y ofrece visiones radicalmente distintas de la realidad, sus causas y sus consecuencias, especifica otra forma de ver y estudiar cmo nos afecta y condiciona nuestras experiencias. La perspectiva de gnero consiste en desnaturalizar la percepcin que se tiene de ser mujer o varn y atribuir a sus roles y comportamientos un carcter socialmente construido, permite deconstruir y pensar de otro modo los lugares que ocupan en la sociedad mujeres y varones. La consideraremos pues, marco conceptual, metodologa de interpretacin y, como hemos dicho, un instrumento para observar la realidad (es ms que mirar.). En definitiva, el anlisis que aplica esta perspectiva exige el compromiso de todas las organizaciones e instituciones para la modificacin de la condicin y posicin de las mujeres y en trabajar para lograr una sociedad ms equitativa, justa y solidaria. Ello implica alterar la posicin de desigualdad y subordinacin de las mujeres en relacin a los varones en los campos econmico, poltico, social, cultural y tnico, con el fin de mejorar las condiciones de su vida cotidiana. Uno de los elementos que componen esta realidad es el tiempo. Para estudiar el tiempo y para comprobar cul es el uso que hacen de esta coordenada vital las mujeres y, sobre todo, para comparar en qu parmetros se mueven respecto de sus compaeros varones, en primer lugar debemos tratar de situar el concepto al que nos estamos refiriendo.

El tiempo
El tiempo es un recurso imprescindible en el anlisis de gnero. Poder disponer de tiempo es cada vez ms difcil en determinadas circunstancias. Por eso, el tiempo como recurso vital se convierte en el centro de reflexin sobre los problemas de la vida diaria. La disponibilidad de tiempo y la capacidad de decidir sobre el propio tiempo es de gran importancia para las mujeres, pero no es slo un problema de ellas, es una cuestin social ms amplia. Siguiendo a Dolores Ramos (1998), podemos decir que el tiempo es una categora de anlisis que rene en torno a l aspectos econmicos, sociolgicos, psicolgicos y biolgicos. El tiempo es una necesidad principal de la vida de las personas. En los pases desarrollados, donde las necesidades materiales estn cubiertas, es donde se considera primordial ahorrar tiempo, interesarse por las horas trabajadas y por la cantidad de tiempo libre disponible. En la Baja Edad Media el tiempo era un tiempo productivo, muy apropiado para la actividad gremial y mercantil. Con la Revolucin Industrial el tiempo se dividi en horas que se podan vender y comprar y las mujeres empiezan a salir del mbito del hogar para vender horas de trabajo en los oficios ms duros, por ejemplo en las minas. A partir de entonces, las mujeres no slo utilizan su capacidad productiva y reproductiva en el hogar, sino que venden su tiempo en el mercado laboral. Poco a poco entramos en el siglo XX y la mujer decide incorporarse plenamente al mercado laboral, lo que le supone adoptar la doble jornada y convertirse en una supermujer; pero en los aos 80, el mito de la supermujer se derrumb ante el exceso de obligaciones y empez a reivindicar la presencia masculina en el espacio privado. En los noventa esta idea cristaliza en el intercambio de tareas que se concreta en las medidas de conciliacin de la vida familiar. Sin embargo, en estos primeros aos del nuevo siglo comprobamos que las mujeres siguen afrontando las tareas domsticas y, segn las ltimas estadsticas, les dedican siete veces ms tiempo que los varones. No cabe duda de que el tiempo hoy es un factor econmico de primera magnitud. Sin embargo hay tiempos diferentes: el que se contabiliza en los anlisis y el que no. Por ejemplo, el consumo del tiempo para el cuidado tiene un coste de produccin importante en las economas modernas aunque no lo veamos en los anlisis econmicos, pues no est valorado en las relaciones de mercado, lo que hace

156 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada

que estos anlisis sean parciales. Es decir, se quedan cojos pues la economa debe incluir las actividades que se compran y venden y las que se realizan con intercambios no realizados con dinero. La economa del tiempo es una economa poltica. No se produce en abstracto, sino a travs de sujetos que aportan su propio tiempo a la produccin de bienes y servicios. Una de las primeras cosas que aprendemos cuando adquirimos el lenguaje es a nombrar el tiempo con las formas verbales y sus primeras matizaciones en las tres divisiones bsicas: pasado, presente y futuro, ayudndonos de los adverbios de tiempo, como luego, maana, enseguida, que nos permitirn diferenciar los matices significativos de un mensaje concreto. Pero si nombrar el tiempo es uno de los aprendizajes ms complicados de la adquisicin lingstica, medirlo tambin lo es.

Cmo se mide el tiempo? Qu valor tiene?


El tiempo es un elemento continuo y homogneo. Se podra representar como una lnea horizontal sin principio ni fin en la cual debemos situarnos para poder hablar de l. La humanidad ha sentido siempre la necesidad de medirlo agrupndolo y dividindolo en diferentes unidades, que variaron dependiendo de la evolucin de cada sociedad. Distintos pensadores y en diversas reas cientficas de todas las pocas se han ocupado de su estudio. La Astronoma nos permiti poner en relacin el comportamiento de los astros y el paso del tiempo; as, debido a la distancia que debe recorrer la Tierra al dar la vuelta alrededor del Sol tendremos la divisin en un ao compuesto de 365 das, siendo el da el tiempo que tarda la Luna en rodear a la Tierra. Adems, hoy admitimos el da y la noche con una duracin exacta y cclica de 24 horas. ngeles Durn, en su libro El valor del tiempo (2007), le dedica un captulo muy sabroso e ilustrativo que explica los diferentes calendarios solares que han existido a lo largo de la Historia de la Humanidad. Los calendarios nos han servido para organizar el tiempo, y han sido distintos en diferentes pocas. Los cristianos tenemos el calendario gregoriano, en honor al papa Gregorio XIII, que sita el punto cero en el nacimiento de Cristo; los musulmanes empiezan en el 622 d. C., cuando tuvo lugar la Hgira o viaje de Mahoma a la Meca. El ao chino tiene 354 das y no coincide con el occidental solar. Estos calendarios distintos evidencian cmo cada cultura elige el lugar en el que situarse en la lnea del tiempo para referirse a l. La hora es tambin un elemento de medicin bsico del tiempo. En un mundo hoy globalizado la tecnologa hace que se haya impuesto la sincrona para la comunicacin, y as Internet y las TIC hacen posible que los acontecimientos sean vistos desde cualquier punto del planeta simultneamente. Para su contabilidad se propuso como hora cero la que se produca en Greenwich, pasando a aumentar o disminuir segn los husos horarios situados a su derecha o izquierda. Este concepto compartido en toda la civilizacin occidental se ha convertido en referencia para los intercambios comerciales. El tiempo se vende y se compra en horas y en sus mltiplos. Horas de trabajo, horas de ocio, horas de descanso El valor se calcula segn el precio del dinero en cada momento histrico. Actualmente para comprobar cunto tiempo dedicamos a las distintas actividades de nuestra vida cotidiana se contabilizan en horas o sus mltiplos y divisores, minutos y segundos. El problema est en que el objeto de estudio era siempre el tiempo que se invierte en las relaciones comerciales, en el tiempo del trabajo, lo que hace invisible la participacin de las mujeres, pues hasta bien entrado el siglo XX no se ha conseguido su incorporacin real al mercado laboral. Su tiempo se inverta en el trabajo domstico y no se contabilizaba ni apareca en las estadsticas de uso del tiempo. En la plataforma de Accin de Beijing, de la Cuarta Conferencia Mundial sobre las Mujeres en 1995, los pases se comprometieron a visibilizar la distribucin y contribucin de las mujeres al trabajo no remunerado, a travs de la elaboracin de cuentas satlites en el marco del sistema de cuentas nacionales. Diez aos despus, en 2005, se estipul hacer estadsticamente visible los distintos tipos de

trabajo no remunerado que realizan tanto los hombres como las mujeres en el hogar; obtener datos comparables, tanto desde el punto de vista nacional como internacional y conseguir uniformidad y periodicidad en la recogida de informacin (ONU, 1995).
En Espaa contamos con las elaboradas por el INE y los estudios elaborados por el CSIC, y en Amrica Latina con las de la CEPAL.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

157

M Rosa Luengo & Prudencia Gutirrez

Las mujeres y los usos del tiempo


M Jess Izquierdo (1988) afirma que varones y mujeres se pueden diferenciar en el sentido y el uso que le dan al tiempo. Vamos a detenernos en los diferentes aspectos que inciden en los usos del tiempo. El trabajo fue en otras pocas esfuerzo fsico, pero hoy es, sobre todo, cesin de tiempo para transformar objetos y producir servicios. Aquellas personas que realizan el trabajo remunerado, es decir, a cambio de bienes y servicios, conforman la poblacin activa. Debemos distinguir los vendedores de tiempo, o sea, los asalariados y las asalariadas, del empresariado, que es quien compra el tiempo. Son las empresas, ya sean pblicas o privadas, las que contratan la cantidad de horas que necesitan para llevar a cabo sus tareas. La mayora trata de vender su tiempo al completo. El concepto vara segn los pases; as en Espaa por encima de las 40 horas semanales se consigue el contrato a tiempo completo, aunque ya se habla de las 65 horas que se estn realizando en otros lugares. Cuando no alcanzan este nmero estamos ante un contrato a tiempo parcial. Son las mujeres quienes optan por l para poder compatibilizar el tiempo del trabajo con las responsabilidades familiares. El mundo laboral es un mbito donde se valora, por encima de todo, la dedicacin y la disponibilidad de tiempo. El actual sistema de relaciones sociales de gnero es el que asigna a las mujeres el mantenimiento de los espacios domsticos y les otorga la responsabilidad de las tareas del hogar y el cuidado de las personas ancianas y de la infancia, lo que hace que se llegue a restringir su reciclaje profesional y el acceso a puestos de trabajo porque estas funciones requieren mucho tiempo. Cuando las mujeres, adems, realizan otro trabajo fuera del hogar se produce la doble jornada que sin duda, es una situacin flagrante de explotacin al tener que compaginar el horario por el que, percibe el salario y el horario interminable de las amas de casa. Se constata as una nueva desigualdad entre los dos sexos en funcin de los usos del tiempo. La diferencia bsica est en el carcter continuo del tiempo de las mujeres, sin diferenciacin alguna entre laborables y festivos, entre trabajo y ocio. El tiempo de las mujeres tiene un valor de uso. Adems, segn Cristina Carrasco (2005), gran parte del tiempo de las mujeres no se consume ni se vende: se utiliza de manera plural, se regala a los dems. Sin embargo, para los hombres el tiempo tiene calidad de mercanca intercambiable por dinero, ocio o consumo. Su tiempo es discontinuo. Este uso continuo/discontinuo del tiempo es el primer factor de desigualdad. El segundo factor de desigualdad es la forma, heternoma o autnoma, en que el colectivo femenino y masculino usan el tiempo. La primera, uso heternomo, supone estructurar y organizar la jornada en funcin de los otros, un hecho que en s mismo implica alienacin, extraamiento, ya que una persona que no es duea de su tiempo difcilmente puede ser duea de su vida; y eso es lo que les ocurre a las mujeres. La segunda, la del uso autnomo del tiempo, se convierte en un valor de primer orden. sta es la que utilizan los hombres. Los estudios sobre usos del tiempo fueron determinantes para hacer visible su peso especfico. Por eso nos preguntamos que si el tiempo que se invierte en las actividades realizadas en el hogar es tan importante para mujeres y hombres, por qu se ha hecho invisible? Por qu no ha tenido el reconocimiento social que le corresponde? Seguramente la contestacin a este interrogante es complicada. Est claro que las diferencias se deben a los modelos masculino y femenino. El modelo masculino se caracteriza por la libre disposicin de tiempos y espacios. En este modelo es un valor el haber traspasado ese tipo de actividades a alguien que les soluciona la vida cotidiana y les permite dedicarse libremente a la actividad pblica. La libertad que conquistan los varones la obtienen a cuenta de que las mujeres se responsabilicen de atender las necesidades de la vida humana. El modelo masculino es aquel que presupone que los varones se incorporan al mercado de trabajo al alcanzar la edad laboral y permanecen en l hasta la edad de jubilacin, dedicando a ello todo el tiempo a lo largo de su vida activa. El modelo femenino se caracteriza por priorizar el ciclo vital, de manera que las mujeres se incorporan o abandonan el mercado laboral segn esta circunstancia. As, en la medida que las mujeres se han ido incorporando al mercado laboral, han ido desapareciendo las figuras de hombre que aporta los ingresosmujer ama de casa que trabaja para la familia sin remuneracin y se ha ido abriendo paso un nuevo modelo que tiende a consolidarse: el

158 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada

hombre mantiene su rol casi intacto pero la figura del ama de casa tradicional tiende a desaparecer, lo cual no significa que sta abandone sus tareas de cuidadora y gestora del hogar, sino que de hecho asume un doble papel, el familiar y el laboral. Nos vemos enfrentadas, casi en solitario, al problema de conciliar tiempos y trabajos. Lo que nos ha obligado a desarrollar distintas formas de resistencia individual, adaptaciones y elecciones diversas, relacionadas con reducciones del trabajo familiar, con la organizacin del trabajo de cuidados y con formas especficas de integracin en el mercado de trabajo. Para Marcela Lagarde (2003) se est produciendo lo que ella define como sincretismo de gnero cuando cuidar a los otros de la manera tradicional se produce a la vez que el desarrollo individual para formar parte del mundo moderno, siendo la cultura patriarcal la que fomenta en las mujeres la satisfaccin de cuidar y al mismo tiempo la necesidad de participar en los procesos educativos, laborales y sociales. Sin embargo, durante la vida laboral, para promocionar en el trabajo es ineludible la formacin continua. Los estudios actuales revelan que las mujeres estn alcanzando un nivel de estudios alto y se preocupan por conseguir una preparacin adecuada y, a pesar de ello, hay otras dificultades que les impiden progresar. Los varones tienen ms disponibilidad para trabajar en das festivos y disponen de ms tiempo para realizar contactos y viajes profesionales, y no manifiestan falta de tiempo fuera del horario laboral para realizar ms tareas relacionadas con su profesin. Est claro, por lo tanto, que las mujeres tienen obstculos y falta de disponibilidad para el empleo, pues las obligaciones familiares las atan. Se sienten angustiadas por la doble jornada y hasta se sienten culpables cuando no dedican ms tiempo a estos menesteres, pero hay que hacer notar las diferencias segn el ciclo vital en el que se encuentran: no es lo mismo una mujer de 25 a 30 aos soltera y sin responsabilidades que una mujer casada y con personas a su cargo. El mercado de trabajo, en la gran mayora de pases se caracteriza por una segregacin horizontal y vertical que tiene su justificacin en razones de gnero, aunque no son slo stos los motivos que explican la segmentacin del mercado de trabajo. La segregacin ocupacional por razn de sexo se manifiesta: Horizontalmente, segregacin horizontal, cuando se dan diferentes empleos y trabajos para mujeres y hombres segn los roles de gnero. Verticalmente, segregacin vertical, cuando son los hombres quienes ocupan los puestos de responsabilidad y las mujeres las categoras inferiores dentro de las jerarquas establecidas en una misma profesin. Por ejemplo, las mujeres son ms numerosas en casi todos los niveles del sistema educativo y obtienen mejores resultados acadmicos, como revela el Informe PISA (OCDE, 2007), y presentan una calificacin acadmica media superior a la de sus compaeros varones. Este hecho se debe a que a ellas el ttulo les es ms indispensable

para conseguir un trabajo remunerado, pues reduce la ventaja que este ltimo tiene en el mercado laboral.
Al contrario de lo que pueda parecer, esta realidad no se traduce en la obtencin de empleos acordes a su formacin, pues a medida que subimos en el escalafn jerrquico dentro de las organizaciones, disminuye el nmero de mujeres y aumenta el de hombres. A este fenmeno es al que denominamos segregacin vertical. Se explica con la metfora del techo de cristal, es decir, existen unas barreras invisibles que impiden a las mujeres con cualificacin y capacidad acceder a los puestos de direccin y responsabilidad en sus destinos profesionales. Una de esas barreras es el tiempo. O mejor dicho, esa doble jornada de la que ya hemos hablado (GUTIRREZ ESTEBAN, 2007). Adems, si nos preguntamos Cunto tiempo tardan en llegar? Cul es la proporcin de las que lo hacen? Deberemos responder con otra metfora, la que llamamos del suelo pegajoso, que nos explica las dificultades que encuentran las mujeres para desprenderse de los obstculos y factores que las atan a las categoras profesionales inferiores, de manera que no pueden acceder a los puestos de direccin, lo que hace que la proporcin sea siempre menor como lo han demostrado ya diversos estudios realizados al efecto. El suelo pegajoso est compuesto en su mayora por las tareas asignadas tradicionalmente a las mujeres, lo que es coloquialmente conocido como llevar la casa (GUTIRREZ & LUENGO, 2007). Vamos a reflexionar ahora sobre qu tiempo se dedica a esta tarea y en qu cometidos.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

159

M Rosa Luengo & Prudencia Gutirrez

El tiempo dedicado al cuidado de otras personas


Cuidar es la accin de asistir, guardar y conservar, segn la RAE. Cuando hablamos de cuidar nos referimos especialmente al tipo de servicios no remunerados que se prestan en los hogares y que van dedicados a nios, enfermos y ancianos. Para medir el tiempo que se emplea en los cuidados se han realizado varias encuestas, una de ellas la Encuesta del Empleo del Tiempo del INE (2003). Pero sus resultados hay que tomarlos con precaucin, pues se ha definido la actividad principal y el cuidado es a menudo una actividad difusa, invisible, y fcilmente eclipsada en los recuentos por otras actividades ms concretas y fsicas que dejan rastro. Tal como dice ngeles Durn (2007), a menudo el cuidado se realiza de forma simultnea con otras actividades, por lo que nos preguntamos como ella: dnde empieza y dnde acaba la accin de cuidar? Mientras cuidamos planchamos, cocinamos o leemos el peridico. Cuando el encuestador nos pregunta seguramente olvidamos decir que mientras hacemos esas cosas tambin cuidamos a los nios, o a los mayores o a los dependientes de nuestro hogar, y a veces a todos a la vez. No es fcil distinguir los diversos cuidados. Hay cuidados fsicos, como vestir a un nio, que tienen una duracin precisa y pueden medirse con valores cuantitativos, y otros cuidados intangibles, ms afectivos y que se pueden prestar incluso a distancia, que ocupan tiempo pero ms difcil de medir y que coexiste con otras actividades. El lenguaje lo nombra con expresiones como preocuparse de, estar al tanto de, ocuparse de, que implican ideas difciles de incluir o expresar en los resultados de las encuestas pero que son necesarias para aclarar la idea de cuidar en su sentido ms amplio. Tampoco los cuidados tienen la misma entidad. Los bebs y nios pequeos necesitan unos cuidados permanentes que implican la presencia de algn adulto que lo realice. Y esta tarea la suelen realizar las mujeres. Segn la Encuesta del Empleo del Tiempo del INE (2003), las mujeres emplean en cuidar nios como media casi el doble que los varones en los das laborables, aunque en fin de semana ellos aumentan ligeramente la cantidad de tiempo, mientras ellas la reducen tambin ligeramente. El resultado anual es de 572 horas de ellas frente a 158 de ellos. La diferencia, 416 horas en las cuales las mujeres podran realizar trabajo remunerado o actividades para el cuidado de s mismas o para su formacin o para el asistir a reuniones polticas, religiosas, de ocio, etc. Son muchas horas y quizs sea esa una de las razones por las que ha descendido drsticamente la tasa de natalidad. Podra suponerse que la reduccin de nacimientos ha hecho disminuir la cantidad de trabajo dedicado colectivamente a sus cuidados; pero no es as, sino todo lo contrario. Antes los nios dejaban la escuela enseguida y ayudaban a sus padres en el trabajo, hoy los jvenes permanecen en el sistema educativo ms aos y no se incorporan al mercado de trabajo hasta los 2530 aos. Por ello, en las familias se les sigue cuidando, pero ese cuidado de adolescentes y jvenes est ms vinculado al concepto antes mencionado de ser responsables, estar pendientes de ellos y mantener sus vnculos de dependencia familiar. Hay otro aspecto que no podemos olvidar: la forma en que los nuevos ncleos familiares gestionan el uso del tiempo. El concepto de familia evoluciona constantemente. Nuevas formas de relacin personal hacen que se constituyan ncleos familiares compuestos por una sola persona, soltera, separada o viuda; parejas del mismo sexo, con o sin hijos; madres solteras que viven con sus hijos, mujeres separadas con hijos o parejas separadas que cuidan de los hijos en tiempos distintos. Pero el cuidado adems puede realizarse dentro o fuera del hogar. Las abuelas, hermanas, primas, etc. apoyan la incorporacin de las mujeres ms jvenes al mercado laboral, ocupndose de las tareas de cuidado en un acto de gran solidaridad entre las mujeres; o mejor dicho, sororidad en palabras de Marcela Lagarde (2006).

Las tareas del hogar


Pero llevar la casa incluye otras actividades que requieren mucho tiempo, como la cocina. Los estudios sobre los usos del tiempo no se ponen de acuerdo sobre cunto tiempo dedicamos a cocinar. No es fcil saber lo que dedicamos a realizar la compra de los alimentos y el tiempo invertido en su preparacin. Lo que s es cierto es que a la cocina se le dedica mucho tiempo al cabo del ao y que es una actividad que no disminuye ni en vacaciones ni en fines de semana. Las encuestas demuestran tambin que el estado civil afecta a esta faceta, de manera que los varones solteros son los que menos cocinan y siempre son las mujeres las que ms lo hacen y en todos los tramos de edad. Hoy, adems de la comida

160 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada

de la casa, hay que contar con necesidades tambin nuevas, pues las madres aumentan el tiempo que dedican a la cocina para hacer platos a sus hijos e hijas que despus stos se llevan ya preparados a sus casas. Por otro lado, hay que decir que es en el fin de semana cuando ms se dedican a hacerlo, lo cual hace que no se vea como trabajo, pues en el calendario laboral los fines de semana se contemplan como das de descanso y no se registran las tareas domsticas para las que este descanso no se aplica. Vamos a fijarnos ahora en otra de las tareas que se realizan constantemente en los hogares: la limpieza. Las encuestas cuantifican el tiempo dedicado por los varones y las mujeres de manera que, segn el INE, las mujeres dedican un esfuerzo seis veces mayor que ellos a mantener limpios los espacios privados. Hay adems algunas cuestiones que parece importante sealar y entre ellas destacamos que el nivel educativo afecta poco al tiempo que se dedica a esta tarea, es decir, da igual que sean personas de bajo nivel cultural o por el contrario alguien que ha alcanzado estudios superiores, pues los promedios dedicados a limpiar no varan. Las familias con nivel econmico alto son las que ms dinero dedican para contratar a otra persona que la realice por ellos. Y en todo caso, cuando en un hogar hay una persona externa que realiza la limpieza los varones se desentienden pero las mujeres siguen involucradas en ella. Relacionada con la limpieza est la atencin a las plantas y los animales domsticos. Claro que son elementos optativos, no obligatorios, pero que estn presentes en los hogares y cuentan en las relaciones familiares. No insistiremos mucho en ello pero si se midiese el tiempo que cuesta atenderlos su valor sera altsimo por la acumulacin de minutos que se consume en su cuidado. Estas actividades forman parte de los aprendizajes de los roles y los nios y nias las asimilan por la socializacin. En el libro Gnero y libros de texto, Luengo Blzquez (2003) analizan las imgenes de las mujeres y se puede observar cmo cada vez que se representa a una mujer mayor sta tiene cerca algn animal domstico, lo que hace inferir que es ella quien lo cuida.

El tiempo de la salud
La salud es otro de los temas que ocupan gran parte de la actividad domstica. Nos es una cuestin balad decir que hoy da tenemos una esperanza de vida muy alta que se sita en 75 aos para los varones y en 81 para las mujeres. En contrapartida a su mayor supervivencia, la proporcin de personas enfermas crnicas y discapacitadas es tambin mayor. Pues por cada persona enferma o que no puede valerse por s misma se necesitan una o varias personas que le presten el tiempo que requiere para satisfacer sus necesidades. Y es obvio decirlo, son las mujeres las que emplean sus energas y tiempo en ello tambin. Segn el INE (2003), una de cada diez personas reduce su actividad cada quince das a causa de alguna enfermedad o accidente. Nos referimos a dolores, enfermedades espordicas como infecciones, fiebre o gripes Esto hace que se requieran los servicios mdicos y, en gran parte de los casos para las consultas, la ayuda de algn familiar que acompaa a la persona enferma, interrumpiendo sbitamente su quehacer diario. De nuevo las encuestas nos dicen que son las mujeres mayoritariamente las que dedican ese tiempo a los dems. Detrs de la palabra familiar o acompaante se oculta una mujer. La reflexin la debemos hacer teniendo en cuenta que este tiempo se puede traducir en horas de trabajo que cuestan dinero y que las mujeres donamos gratuitamente. Si nos preguntramos cunto cuesta la atencin de una persona dependiente, es decir, cunto valdra sustituir a las personas que la cuidan las 24 horas, las Administraciones Pblicas tendran que reorganizar todo su presupuesto para atenderlas. La nueva Ley de Dependencia (2006) es un paso muy importante, pero no cabe duda de que necesita mucha financiacin y que las administraciones autonmicas agilicen los trmites para la obtencin de las ayudas.

Tiempo y espacio
Hablemos ahora de los desplazamientos. Ir de un sitio a otro en las ciudades se ha convertido en algo costoso, de forma que continuamente nos planteamos ms cunto tiempo vamos a necesitar y si es un gasto que nos merece la pena.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

161

M Rosa Luengo & Prudencia Gutirrez

Para trabajar nos desplazamos en trayectos ms largos y en vehculos mientras que para habitar nos desplazamos a pie y por trayectos cortos, pues solemos tener cerca el colegio, los comercios para la compra diaria o las necesidades bsicas. El tiempo dedicado a los desplazamientos y la concentracin de vehculos hace de los atascos unos de los problemas que alargan el tiempo que dedicamos a desplazarnos y a perder tiempo. Pero esto es un obstculo para las mujeres que trabajan fuera de la casa, pues deben organizarse de manera que su movilidad sea compatible con las dos funciones: la de ama de casa y la de mujer empleada por cuenta ajena. Esto hace que las mujeres desarrollen estrategias espaciales. Son estrategias especficas para superar la creciente distancia entre los lugares en los que transcurre la vida cotidiana de las madres trabajadoras: la casa propia, el trabajo, los centros escolares, la casa de los abuelos, el centro de salud... Por eso el 35% de las mujeres que trabajan fuera de su hogar lo hacen cerca de su casa, en su mismo barrio, a diferencia de los varones, que lo hacen en un 20%. Esta estrategia supone una limitacin respecto de las oportunidades en el mundo del trabajo, pues se organiza en funcin del tiempo que debe invertir en los desplazamientos.

Tiempo de ocio o tambin tiempo libre


El DRAE define el ocio como el cese del trabajo, o el tiempo libre de la persona en contraposicin con el tiempo no libre es decir, el tiempo obligado. Existe una tercera acepcin, que es la que habla del ocio como diversin u ocupacin diversa, como el deporte, las aficiones, la vida social, etc. El tiempo libre es la oportunidad de cambiar de actividad y disponer de horas, minutos para hacer lo que queramos. El tiempo libre es una mercanca intercambiable por actividades elegidas por placer y sin obligacin, por decisin propia y que se encaminan a la relacin con las personas o la cultura y la actividad fsica. De nuevo los datos nos dicen que los varones disfrutan de ms tiempo de ocio, que tienen ms tiempo para s, para realizar vida social y dedicar este tiempo al deporte y otras actividades como la lectura o ver la televisin. Pero adems el ocio est muy dirigido y las mujeres a veces se ven sometidas a modas y situaciones que las hacen rebelarse contra lo que no les gusta: Mi madre cuando est libre plancha, mi padre no hace nada Yo entiendo el tiempo libre como libre. Pero por qu tengo que ir a la piscina si no s nadar, si no lo he hecho en mi vida? Estas dos frases, pertenecientes a un estudio realizado con el alumnado de las diplomaturas de Maestro (GUTIRREZ ESTEBAN, 2006), nos dan la oportunidad de pensar sobre lo que se considera tiempo libre y sobre la asimetra de este tiempo en las mujeres y los varones. En general las mujeres declaran que cuando tienen tiempo libre lo dedican a ver TV, a trabajos manuales para el hogar y en gran parte sus actividades se siguen realizando dentro de la vivienda.

El tiempo que me queda es el ttulo de un captulo escrito por Vantaggiato en el libro Una revolucin inesperada. Parafraseando se podra decir yo dedico todo mi tiempo a mi familia y el que me queda es para m, es mi tiempo libre. Ser muy difcil medir ese tiempo que nos queda despus de darlo
todo. Puede parecer una paradoja esa sensacin que tenemos las mujeres de no tener tiempo de nada cuando vivimos ms tiempo que nunca. Esto se explica porque existen distintos tiempos. En la Grecia clsica, el tiempo lo representaba Chronos, el padre de Zeus, que era el dios del tiempo homogneo, el que se deja dividir en horas minutos y segundos, o sea el que se puede comprar y vender con el dinero, el de la prisa. Y Kairs, que representaba los momentos significativos de la vida, el tiempo del sentido, ese tiempo valioso que contiene el refrn que dice: el tiempo es oro. Las mujeres vivimos esos dos tiempos, el de Chronos y el de Kairs, pero hoy nuestra civilizacin hace que estos dos tiempos entren en conflicto y cada vez son ms las mujeres que prefieren tener ms tiempo para ellas, lo que est originando un nuevo cambio cultural que en definitiva transformar el mundo del trabajo y obligar a la flexibilizacin horaria como ya est ocurriendo.

162 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada

Tiempo, mujeres y educacin


Ya sabemos que el tiempo es fundamental en las relaciones interpersonales. La educacin se basa en un sistema de interrelaciones y decimos que estamos aprendiendo de forma indefinida, lo que se conoce como formacin a lo largo de la vida. Socialmente se considera que la Escuela (entendida como el Sistema Educativo) es el lugar adecuado para la educacin y que cuanto ms tiempo se pase en ella mayor ser el nivel de formacin que alcance la persona. Por ello siempre se pide ms tiempo para la educacin. Durante el tiempo que el profesorado y el alumnado estn en el centro escolar ponen en escena sus roles, en sus diferentes modos de hacer, tanto retricos como didcticos. Estamos ante construcciones culturales que forman parte de las tradiciones corporativas. Dice Escolano (2000) que en las escuelas decimonnicas y de buena parte del siglo XX, el currculo diferenciado de nios y nias haca que la dedicacin temporal a las materias fuera asignada en funcin del sexo, dndose grandes diferencias. Estas diferencias se expresan en la elevada carga temporal de las labores que evidentemente solamente realizaban las nias dirigidas por sus maestras, mientras que los nios dedicaban estos tiempos a otras materias como la agricultura. El tiempo del profesorado es un tiempo que tiene un coste elevado y, por eso, el tratamiento debera hacerse en funcin de cada una de las personas y de sus responsabilidades dentro y fuera del sistema educativo. No es lo mismo el tiempo del profesorado, el tiempo del alumnado o el tiempo dedicado a la gestin educativa. Todos estn relacionados, pero su distribucin debe estar regida por la lgica y desde una visin globalizadota, tanto para las personas como para la institucin. Tal como indican Domnech Valls (1997), muchos son los estudios que se han realizado con el objetivo de explicar los usos del tiempo en la educacin, en la institucin escolar y para que sean ms flexibles y racionales con la distribucin. El tiempo en la institucin escolar se distribuye basndose en las decisiones de la administracin educativa y stas tienen un carcter uniformista monocroma segn Hargreaves (1992) que plantea diversos problemas cuando la realidad escolar aconseja cambios en funcin de la idiosincrasia de cada centro. Se han buscado alternativas y, ante la tradicional organizacin de horarios mosaicos, ahora se trabaja con otras variables que tengan en cuenta cuestiones relacionadas con el grupo, el nivel y las diferentes materias. Pero todos estos planteamientos estn referidos al tiempo del alumnado o del profesorado durante su estancia en el centro educativo. Sin embargo, el tiempo del profesorado debe comprender todas las actividades que componen sus tareas como profesional. Estas tareas son muy diversas y, adems, estn relacionadas con el desarrollo del currculo y con el proceso de enseanzaaprendizaje. Pero as como unas estn perfectamente definidas temporalmente, aquellas que se realizan en el centro escolar, otras que podramos considerar complementarias y se llevan a cabo en casa, en otros centros formativos, etc se dejan sin concretar y llegan a producir confusin cuando no estrs, por el nmero y volumen de trabajo que conllevan, junto con la implicacin y el esfuerzo que suponen. Adems encontramos fuertes desequilibrios y una variabilidad importante cuando observamos el uso de esos tiempos de forma individual. Los diferentes estudios sobre la gestin del tiempo insisten en que cada persona debe organizar sus actividades para hacer su trabajo de la mejor manera posible, pero siendo la educacin una profesin muy feminizada, son las mujeres las que se ocupan de ella y, por lo tanto, el componente de gnero aqu es, como en la sanidad, muy importante. La preocupacin de los y las docentes sobre la falta de tiempo para llevar a cabo los programas educativos es menos acusada en las maestras pues ellas tienen un pensamiento proactivo, son ms positivas y asignan con facilidad las actividades ms atractivas y menos rutinarias. Las maestras son proclives al cambio y no dudan en variar el tiempo que dedican a las tareas dependiendo de los resultados que obtienen. Sin embargo, el tiempo que se tiene que dedicar necesariamente a la organizacin y planificacin en los centros educativos a menudo es visto por las maestras, como tiempo perdido, pues se concreta en mltiples reuniones fuera del horario de trabajo en el aula con el alumnado, lo que implica que es un tiempo que como mujer, madre y cuidadora resta a su otra esfera de actuacin, la de su hogar. De nuevo estamos ente el problema de la doble jornada. Para Gimeno (2008), las mujeres perciben la necesidad de optimizar el tiempo que se dedica a las reuniones y sobre todo la necesidad de prepararlas, para que su desarrollo sea bajo un orden de temas y con un intercambio de puntos de vista que permitan llegar a acuerdos o conclusiones.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

163

M Rosa Luengo & Prudencia Gutirrez

Qu respuestas se pueden ofrecer? Algunas experiencias o acciones positivas


Como hemos visto, el modelo masculino no es generalizable, no responde a las necesidades de la vida humana. Si las mujeres adoptsemos ese modelo, quin asumira las tareas de cuidados domsticos? Hay que buscar alternativas. Se hace necesario un cambio en el paradigma que supone mirar, entender e interpretar el mundo desde la perspectiva de la reproduccin y de la sostenibilidad de la vida, desplazando el centro de atencin desde lo pblico mercantil hacia la vida humana, reconociendo en este proceso la actividad de cuidados realizada por las mujeres. No es un asunto de reparto de horas y, desde luego, implica una revolucin en la concepcin del mundo. Para conseguir cambiar el rumbo de los acontecimientos se necesit un cambio en la legislacin que hoy sirve de marco de actuacin para las personas que componen nuestra sociedad. As en Espaa, durante la transicin y tras la aprobacin de la Constitucin de 1978, se garantiza la igualdad de derechos entre mujeres y hombres. Adems tenemos que sealar como otro hito la aprobacin de la Ley Orgnica 3/2007 de 22 de marzo, para la Igualdad efectiva entre Mujeres y Hombres. Las acciones positivas son medidas que aceleran el proceso de igualdad y que, por favorecer directa o indirectamente al sexo en situacin de desventaja, tienen su razn de ser mientras persista la desigualdad y deben suprimirse cuando sta se alcanza. Las acciones positivas existen porque, pese a que en numerosos pases se recoge, a nivel constitucional o legal, el derecho a la no discriminacin por razn de sexo o a la igualdad de oportunidades, ningn pas ha alcanzado la igualdad de hecho. Por ello, en todos los mbitos se recoge la necesidad de establecer acciones positivas que aceleren el proceso de igualdad, en especial las que implican un cambio de estructuras, de mentalidad, de roles y de estereotipos. Se estn realizando campaas para que se prohban las jornadas laborales de tardenoche, que en Espaa son ms frecuentes que en otros pases. Se intenta racionalizar la organizacin temporal de las instituciones, suprimir tiempos muertos y, en general, aumentar la productividad en el empleo. La generalizacin en el uso de las TIC permitira concluir antes la jornada y la posibilidad de recuperar horas no trabajadas durante la semana fuera de los horarios habituales, pero cuidado con esto: es un arma de doble filo, pues se indica que el teletrabajo es un nuevo modo de explotacin laboral, especialmente para las mujeres, ya que no existe jornada laboral donde se contabilicen las horas de trabajo Por otra parte, algunas empresas adoptan medidas para favorecer a sus trabajadoras, poniendo en marcha planes de conciliacin. Hasta estamos asistiendo a la inclusin del tema de la conciliacin en la publicidad de productos de limpieza, como el famoso anuncio en el que se le enseaba a los chicos a poner la lavadora, o el que acaba de aparecer de una marca de verduras en el que un nio dice: Quiero comprar una hora de tiempo para mi mam y despus se ve a la madre y al nio jugando mientras una voz en off dice: con () tendrs ms tiempo para tu familia. Otro ejemplo: los Bancos de Tiempo tienen como objetivo promover intercambios para tareas de atencin a personas, sean menores, mayores o enfermos, y ofrecen la oportunidad para que las personas se conozcan y confen unas en otras para intercambiar pequeos servicios. Para su funcionamiento no se utiliza dinero, solamente se puede depositar tiempo, que se retira en el momento de ser utilizado. La unidad de intercambio es la hora. El funcionamiento es simple: una persona deposita unas horas de tiempo ofreciendo un servicio que desea dar y, a cambio, puede solicitar tiempo de otras personas para resolver algunas necesidades de la vida diaria. Cada persona adscrita al Banco de Tiempo dispone de un talonario de tiempo e informa mensualmente a la secretara del tiempo utilizado y recibido. Cada tres meses el banco informa sobre el estado de la cuenta y cada seis realiza una revisin global y avisa de las situaciones de desequilibrio, ya que el banco no puede acumular una diferencia superior a las 20 horas. Si no se utilizan se pueden transferir a otra persona. En la web del Ayuntamiento de Barcelona podemos encontrar adems el Programa NUST (Nuevos Usos Sociales del Tiempo), que propone y desarrolla otras polticas de buenas prcticas con proyectos en diferentes barrios, con oficinas NUST que lo gestionan. Su pgina web explica los pormenores de estas iniciativas municipales (www.bcn.cat/nust). Hay bancos del tiempo en varios ayuntamientos de Espaa, como San Javier en Murcia o Zaragoza, en Internet existe un banco del tiempo online

164 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

Enredadas en el tiempo. Mujeres, tiempo y educacin: una relacin condicionada

Finalmente y como conclusin, deberemos referirnos a la propuesta del pacto social para cambiar el reloj del tiempo. La actual lnea de pensamiento femenino propone el cambio social y supone el olvido del modelo masculino, obviando el aspecto econmico que rige todas las actuaciones de nuestra vida para adoptar un modelo que ponga en el centro de nuestras vidas las necesidades de bienestar de todas las personas, tanto a los hombres como a las mujeres, y nos permita ser nosotras mismas. ngeles Durn (2007) va ms all y nos dice que es un pacto de generaciones, pues en su opinin lo que realmente se est poniendo en juego son los cimientos de una sociedad nueva con la ruptura de las antiguas relaciones. Sin embargo, no podemos olvidar el papel que juega aqu la educacin. Entendemos que en la medida que seamos capaces de ensear otra forma de utilizar el tiempo a las nuevas generaciones, tanto en los centros educativos como en el ambiente familiar, podremos ir consiguiendo este cambio del que estamos hablando. Finalmente una reflexin: muchas son las noticias que a diario recibimos sobre el maltrato a las mujeres y la violencia de gnero que, poco a poco, va matando a algunas de las que se atreven a gastar su tiempo en lo que quieren, a actuar como personas libres, y se encuentran con la reaccin violenta de hombres que no son capaces de asimilar el cambio social que las mujeres hemos protagonizado. Esperamos que poco a poco esta sociedad comprenda que no se trata slo de un cambio en los tiempos de trabajo, ni del reparto del empleo; va ms all de un asunto de horas, implica el reconocimiento de que las mujeres son personas que gozan de las mismas obligaciones, pero no ms, y de los mismos derechos, pero no menos.

Referencias bibliogrficas
CARRASCO, C. (2005). Women in Spain: An adjusment variable between home and market. En De Sotelo (ed.). New women of Spain. Mnster: Lit Verlag (ed.). DOMNECH, J. & VALLS, J. (1997). La organizacin del espacio y del tiempo en el centro educativo. Barcelona: Gra. DURN, M A. (2007). El valor del tiempo. Cuntas horas te faltan al da? Madrid: Espasa. ESCOLANO BENITO, A. (2000). Tiempo y espacios para la escuela. Madrid: Biblioteca Nueva. FERNNDEZ VILLANUEVA, C., ET AL. (2003). La igualdad de oportunidades. Barcelona: Icaria. GIMENO SACRISTN, J. (2008). El valor del tiempo en educacin. Madrid: Morata. GUTIRREZ ESTEBAN, P. (2007). Insercin laboral del alumnado egresado de la Facultad de Educacin desde una perspectiva de gnero. Cceres: Servicio de Publicaciones Universidad de Extremadura. GUTIRREZ ESTEBAN, P. (2006). Propuesta de inclusin de contenidos sobre reparto de tareas del hogar en la formacin inicial del profesorado. En A. GIL (ed.), Actas del II Congreso de la Fundacin

Isonoma para la Igualdad de oportunidades entre mujeres y hombres: Mujeres jvenes: los Nuevos Feminismos? Castelln de la Plana: Universidad Jaume I.
GUTIRREZ, P. & LUENGO, M. R. (2007). La formacin inicial del profesorado y la transicin al mercado de trabajo del alumnado egresado de la Facultad de Educacin de la UEx desde una perspectiva de gnero. Campo Abierto, 26 (2). HARGREAVES, A. (1992) El tiempo y el espacio en el trabajo del profesor. Revista de Educacin, 298. <http://www.eclac.org/mujer/reuniones/tiempo/Cristina_Garcia.pdf>.[Consulta 25/02/2009, 18:1]. INE (2003). http://www.ine.es/revistas/cifraine/0407.pdf IZQUIERDO, M. J. (1998). El malestar en la desigualdad. Valencia: Ctedra. LAGARDE, M. (2003) Mujeres cuidadoras: entre la obligacin y la satisfaccin. SARE (2003). Cuidar cuesta: costes y beneficios del cuidado. EMAKUNDE. Victoria. LAGARDE, M. (2006). Pacto entre mujeres y sororidad. Ponencia. Madrid, 10 de octubre de 2006. Consulta: 28 diciembre de 2009, 14:02. Disponible en: [http://webs.uvigo.es/pmayobre/textos/ marcela_lagarde_y_de_los_rios/sororidad.pdf].
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

165

M Rosa Luengo & Prudencia Gutirrez

LUENGO, M. R. & BLZQUEZ, E. (2003). Gnero y libros de texto. Un estudio de estereotipos en las imgenes. Badajoz: IMEX. Junta de Extremadura. ONU (1995). Documentos de la Cuarta Conferencia Mundial sobre la Mujer (Beijing, 1995). Consulta: 8 diciembre de 2009, 11:58. Disponible en: [http://www.cinu.org.mx/biblioteca/ documentos/dh/ConfBeijing1995.htm]. OCDE (2007). El estudio PISA de la OCDE muestra que algunos pases han tenido mejoras significativas en sus resultados educativos. Consulta: 21 septiembre de 2009, 20:34. Disponible en:[http://www.oecd.org/document/26/0,3343,fr_2649_34487_39721626_1_1_1_1,00.html RAMOS, D. (1998). La medida del mundo. Gnero y usos del tiempo en Andaluca. SevillaMlaga. Instituto Andaluz de la Mujer.

166 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 155166

REALIDAD, PENSAMIENTO Y FORMACIN DEL PROFESORADO

REFERENCIA: Alzola, Nerea; Arratibel, Nekane; Mongelos, Arantza; Pedrosa, Begoa; Prez, Karmele & Uriarte, Leire (2010). Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea). REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragon Unibertsitatea)
NereaALZOLA NekaneARRATIBEL ArantzaMONGELOS BegoaPEDROSA KarmelePREZ LeireURIARTE
Correspondencia: NereaAlzola NekaneArratibel ArantxaMongelosGarca BegoaPedrosa KarmelePrezLizarralde LeireUriarteZabala Direccinpostal: FacultaddeHumanidades yEducacin UniversidaddeMondragon 20540Eskoriatza Telfono: (+34)943714157 Correoselectrnicos: nerea_alzola@huhezi.edu nekane_arratibel@huhezi.edu arantza_mongelos@huhezi.edu Begona_pedrosa@huhezi.edu karmele_perez@huhezi.edu leire_uriarte@huhezi.edu Recibido:24deabrilde2010 Aceptado:18deoctubrede2010

RESUMEN
Enesteartculo,elequipodetutorasquehaimplementado la materia inicial del ttulo de Grado de Maestro en la Facultad de Humanidades y Ciencias de la Educacin (HUHEZIMondragonUnibertsitatea)describesurealizacin yreflexionasobredichaexperiencia.Estamateria,realizada endosfases,estconcebida,enprimerlugar,comolabase detodounprocesodeformacin,deaprendizajeautnomo y de camino hacia un perfil profesional y ciudadano de los estudiantes. En segundo lugar, gua a los estudiantes hacia laautoregulacinylosentrenaenlaautoreflexin,enel diagnsticoylaconstruccindecompetenciaspersonalesy profesionales, y en la orientacin social, pedaggica y metodolgicadelaformacindegrado.

PALABRAS CLAVE: Formacin maestro, Competencias transversales,Interdisciplinariedad.

Defining and contextualising the professional profile of the school teacher at the HUHEZI Faculty of the Modragon Unibertsitatea (Spain)
ABSTRACT
Inthisarticle,thetutorswhohaveimplementedtheinitialmoduleinthenewPrimaryTeacherTraining degreeattheFacultyofHumanitiesandEducationSciences(MondragonUnibertsitatea)describehowit

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

169

Nerea Alzola, Nekane Arratibel, Arantza Mongelos, Begoa Pedrosa, Karmele Prez & Leire Uriarte

hasbeencarriedout,andreflectonthewholeexperience.Thismoduleisdividedintwopartsanditis understoodasatwofoldtrainingprocess.Firstofall,itisidentifiedasthebasisofatrainingprocessin autonomouslearning,andtowardsaprofileofthelearnersasprofessionalsandcitizens.Secondly,this processisvaluedastheinitialtrainingofthestudentsindifferentaspectslikeselfreflection,diagnosis and personal and professional competence construction. It also starts training them on social, pedagogicalandmethodologicalguidancethatwillbedevelopedthroughoutthedegree.

KEY WORDS: Teachertraining,Crossdisciplinaryskills,Interdisciplinarity.

Introduccin y antecedentes
En el curso 20092010 HUHEZI ha comenzado la implantacin de los Grados en Educacin Primaria y Educacin Infantil. En este artculo nos centramos en la narracin y reflexin sobre la materia que hemos diseado como punto de partida de la formacin en estos grados (Alzota, Arratibel et al. 2009). El proceso de diseo de la materia comenz con la preparacin del currculo de los grados mencionados. Partiendo de una visin general del perfil profesional y humano de nuestros futuros maestros, junto con la perspectiva general de nuestra organizacin y metodologa, diseamos con mimo esta materia para el primer curso. Dicha materia est concebida como introduccin a la formacin y a la orientacin bsica pedaggica y metodolgica de todo el grado en nuestra Facultad. Esta materia tiene dos fases: una primera presencial y una segunda no presencial, basada en el trabajo personal del alumnado a lo largo del curso. Este texto, en el que damos cuenta sintticamente del diseo y experiencia de la primera fase de la materia, tiene varios apartados que ayudarn al lector a caminar por esta propuesta: Proyecto educativo de la Facultad de Humanidades y Ciencias de la Educacin (HUHEZI) de Mondragon Unibertsitatea. Competencias transversales en los grados de maestro en HUHEZI. Sentido, objetivos y organizacin de la materia. ltimas reflexiones y mirada hacia el futuro.

Proyecto educativo de HUHEZI


La Facultad de Humanidades y Ciencias de la Educacin (HUHEZI) es una institucin universitaria perteneciente a la experiencia cooperativa Mondragn. Por lo tanto su titularidad, su organizacin interna, su vocacin y sus valores bsicos son coherentes con el cooperativismo. La organizacin democrtica (cada socio, un voto), la horizontalidad de los rganos de gestin, la solidaridad, la perspectiva social, la justicia, la importancia dada a cada persona y a su desarrollo, etc. son algunos de los fundamentos en los que se basa nuestra comunidad educativa. La sociedad del siglo XX se ha caracterizado por los rpidos cambios sociales y culturales, la globalizacin, las grandes tragedias ocurridas en Europa y en el mundo, la era de la comunicacin universal de mano de las tecnologas y el desarrollo de la sociedad del conocimiento, entre otros factores. En el cambiante contexto actual, a la educacin universitaria se le plantean nuevos retos, a los que debe responder estableciendo nuevos objetivos, nuevas formas de organizacin, as como nuevas formas y recursos para la enseanzaaprendizaje. Tenemos que aprender a pensar de nuevo o, como dira Hannah Arendt hace ms de 50 aos, hemos de pensar sin asideros (BRCENA, 2009: 121). Es decir, tenemos que combinar la aportacin de la autoridad del pasado (ciencia, filosofa, tradiciones, lenguas, valores tradicionales, modos de hacer, etc.) y la novedad radical en la que nacen y viven hoy los nios y los jvenes (las nuevas formas de organizacin social, los nuevos paradigmas culturales, las nuevas tecnologas, los nuevos tipos de comunicacin, la rapidez de los cambios cientficos, sociales y culturales, etc.).

170 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea)

Es decir, hemos de inventar caminos nuevos estando, con pragmatismo, atentos a los nuevos paradigmas cientficos, tecnolgicos, etc., pero sin olvidar lo simblico, lo potico, la tradicin humanista, como seala el pensador francs Morin (2010): [] no olvidemos que para revitalizar (las sociedades) se necesita un poco ms de

feminidad, de poesa, un poco ms de arte. Hay que tener entusiasmo, razones para reiniciar una esperanza colectiva en los jvenes, en las mujeres, en los hombres... Hay un montn de buenas voluntades, pero la buena voluntad sin esperanza queda desocupada. Y esa desocupacin de la buena voluntad genera desesperacin ante la barbarie.
Enraizada en esta realidad, Mondragon Unibertsitatea desarrolla un paradigma educativo que transita de un modelo que prioriza el aprendizaje de conceptos a un modelo que, sin olvidar las aportaciones de la sabidura humana, ha de crear nuevos escenarios de reflexin y actuacin. Nuestro proyecto educativo denominado Mendeberri se ha alimentado de muchas experiencias educativas universitarias o no y de pensadores sociales, pedagogos o filsofos de distintos paradigmas y procedenciasi, y prioriza los siguientes aspectos: El desarrollo de valores cooperativos: justicia, solidaridad, responsabilidad y participacin. El desarrollo de una serie de competencias profesionales y transversales. La creacin de una comunidad universitaria en la que la organizacin de los procesos de aprendizaje y de participacin tiene en cuenta el desarrollo individual y colectivo. La consideracin del aprendizaje como desarrollo personal, comunitario y como servicio a la sociedad. La creacin de una comunidad constantemente abierta a distintas culturas, conocimientos, lenguas, redes, formas de comunicacin.

Mondragon Unibertsitatea comenz a implementar el proyecto de innovacin Mendeberri en el curso 20022003. Este proyecto, que ha orientado claramente el diseo del currculum de los nuevos grados de formacin de maestros y maestras, se ha implementado en las diplomaturas de Magisterio a lo largo de los ltimos 8 cursos acadmicos y persigue los siguientes objetivos principales, que se mantienen vigentes en los nuevos grados diseados: Adecuar los contenidos a las exigencias del nuevo perfil profesional para posibilitar el desarrollo de las competencias necesarias para los maestros. Adecuar la estructuracin de los contenidos para facilitar el aprendizaje significativo (ARREGI, BILBATUA & SAGASTA, 2004). Desarrollar la perspectiva social del aprendizaje al servicio del bien comn.

As pues, el cambio metodolgico desarrollado en la Facultad apunta hacia un paradigma ms interactivo que transita: De un currculum basado en las asignaturas a un currculum interdisciplinar organizado en materiasii. De un currculum basado primordialmente en conceptos a un currculum basado tambin en competencias y valores. De un currculum orientado a temas a un currculum orientado tambin a problemas, casos o proyectos. De una metodologa basada principalmente en la transmisin unidireccional del profesor a una metodologa basada en la responsabilidad del estudiante sobre su propio aprendizaje, camino que es guiado por el profesortutor. Del rol del profesor experto al rol del profesor experto, tutor y facilitador. Del rol del aprendiz receptor al rol del aprendiz activo y responsable de su propio proceso de aprendizaje.

Uno de los caminos para conseguir este cambio descrito es el desarrollo de distintas competencias, tanto profesionales como transversales, entre las que se encuentran las competencias bsicas, comunicativas y tecnolgicas que se detallan ms adelante.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

171

Nerea Alzola, Nekane Arratibel, Arantza Mongelos, Begoa Pedrosa, Karmele Prez & Leire Uriarte

A lo largo del grado, los estudiantes, tal y como se detalla en el presente artculo, irn desarrollando las diferentes competencias planteadas.

Competencias transversales: bsicas, tecnolgicas y comunicativas


En la profesin de maestro (como en cualquier otra), adems de los conocimientos y competencias propias de la profesin, tambin es importante tener en cuenta otro tipo de competencias. Dentro de estas competencias que hemos denominado transversales (dado que se desarrollan durante todo el grado) se engloban las competencias bsicas, las tecnolgicas y las comunicativas. Estas competencias transversales, a su vez, se trabajan de forma ms intensa y especfica desde cada una de las materias en funcin de los objetivos, la metodologa y las caractersticas propias de cada materia, tal y como veremos ms adelante. COMPETENCIAS BSICAS En el proyecto educativo de HUHEZI se definen siete competencias transversales bsicas para trabajar en cada una de las titulaciones (GARCA, 2006). Dichas competencias son las siguientes: trabajo en equipo, comunicacin efectiva, pensamiento orientado a la resolucin de problemas, toma de decisiones, visin global de trabajo, liderazgo y aprender a aprender. Siendo conscientes de la dificultad que plantea trabajar todas estas competencias simultneamente y con la misma intensidad, se ha planteado una secuenciacin en el desarrollo de dichas competencias: secuenciacin en base a niveles (se han definido 4 niveles para cada competencia) y en base a qu competencias conviene trabajar ms intensamente en cada curso (en funcin de la metodologa, en funcin de la madurez de los aprendices, en funcin de los escenarios que se trabajan en clase, etc.). De esta forma se acord trabajar tres competencias bsicas en esta primera materia: trabajo en equipo, comunicacin eficaz y aprender a aprender. Y cada una de ellas se trabaj mediante talleres durante las tres semanas que dur la materia. La primera semana se trabaj la competencia de trabajo en equipo. El objetivo de esa semana era trabajar las cualidades de cada uno, qu aportaba cada individuo al grupo, y las potencialidades que tenan como grupo. Para ello se habl y discuti sobre qu es un grupo, sus caractersticas, los roles, la interaccin, los tipos de liderazgo y tcnicas para trabajar en grupo. La segunda semana se trabaj la competencia aprender a aprender. Teniendo en cuenta que el objetivo de esa semana era reflexionar sobre el perfil del docente, partimos de la reflexin sobre las tcnicas y estrategias de aprendizaje que utiliza cada uno, para ir tomando conciencia sobre los procedimientos adecuados para crear y transferir nuevos conocimientos. Para ello se trabaj sobre el propio proceso de enseanzaaprendizaje, la metacognicin, las estrategias y procedimientos para crear y transmitir nuevos conocimientos y la transferencia de esos conocimientos a otros mbitos de la vida. La tercera semana se trabaj la comunicacin efectiva. Aprovechando que los estudiantes deberan realizar una presentacin del proyecto que haban trabajado durante las tres semanas, se abordaron temas como qu es la comunicacin, aspectos del proceso de comunicacin, el feedback, la empata, la escucha activa y la asertividad. COMPETENCIAS TECNOLGICAS En cuanto a las competencias tecnolgicas, es evidente la presencia y uso mayoritario de las Tecnologas de la Informacin y la Comunicacin en nuestra sociedad. Los rpidos cambios que se estn produciendo en este mbito en los ltimos aos, nos obligan a convertirnos en aprendices permanentes y a estar actualizndonos constantemente. Hoy en da se utilizan cada vez ms los conceptos nativo digital e inmigrante digital (PRENSKY, 2001). Las nuevas generaciones, nuestros estudiantes, son nativos en la lengua digital de los videojuegos e Internet, y el resto tenemos puntos de encuentro con las tecnologas y las adaptamos y a su vez nos adaptamos a ellas, pero somos inmigrantes digitales. Parece que quien no est dispuesto a actualizar permanentemente sus conocimientos en este mbito, quedar en poco tiempo al margen de todos estos cambios. La escuela no es ajena a toda esta revolucin tecnolgica. Los docentes necesitan desarrollar las competencias tecnolgicas e integrarlas en los procesos de enseanzaaprendizaje. Pero las tecnologas per se no tienen ningn valor aadido en los procesos de enseanzaaprendizaje, tambin se pueden dar clases totalmente tradicionales sustentadas en las tecnologas (LARREA & VITORIA, 2009). Nuestro

172 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea)

objetivo es que las TICs sean un instrumento para desarrollar otro tipo de competencias como el trabajo en equipo, la comunicacin o aprender a aprender. Con este objetivo se han desarrollado varios talleres. El primero de ellos, sobre la plataforma

Moodle. El diseo y el desarrollo de Moodle se basan en una determinada filosofa del aprendizaje, una forma de pensar que a menudo se denomina pedagoga construccionista socialiii, que promueve la
colaboracin y la reflexin crtica. En base a esta pedagoga, los aprendices y el docente interactan entre ellos construyendo activamente nuevos conocimientos, fomentando la construccin social de dicho conocimiento, la cultura participativa y colaborativa, y compartiendo significados. En dicho taller se han trabajado las distintas herramientas (wikis, foros, bases de datos, etc.) y usos de la plataforma. En un segundo taller se han trabajado el conjunto de herramientas que ofrece Google Apps y sobre todo Google Docs, con el objetivo de fomentar una vez ms la comunicacin y el trabajo colaborativo entre los estudiantes. Las aplicaciones que se han trabajado han sido el correo electrnico, mensajera audiovisual, agenda, wiki para trabajos en grupo, buscador de informacin, etc. COMPETENCIAS COMUNICATIVAS La ltima de las competencias transversales que queremos desarrollar a partir del primer curso es la competencia comunicativa. Hay que tener en cuenta que uno de los pilares de nuestro proyecto educativo es promover futuros profesionales vascos multilinges, y es en esta primera materia donde comienzan a reflexionar sobre el papel que las lenguas tienen en su perfil profesional. Las competencias comunicativas juegan un papel muy importante en el perfil de nuestros estudiantes: por un lado, deben lograr un buen nivel en las lenguas del currculo (euskera, castellano e ingls); y, por otro lado, como futuros profesionales de la educacin, sern modelos para sus futuros estudiantes y debern responder tanto ante la institucin educativa como ante las familias. Por ello uno de los objetivos de nuestro currculo es que todos los aprendices logren un nivel C1iv en las dos lenguas oficiales de la CAV y un nivel B2 en lengua extranjera. En el Pas Vasco se han realizado varios estudios para analizar las actitudes, las orientaciones de los sujetos hacia el aprendizaje de las lenguas y su posible influencia en el uso y/o el aprendizaje de stas (ARRATIBEL, 1999; LARRAAGA, 1995; LASAGABASTER, 2003, 2004, 2007; MADARIAGA, 1994; PERALES, 2001; SAGASTA, 2000). El objetivo, en esta primera materia, es reflexionar con los nuevos estudiantes sobre las lenguas en el mbito personal, institucional y social, y sobre el papel que stas tienen de cara a su perfil profesional: qu papel juegan estas lenguas en nuestro perfil profesional? qu competencias debemos desarrollar en relacin a cada lengua? por qu y para qu? Esas son algunas de las preguntas que se plantean en los talleres impartidos en esta primera materia. En cursos anteriores hemos ido observando actitudes no muy positivas hacia el aprendizaje de las lenguas (euskera, castellano o ingls) en general (PEDROSA, 2008); es por ello que llevamos aos apostando por crear un proyecto de lengua adecuado, que motive y haga entender a los estudiantes la importancia y el lugar que estas lenguas tienen de cara a su perfil profesional. Y es por eso, tambin, que llevamos a cabo un taller sobre actitudes lingsticas a principio de curso. En lo que a la lengua vasca se refiere, los estudiantes deben ser conscientes de la importancia que esta lengua tiene en el currculo y de la labor que como futuros educadores deben llevar a cabo para reforzar la lengua vasca en el mbito educativo. Adems, deben comprender que, siendo la lengua vehicular a lo largo de sus estudios de grado, deben hacer un esfuerzo por utilizarla en el da a da, no slo en el mbito acadmico, sino tambin en el social. Algunos de los estudiantes proceden de mbitos sociolingsticos donde predomina la lengua castellana, y es por ello que se encuentran con una oportunidad de oro para practicar y reforzar su competencia en lengua vasca. La nueva reforma de los estudios de Magisterio, dentro del proceso de Bolonia, ha eliminado las asignaturas especficas de lengua y ha potenciado el currculum basado en contenidos. El planteamiento es ensear lengua por medio de contenidos que sean relevantes para el perfil profesional de los estudiantes, ya que de este modo adquirirn competencias comunicativas relevantes y situadas (GARRO, PEDROSA, PEREZLIZARRALDE & SAGASTA, 2010). Para ello se han creado dos materias (una en primer curso para fijar los criterios de inicio y marcar las bases para todo el grado; y otra en el cuarto curso, para retomar lo aprendido, completarlo, afianzarlo y evaluarlo) cuyo objetivo es desarrollar las competencias comunicativas en las tres lenguas del currculo de manera integrada y hacer reflexionar a los estudiantes sobre las transferencias que pueden llevar a cabo de una lengua a otra de forma estratgica y lgica.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

173

Nerea Alzola, Nekane Arratibel, Arantza Mongelos, Begoa Pedrosa, Karmele Prez & Leire Uriarte

SISTEMAS DE TRABAJO PARA EL DESARROLLO DE LAS COMPETENCIAS El desarrollo de todas esas competencias se realiza a travs de distintos sistemas de trabajo en diferentes fases de la titulacin de grado. Los ejes sobre los que pivota este planteamiento son tres: Sensibilizacin y formacin de los agentes implicados, fase en la cual se reflexiona sobre la importancia de estas competencias y su estrecha unin con la proyeccin laboral de los titulados. Adems se forma tanto a estudiantes como a profesores en los ncleos de conocimiento necesarios para que dichas competencias puedan desarrollarse y trabajarse de manera consciente y efectiva a lo largo de la titulacin. Coordinacin y seguimiento del currculum, para que se pueda saber qu competencias se priorizan en cada materia, si existen competencias que no se trabajan lo suficiente y si la secuenciacin en la manera de trabajarlas es la adecuada. Todo esto se articula con dispositivos como seminarios de tutores de materias, grupos de coordinadores de materia, etc. Coordinacin y seguimiento respecto a los estudiantes. Se realiza un sistema de tutoras de manera que cada estudiante pueda reflexionar y contrastar con su tutor las competencias que va desarrollando, en qu medida, con qu obstculos se encuentra, etc. y que pueda recibir la orientacin necesaria para poder superarlos. Para ello se incorpora el portfolio electrnico que los estudiantes desarrollarn durante los cuatro aos del grado. El objetivo de dicho portfolio es acompaar el proceso de enseanza y aprendizaje entendido como un camino progresivo de mejora metacognitiva, que lleva al estudiante hacia la autonoma, definida como la habilidad de hacerse responsable del aprendizaje de uno mismo (HOLEC, 1981), es decir, autonoma, no como independencia, sino como facultad de tomar

decisiones que permitan regular el propio aprendizaje para aproximarlo a una determinada meta, en el seno de unas condiciones especficas que forman el contexto de aprendizaje
(MONEREO, 2001:12). Varias caractersticas describen a este porfolio. Por un lado, el aprendiz se responsabiliza de la gestin de su portfolio, estableciendo sus propios objetivos, espacios, ritmos de trabajo, etc. Por otro lado, el portfolio permite al estudiante compartir sus experiencias de aprendizaje con compaeros y/o tutores. Por lo tanto, el enfoque de enseanza pretende que los sujetos desarrollen aprendizajes profundos, estableciendo relaciones entre las experiencias de aprendizaje que se desarrollan en varios contextos y no slo en la clase (BARBER, GEWERC & RODRIGUEZ, 2009). Desde esta perspectiva se fomentan la reflexin, la comunicacin, la colaboracin, aprender a aprender, trabajar en grupo, etc.

Sentido, objetivos y organizacin de la materia


JUSTIFICACIN DE LA MATERIA El objetivo principal de esta materia es posibilitar la metareflexin inicial sobre el perfil, las competencias generales y las funciones del maestro en la sociedad del conocimiento. Se trata de ahondar en el imaginario colectivo sobre el buen profesor y contrastarlo con el anlisis sobre las funciones del profesor en la complejidad de la relacin entre escuela y sociedad. Para contribuir al pleno desarrollo de las potencialidades y capacidades humanas a las que debe aspirar la educacin del siglo XXI, el maestro debe dotarse, adems de las profesionales, de determinadas competencias emocionales y sociales. En lo que a las competencias profesionales se refiere, se incide, por un lado, en la comprensin sobre la importancia del maestro en el Proyecto Educativo y de la educacin en el desarrollo de una sociedad democrtica. Tambin se dan a conocer las bases tericas que subyacen al desarrollo de las competencias profesionales necesarias para el desarrollo del perfil del docente. Todo ello unido a la toma de conciencia de la diversidad y complejidad del alumnado. Por otro lado, a lo largo de la materia se van identificando aquellas competencias y habilidades que permitirn desempear adecuadamente el rol del profesor, que a su vez asume la funcin de comunicador y facilitador. Todas estas caractersticas se analizan a partir de la prctica de los estudiantes, relacionando sus competencias personales con el desarrollo del perfil profesional. Esa reflexin sobre la funcin del docente se lleva a cabo en el marco de un proyecto educativo en el que el

174 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea)

aprendizaje significativo, as como la perspectiva social del mismo, adquieren especial relevancia, tal y como se ha mencionado anteriormente. La coherencia entre el proyecto educativo de HUHEZI, la metodologa y los contenidos facilita que los estudiantes comprendan el sentido de la materia. ORGANIZACIN DE LA MATERIA La organizacin de la materia ha estado en manos de un equipo multidisciplinar de profesoras: especialistas en competencias bsicas, tecnolgicas y comunicativas, especialistas en pedagoga y ciencias sociales, que han seleccionado los contenidos y han tutorizado a los grupos de estudiantes durante las tres semanas que ha durado la primera parte de la materia, la parte presencial. La materia tiene otra parte no presencial que se evaluar en junio, en la cual se irn recogiendo las reflexiones de los estudiantes sobre su proceso de aprendizaje mediante el portfolio digital anteriormente mencionado. Con el fin de guiar a los estudiantes hacia los objetivos expuestos, en la parte presencial hemos planteado una secuenciacin en tres bloques, y cada bloque se ha desarrollado en una semana. Cada semana ha tenido como eje una pregunta clave que ha guiado a los estudiantes en el desarrollo de su trabajo y les ha llevado tambin a comprender las competencias y contenidos de la semana. Las preguntas gua han sido las siguientes: quines somos?, hacia dnde vamos? y qu nos ofrece

HUHEZI?
En cuanto a la metodologa utilizada para llevar a cabo este proceso, se puede caracterizar por su diversidad. Esa diversidad ha sido especialmente reseable en dos aspectos: en la diversidad de agrupamientos y en la diversidad de actividades y tareas. Grupo colaborativo: es el grupo de referencia para los estudiantes, formado por una tutora y 17 18 estudiantes. En estos grupos los estudiantes pueden contrastar sus conocimientos previos con situaciones nuevas y, de este modo, pueden comparar puntos de vista diferentes, contrastar opiniones y plantearse retos relacionados con la pregunta clave de esa semana. A su vez, los estudiantes forman pequeos grupos de 45 para llevar a cabo sus proyectos y preparar las presentaciones orales. Grupo intermedio: formado por dos grupos de referencia que comparten tutora. En estos grupos han realizado talleres o sesiones prcticas que se han centrado bsicamente en las competencias trasversales mencionadas en el apartado anterior. Grupo extenso: formado por dos o tres grupos intermedios, segn las necesidades de las tareas a realizar. A este grupo han ido dirigidas las conferencias. Estas conferencias son una fuente de input importante para completar el trabajo en grupo que deben presentar al final de cada semana y al finalizar la materia.

El objetivo de esta organizacin es que los estudiantes logren, por un lado, unir los conceptos trabajados de forma lgica y coherente en relacin a las preguntas planteadas en la primera sesin de grupo colaborativo; y por otro, que vayan desarrollando y poniendo en prctica el trabajo en equipo y el trabajo individual. La evaluacinv de la materia se realiza en dos partes: el 70% de la nota al terminar la primera fase presencial, y el 30% de la nota al finalizar el curso y evaluar el trabajo realizado en el portfolio. En la primera fase se tienen en cuenta los siguientes elementos: en primer lugar, la implicacin y responsabilidad del estudiante en el grupo colaborativo y en los distintos talleres (propuestas, aportaciones fundamentadas, uso de las fuentes trabajadas, comprensin de conceptos bsicos, etc.); en segundo lugar, el proyecto que se compone de dos producciones, una realizada en pequeo grupo y que los estudiantes socializan mediante una exposicin oral y otra, realizada de forma individual, que supone un diagnstico y una reflexin de cada estudiante sobre sus propias competencias y que servir de base para el proceso que ste realice durante el curso. Finalmente, en lo que respecta a la secuenciacin, se han querido organizar los contenidos en una secuencia de actividades variadas pero con una lgica clara, de manera que los estudiantes puedan identificar qu y para qu estn realizando esa tarea en cada momento. Tal y como se puede observar en el cuadro I, los contenidos de la semana se presentan y discuten en las sesiones de grupo colaborativo del lunes y se profundizan mediante conferencias y lecturas; las competencias trasversales se trabajan en los talleres; los aprendizajes y conclusiones de los estudiantes se presentan por mediacin de presentaciones orales (grabadas en vdeo para el trabajo posterior en el desarrollo de las competencias comunicativas) en la sesin del viernes, donde intentan enlazar los contenidos trabajados en los diferentes escenarios.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

175

Nerea Alzola, Nekane Arratibel, Arantza Mongelos, Begoa Pedrosa, Karmele Prez & Leire Uriarte

Quines somos?

Hacia dnde vamos?

Martes 15 Mircoles 16 Taller:Moodle. Taller:Las lenguasyyoI. Sesinde discusin. Taller:trabajo enequipoI. Taller:trabajo enequipoI. Conferencia:El desarrollo integral,base delafelicidad. Lunes 21 Martes 22 Mircoles 23 Sesinde Conferencia: Tcnicasde discusin. Nuestro comprensin proyecto detextos Taller:Las educativo. cientficos. lenguasyyoII. Conferencia:Yo Taller:Aprender aaprenderI. soyprofesor.

Lunes 14 Presentacin delcurso. Presentacin delamateria. Juegosde animacin.

Jueves 17 Taller:trabajo enequipoII. Taller:Google Aps.

Viernes 18 Presentacin oraldetrabajos degrupos pequeosen sesinde discusin.

A dnde hemos venido?

Lunes 28 Martes 29 Conferencia:El Taller:El cooperativismo. cooperativismo. Taller: Visitay Comunicacin explicacinde efectivaI. losservicios queofrecela facultad.

Mircoles 30 Taller: comunicacin efectivaII. Conferencia: Nuestro proyecto lingstico.

Jueves 24 Laeducacin enelcine: Buscandoa Forrester. Taller: Aprendera aprenderII. Tutorade seguimiento. Jueves 1 Taller:El portafolio electrnico Tutorade seguimiento.

Viernes 25 Presentacin oraldetrabajos degrupos pequeosen sesinde discusin.

Viernes 2 Presentacin oralde proyectosde grupos pequeosen sesinde discusin. Entregadel proyecto personal escrito.

CUADRO I: Organizacin y contenidos de la materia

Primera semana: Quines somos? Rasgos y cualidades de las personas y del grupo. Los estudiantes han reflexionado sobre sus cualidades como individuos y como grupo. A lo largo de esta semana se han trabajado contenidos relacionados con la inteligencia emocional: qu cualidades tenemos y qu cualidades nos gustara tener? Para trabajar estos contenidos se han organizado sesiones de grupo colaborativo con el tutor para reflexionar sobre nuestras caractersticas personales como individuos y como grupo, y se han utilizado diferentes tipos de input como poesas o textos. Adems de esto, se han ofrecido dos conferencias relacionadas con las preguntas de reflexin. Los estudiantes han trabajado en grupos pequeos para preparar su pequea reflexin final y tambin han asistido a varios talleres relacionados con las competencias trasversales: reflexin sobre las lenguas y trabajo en equipo. Segunda semana: Hacia dnde vamos? El perfil del docente. Los estudiantes han reflexionado sobre el perfil de un buen docente. Para ello, en primer lugar, han partido de su experiencia personal identificando caractersticas del buen docente: cmo eran mis profesores y profesoras en el pasado? o por qu eran buenos docentes? por qu no? A partir de esas reflexiones compartidas se ha profundizado en las competencias que debe adquirir un buen docente, tanto trasversales (la comunicacin, las nuevas tecnologas, las competencias bsicas trabajo en equipo, aprender a aprender y comunicacin efectiva) como profesionales (comprensin de la diversidad y la complejidad del alumnado). A lo largo de la semana tambin se les ha impartido una conferencia sobre el proyecto educativo de la facultad. Tercera semana: A dnde hemos venido? Caractersticas de HUHEZI. Queremos que entiendan cmo, por qu y en qu les pueden ayudar el proyecto educativo y lingstico de HUHEZI as como la naturaleza cooperativa, de esta institucin en la consecucin del

176 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea)

perfil que hemos definido con ellos. Como entidad cooperativa HUHEZI se caracteriza hacia el interior por su organizacin democrtica y hacia el exterior por su compromiso social. HUHEZI es una organizacin basada en la soberana de las personas que, junto con otras organizaciones autogestionarias en mbitos tan diversos como la industria, el crdito o el consumo, conforman la experiencia cooperativa de Mondragn. Esta experiencia tiene como horizonte un proyecto de transformacin ms amplio que se resume en las siguientes palabras de Jos Mara Arizmendiarrietavi (19151976): se ha dicho que el

cooperativismo es un movimiento que emplea la accin educativa, pudiendo tambin alterarse la definicin afirmando que es un movimiento educativo que utiliza la accin econmica (AZURMENDI,
1999).

ltimas reflexiones y mirada hacia el futuro


Como ya hemos sealado, esta materia de 10 ECTS se desarrolla en dos tiempos: una intensiva de tres semanas y una segunda fase desarrollada a lo largo del curso. En la primera fase, los estudiantes estn concentrados exclusivamente en las actividades y sesiones propuestas por el equipo de dicha materia. Tras su implementacin, realizada a comienzo de curso, apuntamos algunas reflexiones con respecto al profesorado y al alumnado. Por parte de las tutoras implicadas, consideramos que el trabajo interdisciplinar es muy valioso para nosotras mismas y un medio imprescindible en este momento para ofrecer una formacin profesional y humana integrales. Como escriben Alzola & Mongelos (2009):

[] estamos convencidas de que nuestra forma de funcionar, nuestra organizacin, nuestro modo de hacer cooperativo tiene una enorme influencia en la coherencia del proyecto educativo y en la creacin de los distintos escenarios de aprendizaje, sea cual sea la metodologa elegida. [] (Asimismo) para el trabajo y desarrollo de las competencias y valores, la metodologa y la organizacin son ejes principales.
En este sentido, estamos viviendo en primera persona la experiencia del aprendizaje cooperativo, con compaeras de distintas especialidades o trayectorias acadmicas; mediante la crtica constructiva, la pregunta y la reflexin aprendemos y avanzamos hacia una mayor calidad y coherencia. En cuanto a las percepciones del alumnado, en esta primera parte de la materia recogemos varios aspectos importantes: el gran cambio que viven, y as lo expresan, entre las metodologas y el estilo experimentados en su trayectoria acadmica previa y la metodologa y estilo de enseanzaaprendizaje con los que se encuentran en esta primera materia (en muchos casos supone su primera experiencia de interdisciplinariedad) y, adems se encuentran con una gran exigencia en el trabajo colaborativo. Por otra parte, es destacable el alto grado de satisfaccin expresado con respecto a las tutoras (8,1) y a la materia (7,6)vii. Por su parte subrayamos como una buena aportacin de la materia la realizacin de las primeras autoreflexiones con respecto a las propias capacidades, competencias y su autoestima y, asimismo, la conciencia por parte del estudiante de la distancia con respecto al perfil profesional y los caminos para la mejora y el progreso. En cuanto a la segunda fase, tal y como se ha comentado anteriormente, se desarrolla a lo largo de todo el curso. En esta fase cada estudiante, con la ayuda de un tutor, realiza su portfolio en el que va plantendose sus retos de aprendizaje con relacin a las distintas competencias transversales. Para poder analizar el avance experimentado, el estudiante parte de un anlisis de diagnstico inicial y, posteriormente, va recogiendo muestras de su trabajo reflexionando sobre su progreso y teniendo en cuenta diferentes evidencias sobre cada una de las competencias planteadas. En nuestra Facultad, a lo largo de los aos, hemos hecho algunos ensayos en el acompaamiento tutorizado de los estudiantes, pero este proceso tan complejo sigue siendo relativamente desconocido para nuestros equipos y supone varios retos. Entre ellos, los ms importantes son los siguientes: la progresin del desarrollo de las competencias y sus evidencias; el consenso de criterios bsicos de evaluacin (cmo evaluar ciertas competencias, el peso en las calificaciones, etc.) y la formacin y dedicacin de los tutores que han de acompaar en el proceso a los estudiantes. Igualmente, el camino realizado en el mundo de las tecnologas de la informacin y la comunicacin es notorio, pero observamos que son uno de nuestros retos de futuro. Pretendemos que

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

177

Nerea Alzola, Nekane Arratibel, Arantza Mongelos, Begoa Pedrosa, Karmele Prez & Leire Uriarte

las TICs puedan llegar a ser un instrumento, no slo para la informacin y la comunicacin, sino tambin para llegar a desarrollar valores acordes con nuestros principios como el respeto y la solidaridad a travs de la red y las distintas formas de comunicacin. Estos retos suponen un gran cambio cultural, tanto para profesores como para estudiantes, y posiblemente tendremos que ir avanzando con pequeos pasos. Lo importante es la orientacin de ese avance. En este caminar, y durante el presente curso acadmico en el que implementamos la materia y el portfolio, hemos de evaluar el trabajo realizado y los resultados obtenidos, para as extraer conclusiones prcticas aplicables. Finalmente, queremos destacar la importancia de reflexionar sobre nuestra planificacin e intervencin, resolver conjuntamente las dudas, formularnos preguntas y escribir acerca de esta experiencia. Este complejo proceso, vivido de forma compartida, nos est ayudando a comprender mejor esta experiencia para, de este modo, abordarla en un futuro con mayor xito y profesionalidad. Estamos convencidas del espritu de la materia, de la lnea iniciada, pero la realidad nos ir proporcionando pistas para que, mirando al horizonte dibujado, encontremos las mejores rutas no necesariamente atajos para ayudar a nuestros estudiantes en su desarrollo personal, social y profesional de la mejor manera posible.

Referencias Bibliogrficas
ALZOLA, N. & MONGELOS, A. (2009). La interdisciplinariedad como fuente de cambios organizativos en la Facultad HUHEZI de Mondragon Unibertsitatea. Espacios de asesoramiento, reflexin y decisin. Seminario de reflexin REDUUSC: La coordinacin mediante equipos docentes en ES: fortalezas, recursos y necesidades. Santiago. ALZOLA, N., ARRATIBEL, N., MONGELOS, A., PEDROSA, B., PREZ, K. & URIARTE, L. (2009). Gua del estudiante 20092010: Haur Hezkuntzako eta Lehen Hezkuntzako irakaslelanbidearen definizio eta testuingururatzea eta gaitasun orokorren garapena. 20092010. Eskoriatza: HUHEZI (documento interno
no publicado).

ARRATIBEL, N. (1999). Helduen euskalduntzean eragiten duten prosezu psikosozialak: motibazioaren errola. Bilbao: Euskal Herriko Unibertsitatea. ARREGI, X., BILBATUA, M. & SAGASTA, P. (2004). Innovacin curricular en la Facultad de Humanidades y Ciencias de la Educacin de Mondragon Unibertsitatea: Diseo e implementacin del perfil profesional del maestro de Educacin Infantil. Revista Interuniversitaria de Formacin del Profesorado, 18 (1), 109129. AZURMENDI, J. (1999). Pensamientos de Don Jos Maria Arizmendiarrieta. Aretxabaleta: Otalora (Azatza). BARBERA, E., GEWERC BARUJEL, A. & RODRIGUEZ ILLERA, J. L. (2009). Portafolios electrnicos y educacin superior en Espaa: Situaciones y tendencias. Revista de Educacin a Distancia. Nmero monogrfico VIII. BRCENA, F. (2009). Una pedagoga del mundo. Aproximacin a la filosofa de la educacin de Hannah Arendt. Anthropos, 224, 113138. CRUZ, J. (31/01/2010). Entrevista a Edgar Morin, socilogo y escritor francs: Para qu sirve Europa.

El Pas.
GARCIA, M. (2006). Zeharkako konpetentziak lantzeko proposamena. HUHEZI. Documento interno no publicado. GARRO, E., PEDROSA, B., PEREZ LIZARRALDE, K. & SAGASTA, P. (2010). El reto del plurilingismo aditivo: la planificacin lingstica de HUHEZI en los estudios de grado de Educacin Infantil y Educacin Primaria. En DOLZ & IDIAZABAL, Hacia una enseanza integrada de lenguas (en preparacin). HOLEC, H. (1981). Autonomy in Foreign Language Learning. Oxford: Pergamon. LARRAAGA, N. (1995). Euskararekiko jarrerak eta jokabideak. Bilbao: Universidad de Deusto. LARREA, I. & VITORIA, J. (2009). IKTak, hezkuntza aireberritzeko aitzakia. Jakingarriak, 65, 1825. LASAGABASTER, D. (2003). Trilingismo en la enseanza. Actitudes hacia la lengua minoritaria, la mayoritaria y la extranjera. Lleida: Milenio.

178 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

Definicin y contextualizacin del perfil profesional del maestro en HUHEZI (Mondragn Unibertsitatea)

LASAGABASTER, D. (2007). Language use and language attitudes in the Basque Country. En LASAGABASTER, D. & HUGUET, A., Multilingualism in European Bilingual Contexts. Language use and attitudes. Clevedon: Multilingual Matters, 6589. MADARIAGA, J. (1994). El papel de las actitudes en la educacin bilinge. Estudio comparativo realizado segn los modelos A y D. En I. IDIAZABAL & A. KAIFER, Eficacia educativa y enseanza bilinge en el Pas Vasco. Coleccin Tesis Doctorales. Instituto Vasco de Administracin Propia. MONEREO, C. (2001). Ser estratgico y autnomo aprendiendo. Unidades didcticas de enseanza estratgica para la ESO. Barcelona: Grao. PEDROSA, B. (2008). El efecto Pygmalion: un estudio del componente actitudinal entre profesorado en formacin. Suficiencia investigadora. Trabajo sin publicar. PERALES, J. (2001). Gainbegirada bat hizkuntza jarrerei Euskal Herrian. Bat Sociolingstica Aldizkaria 40, 89110. PRENSKY, M. (2001). Digital Natives, Digital Immigrants. On the Horizon MCB University Press, Vol. 9, 5. SAGASTA ERRASTI, M. P. (2000). La produccin escrita en euskara, castellano e ingls en el modelo D y en el modelo de Inmersin. Tesis Doctoral. Universidad del Pas Vasco. Euskal Herriko Unibertsitatea. SAGASTA ERRASTI, M. P. (2005). Desarrollo y experimentacin de un nuevo proyecto educativo: El proyecto Mendeberri en la Facultad de Humanidades y Ciencias de la Educacin de la Universidad Mondragn. En Mondragon Unibertsitatea. La Educacin Superior hacia la Convergencia Europea: modelos basados en el aprendizaje. Mondragon: Mondragon Unibersitatea, 123135. SS8272007 http://docs.moodle.org/es (ltima fecha de consulta 28 febrero 2010).
i En los ltimos aos hemos consultado y contrastado con distintas universidades europeas y americanas adems de con profesionales de educacin infantil y primaria. Asimismo hemos bebido de autores como Delors, Morn, Freire, Bruner o Vygotsky, por citar algunos. ii Estas materias renen, a menudo, saberes de distintas ramas y asimismo equipos docentes multidisciplinares. En el nuevo Grado de Maestro, estas materias tienen entre 6 y 10 ECTS. iii http://docs.moodle.org/es iv Marco Europeo de Referencia de las Lenguas v Para conocer ms detalles del proceso de evaluacin, se puede consultar la gua del estudiante 20092010 vi Pensador y promotor de la experiencia cooperativa Mondragon. vii Al finalizar la primera fase de la materia se pidi a los estudiantes cumplimentar un cuestionario de satisfaccin. Los resultados obtenidos se encuentran disponibles en un documento interno de la Facultad.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 169179

179

REFERENCIA: Astudillo, Carola; Rivarosa, Alcira & Ortiz, Flix (2010). Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (dd-mm-aa):)

Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas


CarolaASTUDILLO AlciraRIVAROSA FlixORTIZ
Correspondencia: CarolaAstudillo Correoelectrnico: castudillo@rec.unrc.edu.ar AlciraRivarosa Correoelectrnico: arivarosa@exa.unrc.edu.ar FlixOrtiz Correoelectrnico: fortiz@exa.unrc.edu.ar Telfonocomn: +540384676173 Direccinpostalcomn: Dpto.deCienciasNaturales FacultaddeCienciasExactas, FsicoQumicasyNaturales UniversidadNacionaldeRoCuarto Ruta36,km.601 (5800)RoCuarto.Crdoba. Argentina. Recibido:28deagostode2010 Aceptado:10denoviembrede2010

RESUMEN
Sedescribeyfundamentaunesquemametodolgicoparael estudio de procesos de cambio y movilizacin de concepciones y prcticas de enseanza, impulsados en el marco de un diseo de formacin para profesores de Ciencias. Al respecto, se desarrollan tres fases de decisin: a)anlisistericodelproblema;b)diseodelescenariode formacin;yc)definicindesistemasdeanlisisdedatos. Se espera ofrecer un modelo para pensar estudios en contextos orientados a la validacin, refinamiento y creacindetrayectosdeformacindocenteque,desdeuna perspectiva de cambio didctico, desafen genuinamente concepcionesyrutinasprofesionales.

PALABRAS CLAVE: Formacin de profesores, Diseos instructivos,Metodologadeinvestigacin,Enseanzadelas ciencias.

Analysing a training design for science teachers: methodological considerations


ABSTRACT
Thispaperdescribesamethodologicalframeworkforthestudyofactionandchangeprocessesofideas and teaching practices, driven as part of a training design for science teachers. In this regard, three

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

181

Carola Astudillo, Alcira Rivarosa & Flix Ortiz

decisionphasesareestablished:a)theoreticalanalysisoftheproblem,b)teachertrainingdesign,andc) definitionofsystemsfordataanalysis. We hope to provide a model to think about studies in context aimed at validation, refinement and development of teacher training routes that challenge ideas and professional routines from a perspectiveofeducationalchange.

KEY WORDS: Teachertraining,Instructionaldesigns,Researchmethodology,Scienceeducation.


1. Introduccin y antecedentes
Cmo disear trayectos formativos que contribuyan a formular respuestas a los nuevos desafos de alfabetizacin cientfica? Por qu recuperar en la formacin docente concepciones y actitudes sobre la ciencia, su enseanza y aprendizaje? Cmo construir escenarios de formacin que promuevan la articulacin teoraprctica? Cmo promover la evolucin del conocimiento profesional docente? Estos y otros interrogantes han motivado el proyecto de investigacin que nos proponemos presentar en este artculo y que nos encontramos desarrollando con el propsito de articular, por un lado, las lneas de investigacin acerca del pensamiento del profesor de Ciencias y por otro, el desarrollo de diseos de formacin que, recuperando una perspectiva de cambio didctico, desafen genuinamente concepciones y rutinas profesionales (FELDMAN, 1992; MAIZTEGUI ET. AL., 2000; ADRIZ BRAVO ET AL., 2002; FERNNDEZ ET AL., 2003; ADRIZ BRAVO ET AL., 2004; CARRASCOSA ET AL., 2008). En otras palabras, la intencin es pensar experiencias formativas alternativas y retroalimentarlas con el estudio de los procesos de cambio o movilizacin que stas impulsan. Especficamente, el objetivo del presente trabajo es describir y argumentar las decisiones metodolgicas adoptadas en el seno de un proyecto de investigacin cuyo objetivo es caracterizar los procesos de movilizacin de concepciones y prcticas de docentes que participan en una experiencia de formacin en Didctica de las Ciencias. Dichas decisiones metodolgicas se sustentan en los principios de lo que la bibliografa en investigacin educativa ha dado en llamar estudios de diseo. Esta denominacin refiere a un modelo de investigacin cualitativa orientado al estudio y refinamiento de diseos educativos y al desarrollo de categoras tericas para pensar innovaciones (REIGELUTH & FRICK, 1999; COBB ET AL., 2003; COLLINS ET AL., 2004). El modelo sita en el centro de la escena el desarrollo de investigaciones de diseos de formacin o instruccin pero que permitan formular categoras tericas que puedan servir en nuevos diseos pensados para otros contextos (REIGELUTH & FRICK, 1999; COBB ET AL., 2003; COLLINS ET AL., 2004). Son tres las fases de decisin que conforman la ingeniera metodolgica de un estudio de diseo y en base a ellas, se organizar la exposicin que sigue: a) anlisis terico del problema, b) diseo del escenario de formacin, y c) definicin de los sistemas de anlisis para interpretar las respuestas de los participantes.. Es importante sealar que no se introducirn referencias a resultados de investigacin, sino que la presentacin se limitar a la dimensin metodolgica del proyecto.

2. El modelo metodolgico: narrativa de decisiones


2.1. PRIMERA FASE: ANLISIS TERICO DEL PROBLEMA La naturaleza del problema que motiva la investigacin ofrece criterios para clarificar la intencin terica del diseo de formacin en cuestin, as como definir los principios que orientarn los sistemas de anlisis de datos. Al respecto, la revisin de la literatura de investigacin permiti focalizar los siguientes interrogantes: a) Cules son las nuevas necesidades para la formacin de profesores?; b) Cmo se caracterizan las concepciones docentes acerca de las Ciencias y su enseanza?; c) Cules son los escenarios de formacin ms potentes para movilizar concepciones y prcticas? En relacin con el primer interrogante, las lneas de investigacin en enseanza de las Ciencias vienen sealando la necesidad de delinear y evaluar nuevos formatos de formacin docente basados en enfoques constructivistas del aprendizaje profesional, que permitan la experimentacin de hiptesis

182 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas.

curriculares alternativas. Al respecto, es importante incluir en la formacin problemas y dilemas relevantes de la enseanza y el aprendizaje favoreciendo la participacin activa y reflexiva del profesor en el desarrollo de cualidades cognitivas, afectivas y motivacionales (PORLN, 1995; MARCHESI & MARTN, 1998; ROMERO AYALA, 1998; POZO, 1999; BAENA, 2000; IMBERNN, 2002; HOBAN, 2002). Esta problematizacin de la enseanza no ha de darse en vaco, sino que requiere de una revisin de contenidos y perspectivas epistemolgicas. Al respecto, se reconoce la necesidad de fortalecer una perspectiva de alfabetizacin cientfica, que integre el abordaje de problemticas socionaturales relevantes, revalorizando la formacin en valores. En estrecha relacin, se propone focalizar en la movilizacin de las concepciones e imgenes deformadas de la Ciencia que priman en la enseanza, lo que requiere una fuerte apuesta en la formacin en contenidos metacientficos, recuperando los aportes de la Epistemologa, Historia y Filosofa de la Ciencia (GIL PREZ, 1994; ADRIZ BRAVO ET AL., 2002; FERNNDEZ ET AL., 2002; 2003; RIVAROSA & MORONI, 2008; RIVAROSA, 2009). En otras palabras, urge problematizar el mbito de la formacin de profesores como escenario para promover un dilogo crtico y metacognitivo que vincule aquellas concepciones ms arraigadas y resistentes con nuevas visiones epistemolgicas sobre la naturaleza del conocimiento (FERNNDEZ ET AL., 2003). Retomando ahora el segundo interrogante, hablar de concepciones docentes supone referir a construcciones de carcter provisorio, tentativo, progresivo y sistmico (PORLN, 1995). No pensamos en elementos independientes o autnomos, sino en esquemas conceptuales relativamente integrados, aunque inestables y mviles, y atravesados por contenidos muchas veces contradictorios (FERNNDEZ ET AL., 2002; 2003). Se alude as a sistemas de creencias que articulan un conocimiento profesional complejo, de carcter tcito y dilemtico, con poder estructurador sobre las prcticas de enseanza. Ello explica su inmutabilidad y resistencia al cambio, configurndolo en obstculo principal para la renovacin pedaggica (PORLN, 1993; 1995; FELDMAN, 1999; MACCHIAROLA, 2005). Asimismo, la naturaleza progresiva de las concepciones docentes justifica y reclama la profundizacin de estudios evolutivos vinculados a procesos de innovacin o formacin (tercer interrogante). De este modo, se busca contribuir al conocimiento de diferentes niveles de formulacin de esas concepciones a fin de comprender mejor los obstculos que bloquean el aprendizaje profesional. Tal como sealan Porln & Rivero (1998), este abordaje permitira identificar tendencias en un gradiente de complejidad creciente, delimitando hiptesis tentativas sobre la progresin del conocimiento profesional. En otra lnea de razonamiento, la preocupacin por el contenido del pensamiento o los significados construidos por los sujetos supone, para nosotros, un componente principalmente semntico. En este sentido, preguntarnos acerca de las concepciones docentes supone profundizar en los enunciados de maestros y profesores. Sean principios de accin o justificaciones elaboradas reflexivamente, estarn siempre expresadas en trminos del repertorio personal de conocimientos y creencias (FELDMAN, 1999; POTTER, CIT. EN CUBERO, 2005). Vinculado a ello, tambin resultarn valiosos los mbitos dialgicos de formacin que promuevan la construccin argumentada de nuevas comprensiones (GIL PREZ, 1994; BURBULES, 1999). Ello requiere de escenarios mltiples, donde los docentes en formacin puedan contrastar perspectivas, desarrollar argumentos y negociar posiciones (WELLS, EN COLL & EDWARDS, 1996; PORLN & RIVERO, 1998; SANMART, 2000). Finalmente, la literatura seala la potencialidad movilizadora del pensamiento que reside en la elaboracin de hiptesis curriculares y didcticas, incorporando la escritura de experiencias de prctica o diseos de enseanza como un necesario ejercicio metacognitivo (PORLN, 1995; ROMERO AYALA, 1998; PACCA & VILLANI, 2000; MIGNORANCE, 2001; IMBERNN, 2002; LARROSA, 2008). 2.2. SEGUNDA FASE: DISEO DEL ESCENARIO DE FORMACIN Por qu hablar de escenario? Porque es una expresin que trasciende la idea de una sucesin lineal de actividades de formacin, proporcionando una imagen que remite al carcter situado del diseo de formacin. Pensamos en el escenario como una construccin deliberada que conjuga la consideracin de los sujetos involucrados como portadores de una historia e idiosincrasia socio profesional, un mbito institucional especfico y un contexto que condiciona o incide sobre lo que all acontece. Contemplando estas articulaciones e integrando los conceptos precedentes, se abord el diseo de un escenario de formacin como trayecto de actualizacin, fortalecimiento profesional y

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

183

Carola Astudillo, Alcira Rivarosa & Flix Ortiz

movilizacin de concepciones y prcticas de enseanza de Ciencias Naturales. El mismo fue implementado, con las adecuaciones pertinentes, en los siguientes grupos: a) docentes en ejercicio de Nivel Primario del rea de Ciencias Naturales (grupo 1); b) estudiantes universitarios de un profesorado en Ciencias Biolgicas (grupo 2); c) formadores de formadores que pertenecen a un Instituto de Formacin Docente (grupo 3); y c) educadores ambientales de diversos mbitos educativos y de gestin comunitaria: escuelas, ONGs, centros comunitarios, municipios, etc. (grupo 4). En trminos generales, el diseo apunta a una inmersin progresiva en los conocimientos del campo de la Didctica de las Ciencias y la complejidad epistemolgica de las Ciencias Naturales, procurando superar la yuxtaposicin aditiva de contenidos y la organizacin netamente disciplinar de los encuentros. Para ello, se reconoce como hilo conductor de las actividades formativas las concepciones y prcticas de los docentes, en tanto configuran el conocimiento de donde parten y el ncleo organizador de su profesionalidad (PORLN, 1993). Por otra parte, la secuencia de contenidos y actividades de aprendizaje contemplan un principio de continuidad, definiendo un itinerario de aprendizaje con diferentes niveles de progresin en el abordaje conceptual. La organizacin de los momentos del diseo incorpora, entre otros, instancias de metarreflexin, anlisis de prcticas educativas cotidianas y creacin fundamentada de propuestas innovadoras. De este modo, se procura ofrecer oportunidades mltiples para que los docentes representen y reflejen sus concepciones, priorizando tareas de resolucin de problemas o toma de decisiones que involucren explicaciones y predicciones fundamentadas (LESH & KELLY, 2000). Respecto de los contenidos de formacin, son cuatro los nodos temticos que articulan el diseo: a) Concepciones y dilemas docentes; b) diseo y argumentacin didctica; c) procesos de cambio en el saber profesional; y d) Epistemologa e Historia de la Ciencia. Como veremos, cada uno de los momentos y actividades responden con especial nfasis a uno de los nodos referidos (ver esquema 1). Por razones de espacio, a continuacin describiremos slo aquellos momentos que se seleccionan para su estudio, y que se seleccionan en funcin de su replicabilidad en diferentes grupos en formacin y la participacin principal de los sujetos en formacin a travs de sus producciones e intervenciones. Los momentos as seleccionados se describen a continuacin.

Momento A: Proyeccin de representaciones sobre las Ciencias Naturales y evocacin de la historia escolar del docente. Este momento consiste en la indagacin de representaciones docentes sobre las Ciencias Naturales a partir de esquemas o dibujos. Se trata de una estrategia proyectiva que contribuye a la emergencia de manifestaciones del pensamiento que a veces no logran expresarse desde el lenguaje natural remitiendo a las imgenes que cada uno construye cuando reflexiona sobre la ciencia que ensea.
Complementariamente, se indaga acerca de la propia historia escolar de los participantes a partir de la pregunta qu y cmo aprendimos Ciencias Naturales en la escuela?, ubicando al docente como sujeto de aprendizaje, que recupera sus vivencias como tal. Desde una perspectiva que reconoce el valor de la historia personal y colectiva en las configuraciones actuales del pensar, decir y hacer docente, se contrastan los modelos de enseanza asumidos en la prctica cotidiana con aquellos vivenciados en la experiencia propia con maestros y escuelas.

Momento B: Problematizacin del contenido y nuevos problemas para la enseanza. Este momento se compone de tres submomentos: en primer lugar se indagan los contenidos que los participantes privilegian en la enseanza y las dificultades que advierten en su aprendizaje. El objetivo es explicitar las prioridades que cada docente define para la enseanza de los contenidos del rea y hacer pensables las decisiones y convicciones que las sustentan, convirtindolas en objeto de reflexin y reformulacin.
En el segundo submomento se solicita a los docentes la lectura de artculos de circulacin masiva y la identificacin de problemticas vinculadas a nuevas necesidades de alfabetizacin cientfica. Se propone as una perspectiva diferente sobre problemas socionaturales de actualidad para revisar contenidos de ciencia. El docente sale por un momento del esquema escolar sobre el que est reflexionando para dialogar ahora con el mundo de la vida. Se espera que el anlisis conduzca a pensar en contenidos o conceptos disciplinares desde un esquema ms integrado y complejo que pueda contrastarse con la reflexin inicial respecto de los procesos de seleccin de contenidos. Finalmente, el tercer submomento consiste en la lectura de un conjunto de textos (GARRET, 1995; POZO ET AL., 1995) que abordan el enfoque de resolucin de problemas en la enseanza de las Ciencias, profundizando conceptualmente lneas de investigacin en Didctica. A partir de ello, se propone retomar el artculo de divulgacin ya abordado e identificar tipos de contenidos que podran

184 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas.

incorporarse a la enseanza, as como preguntasproblema que podran orientar una propuesta didctica en el aula.

Momento C: Anlisis del proceso de produccin cientfica. Visionado de films. En este momento se propone el anlisis de las pelculas Y la banda sigui tocandoi y Casas de fuegoii. Se trata de dos films que dan cuenta de la complejidad y multidimensionalidad de los procesos de produccin cientfica, contemplando variables como: momento histrico, situacin socioinstitucional, pujas entre sectores profesionales, econmicos y polticos, realidad econmica, sistemas de creencias culturales, implicaciones personales, etc.
La actividad tiene un doble objetivo: 1) promover la reflexin en torno a la complejidad de los procesos de produccin cientfica, y 2) ofrecer un modelo de intervencin educativa que, con la introduccin de materiales no convencionales, potencia el estilo narrativo y la riqueza de la lectura histricosituacional. La actividad es el punto de partida para iniciar el abordaje de revisiones epistemolgicas relevantes, fundamentndose en el valor que posee para el aprendizaje y la comprensin significativos introducir reflexiones acerca de contenidos de Historia y Filosofa de la Ciencia. El objetivo es problematizar aquellas imgenes distorsionadas o errneas del hacer cientfico que se encuentran ms arraigadas en el pensamiento del docente y en su prctica.

Momento D: Elaboracin y fundamentacin de una secuencia didctica. Esta actividad configura el momento central del diseo de formacin y consiste en solicitar a los docentes la elaboracin de una secuencia didctica que contemple una trama conceptual de contenidos y una sucesin detallada de actividades. El objetivo de este momento es la revisin e integracin de los enfoques desarrollados en torno a una perspectiva de problematizacin del contenido y la creacin de una propuesta para sus propios alumnos y el contexto de su aula e institucin. Se trata de una tarea de mltiples articulaciones: una mediacin entre pasado y futuro (recuperando otras experiencias de formacin); la cooperacin entre conocimiento didctico y prctica de enseanza; la integracin de condiciones psico contextuales; y la construccin de una coherencia global entre las acciones propuestas, con criterios de continuidad y profundizacin progresiva. Momento E: Construccin del diseo experimental en clases de ciencia. Discusin histrica. En este momento se aborda el trabajo del cientfico jerarquizando los aspectos dinmicos y procesuales y avanzando hacia la ruptura con una imagen de ciencia acabada y esttica, que se produce de modo lineal y exitoso. Se desarrolla as una reflexin dialogada respecto de los mitos clsicos del hacer ciencia y su contrastacin con un modelo de perspectivismo metodolgico. Se ofrece como material de lectura el relato de la experiencia cientfica de Pasteur (BARCENA & ARTIS, 1987) introduciendo un nuevo ngulo de anlisis que permite avanzar en la caracterizacin del proceso de investigacin cientfica desde la dimensin temporal y la consideracin de sus condicionamientos. Desde esta lectura, se solicita el diseo de una actividad experimental capaz de recuperar el contexto histrico analizado. Es una invitacin a trascender el sentido ilustrativo o demostrativo de la actividad experimental, transformndolo ahora en una estrategia de problematizacin del conocimiento.
Como cierre, se propone la vivencia activa de una situacin de aprendizaje en el laboratorio, enfrentando a los docentes con un esquema escolar tradicional. El objetivo es que los participantes vivan, como alumnos, las incertidumbres y obstculos conceptuales o procedimentales propios de enfrentar un diseo elaborado por otros. Finalmente, se ofrecen textos de pensadores y cientficos de todas las pocas, abordando el mismo problema con las herramientas explicativas disponibles en cada momento. Se recupera nuevamente la Historia de la Ciencia para comprender las construcciones actuales, las hiptesis y problemas subyacentes a cada avance, la dimensin humana y social del proceso. El laboratorio se convierte en una mesa de debate con la historia, la relevancia cultural de la produccin cientfica y las sucesivas crisis de paradigmas.

Momento F: Reflexin sobre el proceso de aprendizaje. Narracin y entrevista. Desde la valoracin de las instancias de metarreflexin en la toma de conciencia de los propios procesos de aprendizaje, se solicita a los docentes la escritura de una carta relatando las instancias de formacin transitadas. Se recurre al gnero narrativo por su potencial para dejar fluir ideas o representaciones con mayor espontaneidad, dando lugar a la dimensin afectiva de la vivencia, desde la conviccin de que sin la participacin del deseo, la emotividad y el afecto, no hay aprendizaje posible.
En el esquema que presentamos a continuacin se sintetiza la secuencia de momentos que hemos descrito. Se definen los tpicos principales abordados en cada uno de ellos y su vinculacin con los
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

185

Carola Astudillo, Alcira Rivarosa & Flix Ortiz

nodos de formacin del diseo. La lnea de puntos en el esquema indica que las relaciones entre los momentos no implican una sucesin ordenada. Se trata ms bien de integraciones, cierres parciales, avances y recapitulaciones, solapamientos, etc.

A Concepciones ciencia y enseanza Modelos de enseaza histricos y actuales B Decisiones docentes contenido a ensear Nuevos problemas de alfabetizacin Enfoques alternativos (resolucin de problemas) C Complejidad y contexto del proceso de produccin cientfica Materiales alternativos en Educ.. Cientfica Concepciones epistemolgicas del docente D Integracin de enfoques Criterios de progresin didctica Argumentacin didctica E Dimensin contextual e histrica del trabajo cientfico Perspectivismo metodolgico Resignificacin educativa de la actividad experimental F Pensamiento y escritura Afectividad / racionalidad en el proceso de formacin Metacognicin Los procesos de cambio en el saber profesional Diseo y argumentacin didctica Epistemologa e historia de la ciencia Concepciones y dilemas docentes Nodos de la formacin

MOVILIZACION DE CONCEPCIONES Y PRCTICAS

ESQUEMA 1. Esquema de momentos y nodos de formacin 2.3. TERCERA FASE: LOS SISTEMAS DE ANLISIS Para el anlisis de los datos recogidos en cada grupo se han diseado dos estudios complementarios. El Estudio 1 consiste en interpretar las relaciones entre las intenciones y caractersticas de cada momento del diseo y las respuestas de los participantes (sus producciones escritas e intervenciones orales), a fin de analizar transversalmente lo que sucede en cada grupo en formacin y definir relaciones comparativas entre ellos. El objetivo aqu es comprender cmo los contextos de intervencin van configurando los procesos de aprendizaje de los participantes. En este estudio se pretenden caracterizar niveles de cambio y ajuste de las concepciones y prcticas de los participantes, a partir de categorizar sus respuestas a las actividades propuestas en cada momento. Esta caracterizacin considerar complementariamente: a) sentido y dimensiones de las actividades de formacin; b) tipologa de materiales de lectura y estudio; y c) criterios de secuenciacin del diseo. Ante la imposibilidad de crear un nico sistema de anlisis que atendiera a la diversidad de instancias que conforman el diseo de formacin, se procedi a agrupar los momentos descritos en funcin de los nodos de formacin a los que se vinculan, definindose para cada agrupamiento un sistema de anlisis especial (Tabla 1).

186 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas.

Agrupamientos de momentos de formacin Agrupamiento 1: Correspondiente al nodo Concepciones y dilemas docentes (variantes del momento A para cada grupo). El objetivo del anlisis es desentraar las concepciones de los participantes acerca de las Ciencias Naturales y su enseanza, as como los sentidos que se movilizan en el anlisis de dilemas vinculados a sus propias experiencias docentes. Agrupamiento 2: Correspondiente al nodo Diseo y argumentacin didctica (variantes de los momentos B y D para cada grupo). La finalidad es determinar los rasgos que asume la construccin acerca del docente, el alumno, el conocimiento a ensear y las metas educativas, en instancias de diseo didctico. Asimismo, se pretende conocer los criterios de secuenciacin didctica que los participantes priorizan a la hora de pensar la enseanza. Agrupamiento 3: Correspondiente al nodo Los

Sistemas de anlisis Para esquemas con empleo de palabras, se analizarn: 1) jerarquizacin de ideas; 2) direccionalidad de las relaciones; 3) tipo de relaciones a partir de identificacin de nexos (explicativas, descriptivas, de identificacin); 4) conceptos que se asocian con ms frecuencia; 5) modelos de relaciones conceptuales. Para dibujos o grficos se analizarn: 1) imgenes como interpretacin global; 2) componentes y relaciones; 3) jerarqua entre componentes o dimensiones; 4) modelos de significacin subyacentes. Las categoras de anlisis quedan definidas del siguiente modo: Sentido de las acciones que se predican o atribuyen respecto del docente y el alumno en las producciones discursivas de los participantes. Relaciones entre acciones (patrones o secuencias). Formas lingsticas a travs de las cuales los sujetos categorizan, califican, definen o describen el conocimiento a ensear. Las categoras de estudio se definen del siguiente modo: La realidad que se define como trasfondo de relato. Los ncleos temticos que el sujeto describe en su relato. Los encadenamientos causales o secuenciales y los puntos de inflexin (momentos bisagras). Los argumentos que sostienen los participantes. Esquemas de imgenes y metforas. Las categoras son: Relacin con el proceso de validacin experimental. Relacin con las formas de justificacin de ideas e hiptesis. Relacin con los orgenes de los problemas y las motivaciones en la bsqueda. Relacin con valores y principios ticos de la tarea investigativa.

procesos de cambio en el saber profesional


(variantes del momento F para cada escenario). El propsito es conocer los sentidos que se movilizan desde la reflexin respecto del propio proceso de formacin a partir de instancias de indagacin individual y colectiva, de carcter narrativo. Agrupamiento 4: Correspondiente al nodo

Epistemologa e Historia de la Ciencia


(variantes de los momentos C y E para cada grupo.) Respecto de este agrupamiento se pretende dar cuenta de procesos de reflexin histrico epistemolgica acerca de la enseanza de contenidos de ciencia, as como el valor socio educativo otorgado al conocimiento.

TABLA1: Agrupamientos de momentos y sistemas de anlisis

Por su parte, el Estudio 2 consiste en el anlisis de algunos casos en profundidad con el objetivo de conocer el proceso transitado por los participantes, resaltando su dimensin longitudinal y complementando as el Estudio 1. Los casos seleccionados sern participantes que: a) hayan transitado la totalidad de los momentos diseados cumplimentando con las producciones requeridas; y b) pertenezcan a grupos diferentes a fin de que sea posible realizar algunas lecturas comparativas. Reconstruyendo la secuencia temporal de formacin, se determinarn los patrones evolutivos subyacentes en la movilizacin de concepciones y prcticas, procurando determinar condiciones de gradualidad o ruptura respecto de los cambios. Articulando los resultados de los estudios 1 y 2, se proceder finalmente a la construccin de modelos de aprendizaje e innovacin de prcticas de enseanza de Ciencias Naturales, atendiendo a patrones estratgicos de movilizacin del pensamiento en instancias de formacin. Asimismo, y en articulacin con la revisin terica inicial, se sistematizarn algunas categoras de reformulacin e innovacin de diseos de formacin para docentes de Ciencias Naturales (COBB ET. AL., 2003). Por supuesto, no se trata de producir un mdulo estandarizado de solucin, sino ms bien construcciones intermedias que pueden recuperarse en otros escenarios como herramientas para el diseo de nuevas alternativas de formacin adecuadas localmente.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

187

Carola Astudillo, Alcira Rivarosa & Flix Ortiz

3. Consideraciones finales
Para terminar, aportamos un esquema de sntesis a modo de autoanlisis que intenta articular algunas de las ideas vertidas en este artculo. Es un intento de reconstruir el camino recorrido destacando algunos de los ejes de la estrategia presentada.

niveles de cambio y ajuste de concepciones y prcticas en cada agrupamiento de momentos

Patrn evolutivo subyacente a la movilizacin de concepciones y prcticas. Estudio de casos

perfiles de aprendizaje e innovacin

MOMENTOS DE FORMACION Agrupamientos Agr. 1: Concepciones y dilemas docentes Agr. 2: Diseo y argumentacin didctica Agr. 3: Los procesos de cambio en el saber profesional Agr. 4: Anlisis epistemolgico y reflexin socio-educativa

ESTUDIO 1: Perspectiva transversal

ESTUDIO 2: Perspectiva longitudinal

Estudios en contexto: Movilizacin de concepciones y prcticas de enseanza

G1: Docentes en ejercicio de Nivel Primario G2: Estudiantes universitarios de profesorado G3: Formadores de formadores G4: Educadores ambientales

Diseos de formacin de docentes de Ciencias

Definicin de nuevas orientaciones y categoras tericas

E S C E N A

ESQUEMA 2. Estrategia metodolgica para un estudio de diseo

Son cuatro las cuestiones que retomamos en el esquema: 1) preocupacin por la recuperacin del contexto; 2) articulacin de momentos de formacin y sistemas de anlisis mltiples; 3) relacin reflexiva entre teora y prctica en un modelo de recursividad metodolgica; 4) desarrollo de nuevas categoras tericas que integren especificidad y generalidad, desde una perspectiva de refinamiento. Atendiendo a estas premisas, nos hemos abocado a una ingeniera de diseo metodolgico fundado en el reconocimiento de que el decir, pensar y hacer respecto de la enseanza est teido de las configuraciones de cada contexto de formacin, as como tambin lo estn las posibilidades de leer nuevos y viejos sentidos al respecto. Este reconocimiento nos ha conducido a focalizar en el nivel del microespacio de las prcticas cotidianas de formacin e investigacin, en tanto slo en este plano puede pensarse la transformacin. Y es el trabajo de explicitacin y desnaturalizacin de rutinas y concepciones lo que fortalece el vnculo esperanzador con una transformacin superadora. Ese es el sentido ltimo de la indagacin y anlisis que se proponen: comprender cmo se despliegan procesos de movilizacin y ajuste entre pensamiento y prctica con el objetivo de impulsar nuevos sistemas de accin, posibles de ensayar en el contexto del aula. Se trata tambin de un modo de enfrentar la falta de credibilidad generalizada respecto de sostener los hallazgos de la investigacin educativa en situaciones reales. Es, en sntesis, un esfuerzo por promover cambios desde una mayor articulacin teoraprctica, que enfatiza la relacin reflexiva entre ambas, recuperando la apuesta por los procesos creativos en investigacin y un sentido de esperanza en nuevas alternativas. Apostamos as por la idea de un progreso posible, y adoptando las

188 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

Estudio de un diseo de formacin para profesores de Ciencias: consideraciones metodolgicas.

posibilidades contenidas en el seno de lo incierto, sobre todo aquellas vinculadas a procesos creativos, asumimos un compromiso con el cambio desde la prctica misma de investigacin.

Referencias bibliogrficas
ADRIZ BRAVO, A., IZQUIERDO, M. & STANY, A. (2002). Una propuesta para estructurar la enseanza de la Filosofa de la Ciencia para el profesorado de Ciencias en formacin. Enseanza de las Ciencias, 20(3), 465476. BAENA CUADRADO, M. D. (2000). Pensamiento y accin en la enseanza de las ciencias. Enseanza de las ciencias, 18(2), 217226. BARCENA, A. & ARTIS, M. (1987). Introduccin al Mtodo Cientfico en Biologa. Consejo Nacional para la enseanza de la Biologa. BURBULES, N. (1999). El dilogo en la enseanza. Teora y prctica. Buenos Aires: Amorrortu. CARRASCOSA, J., MARTNEZ TORREGOSA, J., FURI, C. & GUISASOLA, J. (2008). Qu hacer en la formacin inicial del profesorado de Ciencias de Secundaria?. Revista Eureka sobre Enseanza y Divulgacin de las Ciencias, 5(2), 118133. COBB, P., CONFREY, J., DISESSA, A., LEHRER, R. & SCHAUBLE, L. (2003). Design Experiments in Educational RESEARCH. EDUCATIONAL RESEARCHER, 32(1), 913. COLL, C. & EDWARDS, D. (1996). Enseanza, aprendizaje y discurso en el aula. Madrid: Aprendizaje. COLLINS, A., JOSEPH, D. & BIELACZYC, K. (2004). Design Research: Theoretical and methodological Issues. The Journal of the learning sciences, 13(1), 1542. CUBERO, R. (2005). Perspectivas constructivistas. La interseccin entre el significado, la interaccin y el discurso. Barcelona: Gra. FELDMAN, D. (1992). Por qu estudiar las creencias y teoras personales de los docentes? Revista del Instituto de Investigaciones en Cs. de la Educacin, 1(1), 4150. FELDMAN, D. (1999). Ayudar a ensear. Buenos Aires: Aique. FERNNDEZ, I., GIL, D., CARRASCOSA, J., CACHAPUZ, A. & PRAIA, J. (2002). Visiones deformadas de la ciencia transmitidas por la enseanza. Revista Enseanza de las Ciencias, 20 (3), 447488. FERNNDEZ, I., GIL, D., VILCHES, A., VALDS, P., CACHAPUZ, A. PRAIA, J. & SALINAS, J. (2003). El olvido de la tecnologa como refuerzo de las visiones deformadas de la ciencia. Revista Electrnica de Enseanza de las Ciencias, 2(3), consultado el 02/07/2009. GARRET, R. (1995). Resolver problemas en la Enseanza de las Ciencias. Alambique Didctica de las Ciencias Experimentales 5, 115. GIL PREZ, D. (1994). 10 aos de investigacin en Didctica de las Ciencias: realizaciones y perspectivas. Enseanza de las Ciencias, 12(2), 154164. HOBAN, G. (2002). Teacher Learning for Educational Change. Philadelphia: Open University Press. IMBERNN, F. (2002). La investigacin educativa como herramienta de formacin del profesorado. Barcelona: Gra. LARROSA, J. (2002). Notas sobre a experincia e o saber de experincia. Revista Brasileira de Educao 19, 2028. LESH, R. & ANTONHY K. (ed.) (2000). Handbook of Research Design in Mathematics and Science Education. New Jersey: Lawrence Erlbaum Associates. MACCHIAROLA, V. (2006). El conocimiento de los profesores universitarios de qu tipo de conocimiento estamos hablando? En RIVAROSA, A. (comp.), Estaciones para el debate, un mapa de dilogo con la cultura universitaria. Ro Cuarto: Fundacin de la UNRC, 8089. MAIZTEGUI, A., GONZLEZ, E., TRICRICO, H., SALINAS, J., PESSOA DE CARVALHO, A. & GIL, D. (2000). La formacin de profesores de ciencia en Iberoamrica. Revista Iberoamericana de Educacin 24, 163187. MARCHESI, A. & MARTN, E. (1998). Calidad de la enseanza en tiempos de cambio. Madrid: Alianza.
ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

189

Carola Astudillo, Alcira Rivarosa & Flix Ortiz

MIGNORANCE, P. (2001) Aprendizaje y desarrollo profesional de los profesores. En MARCELO, C. (ed.): La funcin docente. Madrid: Sntesis, 2741. PACCA, J. & VILLANI, A. (2000). La competencia dialgica del profesor de ciencias en Brasil. Revista Enseanza de las Ciencias, 18(1), 95104. PORLN, R. (1993). Constructivismo y Escuela. Hacia un modelo de enseanzaaprendizaje basado en la investigacin. Sevilla: Dada. PORLN, R. (1995). Las creencias pedaggicas y cientficas de los profesores. Enseanza de las Ciencias de la Tierra 3(1), 713. PORLN, R. & RIVERO, A. (1999). El conocimiento de los profesores. Una propuesta formativa en el rea de ciencias. Sevilla: Dada. POZO, J. I. (1999). El cambio de las concepciones de los profesores sobre el aprendizaje. En J. M. SNCHEZ, A. M. OORBE & I. BUSTAMANTE (eds.), Educacin Cientfica. Madrid: Universidad de Alcal. POZO, I., POSTIGO, Y. & GMEZ CRESPO, M. (1995). Aprendizaje de estrategias para la solucin de Problemas de Ciencias. Alambique 5, 1626. REIGELUTH, C. & FRICK, T. (1999). Investigacin formativa: Una metodologa para crear y mejorar teoras de diseo. En REIGELUTH, C., Diseo de la instruccin. Teoras y modelos. Un nuevo paradigma de la teora de la instruccin (II). Madrid: Aula XXI. RIVAROSA, A. & MORONI, C. (2008). Anlisis de las representaciones de los estudiantes universitarios de Biologa acerca de las prcticas en ciencias: una alternativa para la enseanza. Revista de Educacin en Biologa, 11 (1), 1830. RIVAROSA, A. (2009). Aprendiendo a ensear: La reflexin histrica y epistemolgica en la formacin de formadores. Ro Cuarto: Fundacin de la Universidad Nacional de Ro Cuarto. ROMERO AYALA, F. (1998). Una pequea reflexin sobre los problemas de investigacin de la Didctica de las Ciencias. Enseanza de las Ciencias, 16(1), 171174. SANMART, N. (2000). El diseo de unidades didcticas. En PERALES PALACIOS, F. & CAAL DEL LEN, P. (eds.), Didctica de las Ciencias Experimentales. Alcoi: Marfil.

i ii

1993. Estados Unidos. Direccin: Roger Spotiswoode 1995. Argentina. Direccin: Juan Bautista Stagnaro

190 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 181-190

REFERENCIA: Muoz Gonzlez, Juan Manuel & Ontoria Pea, Antonio (2010). Implicacin del alumnado en el proceso de aprender a pensar. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (dd mmaa):)

Implicacin del alumnado en el proceso de aprender a pensar


JuanManuelMUOZGONZLEZ AntonioONTORIAPEA
Correspondencia: JuanManuelMuozGonzlez Correoelectrnico: m02mugoj@uco.es Telfono: 627966156 Fax:957218937 AntonioOntoriaPea Correoelectrnico: ed1onpea@uco.es Telfono: 607914188 Fax:957218937 Direccinpostalcomn: FacultaddeCC.delaEducacin UniversidaddeCrdoba Crdoba(Espaa) Recibido:7demayode2010 Aceptado:18deoctubrede2010

RESUMEN
En el trabajo planteamos los mapas mentales como una tcnicaquepotencialacapacidaddeaprenderaaprendery aprenderapensardelalumnadodemagisteriodentrodeun aprendizaje holstico o aprendizaje con todo el cerebro. El trabajoquedaestructurado,enprimerlugar,conunmarco tericoenelqueseclarificaconceptualmentelatcnicadel MapaMental.Acontinuacin,presentamoseldesarrollodel proceso de investigacin desde la intencionalidad a la recogidadedatosysutratamientoconelprogramaAtlas.ti, para obtener los resultados tanto descriptivos como interpretativos, expuestos en tablas de frecuencia y en redesrelacionales,pormediodeunanlisiscualitativo.

PALABRAS CLAVE: Estrategia de aprendizaje, Estilo cognitivo,Procesocognitivo,Aprendizajevisual.

Learners involvement in the learning to think process


ABSTRACT
InthisarticleweestablishmindmapsasatechniquethatbooststheLearningtolearnandLearning tothinkabilitiesofundergraduateTeacherTrainingstudentswithinaholisticlearningorwholebrain learningprocess.Firstly,atheoreticalframeworkisproposedwhichconceptuallyclarifiestheMindMap technique.Next,wepresenttheresearchprocesscoveringtheaimsandthestepsindatacompilation and processing. Data were processed with Atlas.ti software to obtain descriptive and interpretative results, which are shown in frequency tables and in relational networks as a result of a qualitative analysisofthefindings.

KEY WORDS: LearningStrategy,Cognitivestyle,Cognitiveprocess,Visuallearning.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 191199

191

Juan Manuel Muoz Gonzlez & Antonio Ontoria Pea

1. Introduccin
La expansin de los medios tecnolgicos ha provocado cambios cualitativos en la sociedad, de tal manera que podemos hablar de la emergencia de una nueva mentalidad. En este sentido, se identifica la sociedad actual por la informacin (Sociedad de la Informacin), por el conocimiento (Sociedad del Conocimiento) y por el aprendizaje (Sociedad del Aprendizaje). La educacin actual y la formacin del profesorado necesitan nuevas estrategias y tcnicas para responder a esta nueva sociedad de la informacin. La abundante informacin disponible en la actualidad necesita estrategias y tcnicas, que posibiliten su conversin en conocimiento a travs del procesamiento personal. McCarthy (1991: 142) refuerza esta idea al afirmar que el conocimiento es el resultado de personalizar la informacin, de

convertir la masa de datos entrante en conceptos e imgenes significativos. Este proceso se desarrolla reflexionando sobre la informacin que nos llega, comprendindola, evalundola y traducindola al lenguaje que nosotros utilizamos.
A la preocupacin de la perspectiva cognitivista por la construccin del conocimiento en conexin con la comprensin del significado y la creacin de estructuras cognitivas, se une la perspectiva neurocientfica, que impulsa un aprendizaje holstico de la persona con estrategias orientadas a aprender con todo el cerebro. En este plano, que pretende desarrollar la capacidad de aprender a aprender y aprender a pensar, situamos nuestro trabajo en concordancia con la necesidad de adquirir tcnicas y estrategias que lo hagan posible.

2. Perspectiva conceptual de los Mapas Mentales


El origen y desarrollo de los Mapas Mentales conecta con el movimiento del cognitivismo o

revolucin cognitiva, consolidado a partir de la dcada 7080. El pensamiento cognitivista evolucion


desde el inters prioritario por los mecanismos de adquisicin de la informacin y las capacidades hasta la comprensin del significado y la creacin de nuevas estructuras cognitivas. Tony Buzn es el creador de los Mapas Mentales. Su presentacin se realiza bsicamente con El libro de los Mapas Mentales (1996) y Tu mente en forma (2004). Ontoria y su grupo han propiciado la difusin de esta tcnica con los libros Potenciar la capacidad de aprender y pensar (2007, 4 Ed.) y Aprender con Mapas Mentales (2006, 4 Ed.), as como la realizacin de una tesis doctoral de la mano de J. M. Muoz (2009). La fundamentacin terica de los Mapas Mentales como estrategia/tcnica de aprendizaje se encuentra en tres enfoques cientficos relevantes: 1) El desarrollo de la neurociencia: Al relacionar los mapas mentales con el funcionamiento cerebral, se los define como una poderosa tcnica grfica que aprovecha toda la gama de capacidades corticales y pone en marcha el autntico potencial del cerebro (BUZN, 1996: 175). Desde esta perspectiva, interesa el acercamiento a las teoras representativas del desarrollo cerebral: los dos hemisferios o divisin cerebral (SPERRY, 1973), cerebro triple o triuno (MACLEAN, 1978; 1990), cerebro total o de los cuadrantes cerebrales (HERRMANN, 1989) y cuadrantes cerebrales o especializacin funcional (BENZIGER, 2000). Se han incrementado las investigaciones sobre el cerebro como una realidad total (CARTER, 2002; JENSEN, 2003), de las que se han obtenido principios referidos al enfoque global y holstico del aprendizaje en sus distintass modalidades y a la estimulacin del cerebro total. 2) La visualizacin de la informacin y la expansin de las TICs en la sociedad. La construccin del conocimiento con organizadores grficos se sita dentro de las tcnicas de visualizacin de la informacin (TUFTE, 1994; WURMAN, 1997; DRSTELER, 2000; ENGELHART, 2002; WARE, 2004). El Mapa Mental es, por definicin, una expresin grfica que refleja el pensamiento irradiante, imaginativo y estructurado simultneamente (BUZN, 1996, 2004; ONTORIA, 2004, 2006), o bien, se considera como un mtodo que destila la esencia de aquello que conocemos y organizamos de forma visual (MCCARTHY, 1991: 142). 3) La concepcin de las Inteligencias Mltiples (GARDNER, 1994; STENBERG, 1999), el enfoque de las Mentes del futuro (GARDNER, 2005) y el movimiento de la Inteligencia Emocional (GOLEMAN, 1998, 2006; ELAS, TOBAS & FRIEDLANDER, 2001; MARTIN & BOECK, 2002, entre otros) apoyan una perspectiva holstica del aprendizaje. Con los Mapas Mentales se potencian las capacidades cognitivas, sociales y personales, pues, como hemos indicado anteriormente, sintonizan con una concepcin holstica de la educacin y del aprendizaje. Con los Mapas Mentales puede plantearse tambin la autoconciencia de los procesos vividos

192 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4),

191199

Implicacin del alumnado en el proceso de aprender a pensar

durante su aplicacin, con lo cual se manifiesta la implicacin del yo como agente del propio aprendizaje, situndonos en un nivel metacognitivo segn el enfoque interpretativo fenomenolgico (MCCOMBS, 1993). El Mapa Mental representa una realidad multidimensional que comprende espacio, tiempo y color. La imagen estimula una amplia variedad de habilidades en el cerebro como formas, colores, lneas, dimensiones, etc., es decir, habilidades que estimulan la imaginacin y, por consiguiente, fomentan el pensamiento creativo y la memoria asociativa. Ayuda a pensar, buscando la integracin de palabras e imgenes y, con ellas, generar estructuras que reflejan la jerarquizacin y la categorizacin del pensamiento (ONTORIA ET AL., 2006). Contiene ideas ordenadoras bsicas, que son los conceptos claves a partir de los cuales se organiza la trama de relaciones conceptuales. El Mapa Mental como tcnica de enseanzaaprendizaje tiene importantes repercusiones en el mbito afectivorelacional de la persona, ya que el protagonismo otorgado al alumnado, la atencin y aceptacin que se presta a sus aportaciones y el aumento de su xito en el aprendizaje favorecen el desarrollo de la autoestima. Su uso en la negociacin de significados mejora las habilidades sociales y desarrolla actitudes acordes con el trabajo en equipo y, ms globalmente, con la sociedad democrtica. Finalmente, aludimos al papel de las TICS en la aplicacin de los Mapas Mentales como estrategias de aprendizaje, pues se dispone del programa informtico Mindmanager en su versin 7. Su repercusin educativa presenta una vertiente tcnicocreativa en la elaboracin de los Mapas Mentales y una referencia al proceso madurativo del alumnado como persona total, que incluye el mbito cognitivo, personal y social.

3. Proceso de Investigacin: intencionalidad, contextualizacin, muestra y cuestionario


El trabajo se enmarca dentro de la metodologa de la investigacin cualitativa, que responde mejor al anlisis del pensamiento del alumnado como sujeto interactivo y comunicativo que comparte significados (PREZ SERRANO, 2004: 10). Este modelo se identifica con los siguientes rasgos orientadores del trabajo (RODRGUEZ ET AL., 1999; FLICK, 2004; PREZ SERRANO, 2004; MCMILLAN & SCHUMACHER, 2005):

Proceso descriptivo, en el que se recogen los datos y las situaciones como palabras, sentimientos y comportamientos de las personas, que son la fuente informativa del trabajo. Enfoque humanista interpretativo, con un carcter fenomenolgico que busca los significados que dan los propios sujetos a la experiencia. La observacin como tcnica para la recogida de datos. La reflexin como actividad generadora de pensamiento.

El contacto frecuente del investigador con la situacin investigada. 1) Intencionalidad. El objetivo de este trabajo est orientado a descubrir el impacto de los mapas
mentales como una tcnica holstica de aprendizaje en la formacin inicial del maestro. Existe inters por detectar su aportacin en la comprensin y organizacin del conocimiento. Se busca, en definitiva, descubrir la conciencia que el alumnado manifiesta sobre la influencia de los mapas mentales en la construccin del conocimiento durante el proceso de aprendizaje.

2) Contextualizacin y muestra. La experiencia se ha desarrollado en Didctica General,


asignatura troncal del plan de estudios de la Facultad de Ciencias de la Educacin de la Universidad de Crdoba (Espaa). La muestra comprende 140 alumnos universitarios pertenecientes al segundo curso de la titulacin de Maestro, en la especialidad Educacin Primaria, durante los aos acadmicos 2006/7 y 2007/8. El trabajo se ha realizado dentro de la cotidianeidad de la docencia de un curso normal. Al estar implicado el propio profesor en la experiencia, sintoniza con el modelo de la investigacin cualitativa que implica la permanencia frecuente y prolongada en el contexto o escenario de la accin educativa, la convivencia con el alumnadomuestra e, incluso, la incidencia en la dinmica del aula. Todas las condiciones, pues, para la realizacin del trabajo han sido positivas y favorables. Con los Mapas Mentales inmersos en la dinmica metodolgica del curso, se han trabajado

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 191199

193

Juan Manuel Muoz Gonzlez & Antonio Ontoria Pea

los mdulos del programa dentro del modelo de aprendizaje cooperativo y centrado en el alumnado (ONTORIA, GMEZ, MOLINA & DE LUQUE, 2006).

3) Cuestionario: Hemos utilizado el cuestionario reflexivo o de autoobservacin interna definido como una narracin que realiza una persona o grupo acerca de sus experiencias, inquietudes, aspiraciones, metas, fines, actitudes, etc. (PREZ, 1994: 39). Es, pues, un
documento personal y autobiogrfico en el que la persona (alumnado) describe e interpreta sus propios constructos mentales y toda su dinmica personal.

4. Construccin del pensamiento con el Mapa Mental


La revolucin metodolgica en la investigacin cualitativa cuenta con autores representativos como Tesch (1990), Fielding & Lee (1992), Miles & Huberman (1994), Kelle (1995), Weitzman & Miles (1995). Dentro de la diversidad de programas informticos aplicados a la investigacin cualitativa, los ms utilizados son Atlas.ti de Thomas Muhr (2007), Aquad de Huber & Garca (1991) y Nudist (1987). Con los tres programas pueden efectuarse anlisis descriptivo interpretativos y pueden construirse nuevas teoras (TESCH, 1990). Hemos optado por el programa Atlas.ti en el que se distinguen dos momentos principales:

1) El anlisis textual que comprende el proceso de codificacin y categorizacin. 2) El anlisis conceptual, que intenta distribuir, agrupar y relacionar las categoras/ subcategoras para generar networks o redes grficas relacionales.
4.1. RESULTADOS DEL ANLISIS DESCRIPTIVO CON EL PROGRAMA ATLAS.TI Como consecuencia del anlisis descriptivo hemos elaborado la siguiente tabla sobre la distribucin de frecuencias y porcentajes de las distintas categoras y subcategoras.

4.1.1. Tabla de frecuencias y porcentajes


CATEGORAS SUBCATEGORIAS
PROCESO ESTRATGICO OBTENCIN DE IDEAS ELEMENTOS FACILITADORES DE LA COMPRENSIN

F 04/05 54 10 64 188 188 57 57 23 94 117 86 19 10 115 541

F 05/06 % 04/05 % 05/06 69 16 85 197 197 102 102 24 4 130 158 149 43 25 217 759 84,4% 15,6% 100% 100% 100% 100% 100% 19,7% 0% 80,3% 100% 74,8% 16,5% 8,7% 100% 100% 81,2% 18,8% 100% 100% 100% 100% 100% 15,2 2,5% 82,3% 100% 68,6% 19,8%

% TOTAL 06/07

%TOTAL 07/08

11,8%

11,2%

TOTAL PARCIAL SELECCIN DE IDEAS COMPRENSIN

TOTAL PARCIAL CONSTRUCCIN DE MICROESTRUCTURAS GRFICAS ORGANIZACIN

34,7%

26%

10,5%

13,4%

TOTAL PARCIAL DOMINIO TCNICO CONSTRUCCIN DEL MM EXPECTATIVAS DE COMO PROCESO APRENDIZAJE RESULTANTE REALIZACIN TOTAL PARCIAL RENDIMIENTO EFICACIA EN EL APRENDIZAJE CON MM MEMORIZACIN COMPRENSIVA ASIMILACIN REFLEXIVA TOTAL PARCIAL

21,6%

20,8%

21,2% 11,5% 100% 100% 100%

28,6%

TOTAL GLOBAL

100%

194 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4),

191199

Implicacin del alumnado en el proceso de aprender a pensar

En dicho anlisis encontramos 5 categoras: obtencin de ideas, seleccin de ideas, construccin de microestructuras grficas, construccin del Mapa Mental como proceso resultante y eficacia en el aprendizaje con el Mapa Mental. Su descripcin se presenta en orden descendente, atendiendo a la frecuencia y porcentaje: a) La categora seleccin de ideas, en el periodo 2006/2007, presenta una frecuencia de 188 y un porcentaje del 34,7%, mientras en el periodo 2007/2008 aparece seleccin de ideas con una frecuencia de 197 y un 26%. b) La eficacia en el aprendizaje con el Mapa Mental ha obtenido una frecuencia de 217 y un 28,6% en el periodo 2007/2008, y con una frecuencia de 115 y un porcentaje del 21,2% en el periodo 2006/2007. c) La categora construccin del Mapa Mental como proceso resultante, figura con una frecuencia de 117 y un 21,6% en el periodo 2006/2007, mientras que en el periodo 2007/2008 presenta una frecuencia de 130 y un 20,8%. d) La categora obtencin de ideas, en el periodo 2006/2007, figura con una frecuencia de 64 y un 11,8%, y, en el caso del periodo 2007/2008, aparece con una frecuencia de 85 y un porcentaje del 11,2%. e) La categora construccin de microestructuras grficas, en el periodo 2007/2008, aparece con una frecuencia de 102 y un 13,4%, y en el periodo 2006/2007 muestra una frecuencia de 57 y un 10,5%. En definitiva, podemos constatar la expresin del pensamiento del alumnado a travs de la construccin del mapa mental, lo cual constituye un eje central de nuestro trabajo. Comprender la obtencin y seleccin de las ideas, su comprensin y organizacin siguiendo unos criterios de prioridad y globalidad. Esta realizacin genera mayor eficacia y rendimiento en el aprendizaje, al mismo tiempo que propicia expectativas positivas y un mayor refuerzo del dominio tcnico. 4.2. EL MAPA MENTAL COMO RESULTANTE DEL PROCESO DE PENSAR. La network o red presentada a continuacin muestra los componentes principales que intervienen en el proceso de construccin del pensamiento. Las categoras y subcategoras son indicadores de la percepcin del alumnado relacionada con las actividades que conlleva la capacidad de pensar. Dentro del proceso investigador corresponde a la fase conceptual o de interpretacin de los resultados obtenidos con el programa Atlas.ti.

4.2.1. Network o red relacional

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 191199

195

Juan Manuel Muoz Gonzlez & Antonio Ontoria Pea

4.2.2 Tabla para la interpretacin de la network o red relacional


Categoras Construccin del MM como Proceso Resultante Construccin de Microestructuras Grficas Eficacia en el aprendizaje con MM Obtencin de Ideas Seleccin de Ideas SIGLAS CMR CMG EFM OID SID Subcategoras Asimilacin Comprensin Dominio Tcnico Elementos Facilitadores de la Comprensin Expectativas de aprendizaje Memorizacin Organizacin Proceso Estratgico Realizacin Rendimiento SIGLAS ASI COM DTE EFC EAP MEM ORG PES REA REN

Al analizar esta network o red relacional podemos diferenciar tres bloques o lneas de referencia para la construccin del pensamiento. 1. Obtencin y seleccin de ideas (OIDSID): Segn el pensamiento del alumnado, representan dos momentos bsicos del proceso de elaboracin del mapa mental, de tal manera que estn conectados y forman una unidad secuencial.

Obtencin de ideas. Implica la inmersin en los documentos disponibles para conseguir la mayor cantidad de ideas insertas en el ncleo temtico. Supone una estrategia (PES) consistente en la familiarizacin con ellos y en conseguir una visin global de su estructura como pasos previos (SHEELE, 1996). El hecho de entresacar ideas est conectado con la utilizacin de elementos facilitadores de la comprensin (EFC), uno de los cuales es solucionar posibles dificultades en el significado de las palabras/conceptos o de expresiones conceptuales. Seleccin de ideas. Nos adentramos en la necesidad de establecer criterios para la
diferenciacin de ideas principales y secundarias, como primer paso de la seleccin de ideas. Surgen dos posturas: una, centrarse en descubrir y construir el pensamiento del autor o autores expresado en los documentos; y otra, construir el pensamiento propio, aunque est influenciado por dicho/s autor/es. Para realizar este proceso de seleccin se requiere como factor esencial el logro de la comprensin del contenido documental. Al mismo tiempo, la categorizacin y priorizacin de las ideas facilita la construccin del mapa mental como expresin del pensamiento. Todo ello, adems, desemboca en un mayor aumento del rendimiento y de la eficacia de la tcnica.

2.Realizacin del Mapa Mental resultante (CMR). Despus de establecer la jerarquizacin de las ideas en la fase anterior, se procede a su organizacin, construyendo pequeas estructuras grficas (CMG). Estas microestructuras son agrupaciones de varios conceptos relacionados, equivalentes a distintas ideas o pensamientos. La organizacin de las ideas obtenidas, diferenciadas en principales y secundarias, son fundamentales para crear las microestructuras grficas. Se trata de un momento de pensamiento creativo en la construccin del pensamiento. Cuando el alumno ha finalizado la fase constructiva de microestructuras grficas llega el momento de pasar a la realizacin del Mapa Mental global. Supone ensamblarlas, aplicando el criterio de priorizacin y jerarquizacin de las ideas. Es necesario recordar que el Mapa Mental desarrolla el pensamiento irradiante, es decir, que la expansin del pensamiento va del centro hacia la periferia. En consecuencia, las ideas principales se sitan en la proximidad del centro de la grfica y las secundarias figuran en el exterior. En este momento del proceso, el dominio tcnico es uno de los requisitos fundamentales para lograr la correcta realizacin del Mapa Mental, de la que emergen las expectativas para su aplicacin en el mbito del estudio y en otras situaciones. 3.Dominio Tcnico del mapa mental (DTE). Representa un componente prioritario para la construccin del conocimiento con esta tcnica, de lo cual el alumnado es consciente. Est en la raz del propio proceso de elaboracin del mapa mental,

196 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4),

191199

Implicacin del alumnado en el proceso de aprender a pensar

pues contribuye a la creacin de las microestructuras grficas, al implicar la relevancia y significatividad de los conceptos. La adecuada elaboracin global del mapa mental refleja la jerarquizacin de los conceptos en funcin de su papel dominante en la lnea de pensamiento. Con la expresin grfica realizada, se facilita la memorizacin y asimilacin comprensiva, al combinar imgenes, colores smbolos, palabras, etc. Implica la conciencia del valor de la estrategia en la construccin del pensamiento, ya que el mismo mapa mental, conceptual y grfico, es resultado del propio pensamiento estratgico. Todos estos aspectos mencionados tienen una repercusin positiva en el rendimiento y en la eficacia del aprendizaje. 4.Eficacia de los Mapas Mentales en el aprendizaje (EFM). La eficacia en el aprendizaje mediante la utilizacin del Mapa Mental depende de dos capacidades primarias: la memorizacin comprensiva (MEM) que desarrolla el alumno durante todo el proceso trabajado y la asimilacin reflexiva (ASI), que facilita la interiorizacin de los nuevos conocimientos. Ambas capacidades se favorecen con el dominio tcnico del Mapa Mental, con la comprensin de los contenidos y con la organizacin de las ideas obtenidas. Potenciando la memorizacin comprensiva y la asimilacin reflexiva se incrementa la repercusin positiva y eficaz en el aprendizaje. De ellas depende, fundamentalmente, el rendimiento (REN), tanto en el mbito de estudio como en otras aplicaciones, ya que se compagina la capacidad de almacenar y recordar la informacin de forma comprensiva y la capacidad para reflexionar sobre el aprendizaje adquirido. El desarrollo de ambas capacidades garantiza la efectividad del Mapa Mental como estrategia de aprendizaje que, con el logro del dominio tcnico, resulta determinante para la generacin de nuevas expectativas y para la aplicacin del Mapa Mental en otros campos de la vida.

5. El Mapa Mental y la sintona con el enfoque gardneriano y con los hemisferios cerebrales
Sealamos, a continuacin, la conexin que establecemos entre el enfoque de la construccin del pensamiento con los mapas mentales, el planteamiento de Gadner sobre las cinco mentes del futuro y la dominancia en la forma de pensar de los cuadrantes cerebrales de Benziger. 5.1. CONEXIONES ENTRE LOS MAPAS MENTALES, EL PLANTEAMIENTO CEREBRALES DE BENZIGER
CONSTRUCCIN DEL PENSAMIENTO CON EL MAPA MENTAL 1. Obtencin de ideas. 2. Seleccin de ideas. 3. Eficacia en el aprendizaje con el Mapa Mental. 4. El Mapa Mental como resultante del proceso. TEORA DE LOS CUADRANTES
CEREBRALES DE HERRMAN Y BENZIGER.

GADNERIANO Y LOS CUADRANTES

Frontal Derecho (Benziger) Cortical Derecho (Herrmann) Persona: buscan la sntesis,


miran las cosas desde la globa lidad, buscando estructuras que plasmen la sntesis de ideas concebidas.

LAS CINCO MENTES DEL FUTURO DE GARDNER. Mente sintetizadora: extrae informacin de mltiples y diferentes fuentes; entiende y diferencia lo importante de lo secundario; evala y valora su significacin y organiza dicha informacin.

Apreciamos que la mente ms acorde con el enfoque del presente trabajo es la mente sintetizadora. Gardner (2005: 41) recoge la idea del premio nobel Murria GellMan de que la mente ms apreciada en el siglo XXI ser la mente capaz de sintetizar, pues representa un valor decisivo a medida que la informacin se acumula e incrementa debido a las tecnologas de la informacin. Se la describe como la mente capaz de atender y extraer informacin de mltiples y diferentes fuentes, entender y diferenciar lo importante de lo secundario, evaluar y valorar su significacin y organizar dicha informacin, de tal manera que tenga sentido para la propia persona y para los dems. Trata tambin de comparar los distintos puntos de vista, sintetizar el conocimiento y establecer criterios para comunicar la informacin efectivamente. La mente sintetizadora supone una reflexin permanente para adaptar la nueva informacin al modelo inicialmente construido.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 191199

197

Juan Manuel Muoz Gonzlez & Antonio Ontoria Pea

Desde el planteamiento cerebral, la predominancia se corresponde con la persona frontal derecha de Benziger (2000) y se compagina bastante con algunas caractersticas del cuadrante lmbico izquierdo o Persona Basal Izquierdo. Definen personas que miran las cosas desde la globalidad y buscan estructuras que plasmen la sntesis de ideas concebidas. Pertenece a la estrategia orientada hacia la conceptualizacin y la integracin, aunque mantiene, tambin, cierta coincidencia con la mente creativa.

6. El Mapa Mental como expansin del pensamiento


A modo de conclusin final, podemos decir que en el Mapa Mental se recogen los principales factores que estn presentes en el proceso de aprender a pensar, poniendo de manifiesto una reflexin sobre la siguiente idea sintetizadora global: el mapa mental como expresin del pensamiento irradiante. Con esta idea Buzn (1996: 69) identifica conceptualmente mapa mental y pensamiento irradiante. Al aludir al pensamiento irradiante como procesos asociativos de pensamiento que proceden de un punto central o se conectan con l (Buzn, 1996: 67) encuentra similitud con la estructura radial de la neurona y su multiplicidad de conexiones: La estructura del mapa mental intenta ser expresin del funcionamiento del cerebro global con sus mecanismos asociativos que favorecen el pensamiento irradiante en el mbito de la recepcin, retencin, anlisis, evocacin y control de la informacin (ONTORIA, 2008: 40). Otra vertiente conceptual del pensamiento irradiante es la consideracin como forma de pensar, al orientar la construccin del conocimiento con la idea de la totalidad (BUZN, 1996: 45). Se intenta aprender a pensar con el cerebro total, es decir, con la confluencia de los dos hemisferios cerebrales, a travs de la palabra y la imagen, con la razn y la imaginacin. Encontramos, pues, una vinculacin del pensamiento irradiante, organizacin del pensamiento a travs del mapa mental. Traemos, una vez ms, las palabras de Buzn para reforzar esta idea: Un vistazo a las leyes y a la teora general del mapa

mental permite ver que ste es en realidad una manifestacin externa del proceso de pensamiento creativo en su totalidad (BUZN, 1996: 175).
En definitiva, afirmamos que el aprendizaje con mapas mentales conlleva procesos cognitivos bsicos para conseguir un rendimiento eficaz: comprensin, obtencin y seleccin de ideas, organizacin, asimilacin reflexiva y la peculiar forma de expresin grfica global del pensamiento.

Referencias bibliogrficas
ALPER, L., HYERLE, D. & CURTIS, S. (2004). Student successes with thinking maps: Schoolbased research, results, and models for achievement using visual tools. Thinking Maps: A Language for Leading and Learning. Thousand Oaks, CA, US: Corwin Press, XVI, 187198. BUZN, TONY (2001). Head strong. Londres: Harper Colling Publisher. Trad: Tu mente en forma (2004). Barcelona: Urano. BUZN, T. & BUZN, B. (1993). The mind book. Londres: BBC Books. Trad: El libro de los mapas mentales (1996). Barcelona: Urano. CALMAESTRA, J. & MUOZ, J. M. (2005). Los Mapas Mentales y las tecnologas de la informacin. Revista Internacional de Magisterio, edicin 18, Colombia: Magisterio de Colombia, 3638. CAZAU, PABLO (2004a). Gua de Estilos de Aprendizaje. Consultado el 15/09/2005 en <http://galeon.hispavista.com/pcazau/guia_esti.htm> CAZAU, PABLO (2004b). Estilos de aprendizaje: Generalidades. Consultado el 11/11/2005 en <http://pcazau.galeon.com/guia_esti01.htm> CHERRY, D., HYERLE, D., CURTIS, S. & ALPER, L. (2004). Student successes with thinking maps: School based research, results, and models for achievement using visual tools. Thinking Technology. Thousand Oaks, CA, US: Corwin Press, XVI, 99104. FIELDING, N. G. & LEE R. M. (1998) Computer analysis and qualitative research. Newtechnologies for social research. London: Sage. FLICK, UWE (2004). Introduccin a la investigacin cualitativa. Madrid: Morata.

198 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4),

191199

Implicacin del alumnado en el proceso de aprender a pensar

GADNER, HOWARD (2005). Las cinco mentes del futuro. Barcelona: Paids Ibrica. GOLEMAN, DANIEL (1996). Inteligencia emocional. Barcelona: Kairs. GOLEMAN, DANIEL (2006). Social intelligence. New York: Bantham Books. Trad. Inteligencia social. La nueva ciencia de las relaciones humanas (2006). Barcelona: Kairs. JENSEN, ERIC (1998). Teaching with the brain in mind. Virginia (USA): Association Supervision and Curriculum Development (ASCD). Trad. Cerebro y aprendizaje (2004). Madrid: Narcea. MARGULIES, NANCY (2002). Mapping Inner Space: Learning and Teaching Visual Mapping. Chicago: Zephyr Press. MILES, M. B. & HUBERMAN, A. M. (1984) Qualitative Data Analysis: an expanded sourcebook. Thounsand Oaks: California Sage. MUHR, TH. (1997). ATLAS/ti. Visual Qualitative Data. Analysis, management and model building. Users Manual and reference. Berlin: Scientific Software Development. ONTORIA, A., GMEZ, J. P., MOLINA, A. & LUQUE, A. (2006). Aprender con Mapas Mentales. Madrid: Narcea. ONTORIA, A., GMEZ, J. P., MOLINA, A. & LUQUE, A. (2008). Aprendizaje Centrado en el Alumno. Madrid: Narcea. ONTORIA, A., GMEZ, J. P. & MOLINA, A. (2007). Potenciar la capacidad de aprender y pensar. Madrid: Narcea. PREZ, GLORIA (2004). Investigacin cualitativa. Retos e interrogantes. Vol.1. Madrid: La Muralla. TESCH, R. (1990). Qualitative research: analysis types and software tools. New York: TheFalmer Press. TJAR, JUAN CARLOS (2006). Investigacin cualitativa. Comprender y actuar. Madrid: La Muralla. TORRE PUENTES, JUAN CARLOS (2002). Aprender a pensar y pensar para aprender. Estrategias de aprendizaje. Madrid: Narcea. WEITZMAN, E. A. & MILES, M. B. (1995). Computer programs for qualitative data analysis. London: Sage.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 191199

199

REFERENCIA: Brigo, Carla Cristina Dutra & Loch, Clesar Luiz (2010). Una mirada sobre el proceso de formacin como investigador en la Universidad Pblica Federal brasilea. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Una mirada sobre el proceso de formacin del profesor como investigador en la Universidad Pblica Federal brasilea
CarlaCristinaDutraBRIGO ClesarLuizLOCH
Correspondencia: CarlaCristinaDutraBrigo Correoelectrnico: carlacdb@terra.com.br Telfono: +554899806448 Direccinpostal: FernandoFerreiradeMelo,204 FlorianpolisSantaCatarina Brasil.CP:88085260 ClesarLuizLoch Correoelectrnico: clesarloch@yahoo.com.br Direccinpostal: DiputadoAntnioEduVieira,147 FlorianpolisSantaCatarina Brasil.CP:88040000 Recibido:7deseptiembrede2009 Aceptado:18deoctubrede2010

RESUMEN
En Brasil, histricamente, la investigacin se ha constituido comounaprcticarestrictaalauniversidadpblica.Frente a las polticas pblicas neoliberales, un nuevo escenario se ha configurado en el proceso de constitucin de la investigacinydelaformacindelprofesor.Enesteartculo buscamos reflexionar sobre el proceso de formacin del profesor como investigador en la universidad pblica brasilea,frentealasnuevasdirectrices.Defendemosquela formacin del profesor como investigador tiene posibilidades de crear y hacer proliferar comunidades interpretativas,demodoacuestionarloinstituido,creando yrecreandolarealidadenlaqueestinsertado.

PALABRAS CLAVE: Universidad pblica, Polticas pblicas


educacionales,Formacindelprofesor.

A look at the process of teachers training as researchers at the Brazilian federal public university
ABSTRACT
In Brazil research has historically been limited to the public university. In the light of the neoliberal publicpolicies,anewscenariohasemergedforthebuildingprocessofteacherstrainingandresearch. Thispaperaimstoconsiderhowtheprocessofteacherstrainingasresearchershasbeenestablishedat the Brazilian federal university, following the new policies. We defend the idea that the teachers trainingasaresearcherenablesthecreationandproliferationofinterpretativecommunitiestoquestion whathasbeeninstituted,creatingandrecreatingtherealityinwhichthisteacherisimmersed.

KEY WORDS: Publicuniversity;PubliceducationalPolicies;Teacherstraining

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

201

Carla Cristina Dutra Brigo & Clesar Luiz Loch

Consideraciones iniciales
Hay en el universo acadmico, entre las investigaciones a que tuvimos acceso, innumerables investigaciones que analizan las causas y los efectos que estn llevando al deterioro del desarrollo de los espacios pblicos en la Universidad Pblica Federal brasilea, a partir de la dcada de 90, con el avance de las polticas pblicas neoliberales. Otras analizan las condiciones de realizacin del trabajo acadmico frente a las acciones de las polticas pblicas educacionales, pero slo algunas investigaciones sitan el trabajo acadmico como constitutivo del proceso de desarrollo del espacio pblico en la Universidad, como una actividad de produccin social que constituye histricamente el proceso de desarrollo de esta institucin social. Concebimos que el trabajo acadmico diferencia al profesor universitario (catedrtico) del profesor de cualquier otro nivel de enseanza. Por ejemplo, por ms que creamos y defendamos que la investigacin debe formar parte del proceso de formacin del profesor y del ejercicio de su actividad acadmica, independiente del nivel de enseanza en el cual acta, ella no est efectivamente presente en todos los niveles, y tampoco la extensin. Los dems profesores tambin ejercen un trabajo acadmico; sin embargo, sin el ejercicio indisoluble de estas tres actividades: la enseanza, la investigacin y la extensin. Analizamos algunas investigaciones sobre el trabajo acadmico y el desarrollo del espacio pblico en la Universidad, con el fin de investigar cmo se constituye el trabajo acadmico, el proceso de publicitacin de ese trabajo y el trabajo del profesor como una actividad de potenciacin de las acciones de desarrollo del espacio pblico en la Universidad Federal, con el objetivo de comprender el movimiento del ejercicio del trabajo acadmico como una manifestacin ideolgica de sustentacin de la sociedad vigente y de contestacin de esta sociedad. Ese movimiento se realiza a partir de la relacin que el profesor establece con su trabajo, frente a las condiciones de realizacin del mismo (BRIGO, 2003). De acuerdo con Brigo (2003), el espacio pblico existe en la Universidad, siendo uno de sus elementos constituyentes. Sin embargo, con las polticas pblicas neoliberales, ese espacio viene perdiendo su fuerza frente a la incidencia de organizacin del espacio privado, que viene constituyndose en la universidad pblica, esencialmente por medio del proceso de racionalidad financiera. A partir de esa realidad, la Universidad, para mantenerse, para sobrevivir, establece relaciones de cooperacin con rganos de financiacin privados. En el ejercicio de sus actividades, a partir de esa realidad, el profesor organiza el espacio pblico cuando incrementa acciones para fortalecer ese espacio, sin embargo a la vez lo desorganiza, cuando fortalece el incremento de acciones privatizantes. Hay una tendencia del trabajo acadmico a ser producido con vistas a la apropiacin privada, en el sentido de revertir recursos para la Universidad como institucin pblica. Es decir, se privatizan los resultados del trabajo acadmico para organizar el espacio pblico y, a la vez, se desorganiza el espacio pblico con los incrementos privados. Como modo de supervivencia de la Universidad pblica, del trabajo acadmico y en busca de recursos que tambin agreguen valor a su sueldo, amenizando, as, el acelerado proceso de proletarizacin acadmica que ocurre desde la dcada de 90, el profesor, como un trabajador enajenado al proceso de trabajo, recurre a recursos junto a los agentes articuladores de cooperacin, legitimando las acciones impuestas por el Estado. En este contexto, el profesor vive esencialmente el antagonismo de organizar y desorganizar, de fortalecer y enflaquecer el proceso de desarrollo del espacio pblico en la Universidad. Entre las actividades que constituyen el trabajo acadmico, la investigacin se destaca esencialmente como un medio potenciador del proceso de privatizacin de la Universidad pblica. Con esto, un nuevo escenario surge en la academia, en el proceso de constitucin del trabajo acadmico, en el proceso de constitucin de la investigacin. Dos aspectos son destacados por Santos (1999: 201), esenciales en esta relacin entre Universidad y recursos externos; Universidad y productividad: la

naturaleza de la investigacin bsica y las virtualidades y lmites de la investigacin aplicada en las universidades.
La incitacin de los recursos externos, no estatales, implica una presin en el sentido de privilegiar la investigacin aplicada en detrimento de la investigacin bsica, por dos motivos esenciales: el coste de la investigacin bsica y el tiempo para la presentacin de los resultados. Hay una diferencia de tiempo de maduracin entre los rganos financiadores y la Universidad. Estos rganos necesitan agilidad en los resultados, pues el mercado les exige. Por otro lado, la

202 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

Una mirada sobre el proceso de formacin como investigador en la Universidad Pblica Federal brasilea

Universidad necesita de tiempo para la maduracin de sus investigaciones. Esa diferencia de tiempo de maduracin y la necesidad de agilidad por los recursos financieros impulsan las investigaciones para que sean ms giles, aplicadas, y tengan resultados ms inmediatos. Con eso, la naturaleza de la investigacin bsica se volvi un problema, sea por sus costes, sea por la conversin progresiva de la ciencia en fuerza productiva, evidenciando la distincin entre investigacin bsica y aplicada. Con base en la investigacin que comento (BRIGO, 2003), en los ltimos aos eran las reas tcnicas, tecnolgicas y profesionales de la Universidad Pblica Federal las potencialmente ms lucrativas para la atencin de las necesidades de la sociedad mercantilizada. En su estado actual, hay una necesidad apremiante en el interior de la Universidad por la bsqueda de recursos externos, esencialmente debido a la racionalidad financiera, que viene impulsando todas las reas de enseanza a hacerse potencialmente interesantes al mercado. Actualmente para el ingreso en las universidades pblicas federales brasileas hay una tendencia nacional, definida por las polticas pblicas educacionales, con raras excepciones mediante las especificidades de las reas, a que todo profesor ingrese ya con el ttulo de doctor. Con esto partimos de la premisa de que todo profesor que ingresa en la Universidad ya ha desarrollado investigaciones. Sin embargo, el desafo se encuentra en las condiciones de realizacin de trabajo a l propiciadas, en las cuales hay una tendencia para que el desarrollo de la investigacin sea realizado por acuerdos con rganos de cooperacin y que atiendan a criterios mercadotcnicos. Por otro lado, la formacin del catedrtico tambin es uno de los elementos decisivos en la relacin que el profesor mantiene con su trabajo acadmico, adems de las condiciones de realizacin de ese trabajo. Al interaccionar con el proceso de trabajo, el profesor manifiesta valores, significados, perspectivas, esperanzas y utopas que son reflejos conscientes de la realidad. En ese proceso de interaccin aparecen el lenguaje, el pensamiento, nuevas necesidades y nuevos modos de satisfaccin (TRIVIOS, 2003). La formacin del profesor es un reflejo consciente de su proceso de formacin, de los fundamentos de su formacin (proceso objetivo de la formacin), y las relaciones que el profesor establece con su trabajo son reflejo consciente de esa formacin, que constituye la actividad acadmica del profesor. Por otro lado, esa formacin tambin, en cierto sentido, es determinada por la interaccin del profesor con las condiciones existentes de trabajo, a partir de las posibilidades concretas, propiciadas al profesor frente a su formacin. Por ejemplo: plano de capacitacin docente, recursos para formacin, entre otros factores que propician la formacin del profesor en su ambiente de trabajo. Pero cmo esa formacin puede determinar las relaciones que el profesor establece con su trabajo acadmico? Pensamos que, si tiene la formacin del profesor sus bases en los dictmenes del neoliberalismo, haciendo que este niegue algunos fundamentos de su formacin, como la utopa de la investigacin, por ejemplo, incrementando fundamentos de modo que esta investigacin se limite a ser aplicable y lucrativa para la sociedad mercantilizada hay, a partir de este contexto, un revs en el proceso de formacin del profesor que se reflejar en el ejercicio de su trabajo acadmico. Frente a este contexto, nuevas inquietudes surgen: Cmo se desarrolla la formacin del profesor como investigador en el contexto de la Universidad Pblica Federal? Qu investigaciones se estn realizando? En qu condiciones se realizan estas investigaciones? Todo catedrtico es un ser que investiga? Hay distincin entre el profesor y el investigador? Necesariamente el profesor que ensea, no es aquel que investiga? La investigacin est direccionada hacia el posgrado y distante de la enseanza de graduacin?

1. La investigacin en el proceso de formacin del profesor


En el proceso de formacin del profesor, la investigacin, histricamente, se ha constituido como una prctica restricta a la Universidad pblica. Actualmente es una de las actividades que constituyen la trada de la esencia universitaria, es decir, la enseanza, la investigacin y la extensin. La investigacin se legitima histricamente en la Universidad como una actividad inherente a su fin formativo, por iniciativa de la Universidad de Berln, en respuesta a las necesidades de la sociedad industrial que surga en Alemania (BRIGO, 2006).

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

203

Carla Cristina Dutra Brigo & Clesar Luiz Loch

En Brasil, la investigacin se concentra en las universidades pblicas, en virtud de los acuerdos de cooperacin con rganos de financiacin pblicos y privados, incluso con la CAPES (Fundacin Coordinacin de Perfeccionamiento de Personal de Nivel Superior) y el CNPq (Consejo Nacional de Desarrollo Cientfico y Tecnolgico), como agencias de fomento, con el fin de viabilizar la realizacin de investigaciones tecnolgicas y cientficas en este pas. Sin embargo, hay otros institutos y organizaciones que tambin realizan investigaciones. Sin embargo, la Universidad pblica todava tiene un fuerte potencial para la investigacin, sobre todo con los cursos de posgrado, a pesar de ser depreciada por el Estado neoliberal, que valora la enseanza en detrimento de la investigacin como medida de la actual poltica de racionalidad financiera. Hay investigaciones en las universidades pblicas que tienden a tener sus resultados privatizados, pues son costeadas por rganos de financiacin, fundaciones, empresas o asociaciones civiles, debido a la restriccin de subsidios destinados por el Estado. El neoliberalismo, que viene infiltrndose en la concepcin de lo que es investigacin hoy en Brasil, entiende esas sociedades entre universidades y rganos de financiacin como mecanismos que legitiman la accin de la universidad ante la sociedad. Hay un cambio en la mirada y en el modo de trabajo del profesor: de una corporacin de investigadores en bsqueda de conocimientos que van al encuentro del inters de la humanidad (inspirado en el modelo alemn de universidad), del pensar ms all, se pasa gradualmente a la produccin de investigaciones con resultados privatizables, inmediatistas, legitimando la mercantilizacin de la investigacin universitaria (BRIGO, 2006). Sin embargo, aunque haya que destacar algunos contratos ticos de trabajo a partir de un sistema de cooperacin, distante del proceso de mercantilizacin, no todas las investigaciones realizadas en las universidades son privatizables. Alertamos contra el corporativismo desenfrenado junto a la comunidad acadmica que viene abriendo espacios para este tipo de actividad mercantil. Los profesores encontraron en los rganos financiadores una posibilidad de poder continuar realizando sus trabajos. En este contexto, hay una tendencia de la investigacin a distanciarse del proceso de formacin del profesor a nivel de graduacin. Pues, a nivel de posgrado o por medio de la actividad de extensin, el desarrollo de la investigacin aplicable es ms rentable en el mercado acadmico. Y esta accin de distanciamiento de la investigacin a nivel de graduacin viene materializndose por medio de las polticas pblicas educacionales brasileas, que incentivan en este contexto, por ejemplo, la contratacin de profesores con contratos temporales en detrimento de la contratacin de profesores efectivos. Esta prctica priva a la enseanza a nivel de graduacin del acceso a la investigacin, pues este tipo de contrato exime el profesor del desarrollo de la actividad de investigacin. La contratacin de profesores temporales tiene por objetivo, en carcter excepcional, sustituir los profesores efectivos en funcin de exoneracin o despido, fallecimiento, jubilacin, alejamiento para capacitacin y alejamientos de concesin obligatoria (como por ejemplo, licencia para el tratamiento de salud). Esta forma de contratacin est reglamentada por la Ley n 8.745 (BRASIL, 1993) que, por medio de la Disposicin n 224 (BRASIL, 2007a), define el cuantitativo que cada Universidad puede contratar. Este profesor contratado no tiene acceso a la investigacin, ni a la extensin. Su misin en la institucin es slo ensear, teniendo un lmite mximo de dos aos de contratacin, no siendo permitido renovar su contrato por los prximos dos aos. Este contrato temporal es aplicado a gran escala en la enseanza a nivel de graduacin, como cualquier contrato temporal en la era del capitalismo flexible y presenta consecuencias que tienden a comprometer el nivel de calidad en el proceso de formacin acadmica. Este es un trabajador flexible y, por lo tanto, con derechos flexibles, lo que convierte su compromiso con la misin institucional y con su propio hacer el ensear en un reto al mantenimiento del nivel de calidad en la enseanza de graduacin en las universidades pblicas federales. El contrato temporal de profesor, aun siendo un mecanismo de insercin de fuerza de trabajo en la Universidad, limita la accin de este profesional a slo una de las reas del trpode que la constituye: limita a la enseanza. Esta imposicin limita a su vez la formacin de este profesor, pues lo distancia de la posibilidad del desarrollo de la investigacin. Nuestra premisa se basa en que el desarrollo de la investigacin fomenta la actividad de enseanza. Con vistas a dirimir este escenario de contraccin

204 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

Una mirada sobre el proceso de formacin como investigador en la Universidad Pblica Federal brasilea

temporal, por medio de la Disposicin Interministerial n 22 (BRASIL, 2007), alterada por la Disposicin n 224 (BRASIL, 2007a), el gobierno brasileo instituye el Banco de ProfesoresEquivalente. La premisa bsica de este mecanismo es devolver la autonoma a la Universidad en la reposicin de las plazas efectivas por motivo de exoneracin, despido, fallecimiento y jubilacin. Ledo engao, hablamos aqu de autonoma, si las Universidades no disponen de una real autonoma financiera en el proceso de la contratacin. Este Banco operar con el presupuesto dispuesto por la Unin a las Universidades, que podrn dentro de su poltica interna optar por el tipo de contrato que van a establecer, obedeciendo a la lgica racionalista del Banco de ProfesoresEquivalentes. Vinculado al presupuesto global de la fuerza de trabajo docente, el Banco prev la equivalencia de 0,5 para el profesor 20 horas; 1,0 para el profesor 40 horas; y 1,55 para el profesor en rgimen de dedicacin exclusiva. Obedeciendo a esta equivalencia, la Universidad tiene autonoma para reponer sus plazas. Se puede observar claramente la tendencia a fortalecerse de la idea de contratacin de docentes en rgimen de 20 40 horas en detrimento del rgimen de dedicacin exclusiva. El Banco fue construido dando a cada docente un peso diferenciado segn su jornada de trabajo. As, un docente en dedicacin exclusiva vale un poco ms que tres profesores en rgimen de 20 h.; un docente efectivo en 40 h. equivale, independientemente del rgimen de trabajo (20 h. 40 h.), a un profesor en contratacin temporal; ya un docente efectivo de 40h equivale a dos efectivos de 20 h. Claramente, quien viene desarrollando la investigacin, en los cuadros de las universidades es el docente en rgimen de dedicacin exclusiva. Con la aplicacin del Banco de ProfesoresEquivalente, para atender a una demanda de reposicin de plazas, podr haber una tendencia a contratar profesores en rgimen de 20 horas y de 40 horas, en detrimento de la contratacin de un profesor en rgimen de dedicacin exclusiva. Pues slo as las Universidades podrn aumentar su cuadro de contratacin y atender a la demanda de las polticas pblicas educativas de la enseanza superior de ampliacin de las universidades pblicas federales brasileas, en su proceso de expansionismo legitimado por el Programa de Apoyo a Planes de Reestructuracin y Expansin de las Universidades FederalesREUNI (BRASIL, 2007b). Esta prctica podr venir a comprometer el desarrollo de la investigacin en el interior de la Universidad y, consecuentemente, su debilitamiento. El reflejo de esta accin recaer sobre la legitimidad que la Universidad encuentra junto a la sociedad. Sin cumplir su misin de enseanza, investigacin y extensin, hay una tendencia de la Universidad Pblica Federal no ser legitimada por la sociedad que la mantiene efectivamente distanciando la investigacin del proceso de formacin a nivel de graduacin, perpetundola slo en los cursos de posgrado, pues all estn los doctores en el ejercicio de sus investigaciones. Coincidimos con Kourganoff (1990), que apunta que, si la Universidad tiene la funcin de formar, no puede restringirse solamente a la enseanza, pues el proceso de formar incluye el conocimiento y la promocin del progreso por medio de la investigacin. La enseanza y la investigacin no constituyen un fin en s, pero son instrumentos para alcanzar una meta ms alta: el desarrollo de la ciencia.

2. El trabajo acadmico
Las actividades de enseanza, de investigacin y de extensin son actividades constituyentes de la Universidad como institucin social, cuyo fundamento est en el reconocimiento pblico de su legitimidad y de sus atribuciones, en un principio de diferenciacin, que le confiere autonoma ante otras instituciones sociales, estando estructurada por ordenamiento, reglas, normas y valores de reconocimiento y legitimidad internos a ella. As, la institucin encuentra en la sociedad su principio y referencia normativa y valorativa, mientras la organizacin encuentra su referencia en objetivos particulares y es reglamentada por el mercado. O todava ms, una organizacin difiere de una institucin por definirse por otra prctica social, la de su instrumentalidad, es decir, est referida al conjunto de medios particulares para la obtencin de un objetivo particular (CHAU, 2000). Sin embargo, la enseanza, la investigacin y la extensin no siempre estuvieron articuladas como actividades en la Universidad como institucin social, pues el trabajo acadmico, como un proceso de manifestacin ideolgica de la sociedad, corresponde a las necesidades de determinados contextos, de determinados medios sociales.
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

205

Carla Cristina Dutra Brigo & Clesar Luiz Loch

La forma como se constituye el trabajo acadmico es reflejo de las condiciones concretas de existencia de la sociedad en la cual est insertado. En palabras de Wood (2003: 65), podemos apuntar que la actividad productiva es una actividad consciente, fruto de la realidad de la cual forma parte. Es decir, es la sntesis de mltiples determinaciones de la realidad; por ello el trabajo acadmico es una actividad social, pues est insertado en dicha sociedad, no petrificado, pero en continuo desarrollo. La investigacin apunta (BRIGO, 2003) que, en las dcadas de los aos 70 y 80, ser catedrtico era una situacin social de prestigio. Era una referencia social ser profesor de una universidad pblica. Sin embargo, adems de este brillo social que atraa al profesor, el buen sueldo ofrecido delante del mercado laboral, una vida ms confortable, suplan las necesidades bsicas de ese trabajador. Sin embargo, la prctica de la investigacin y de la enseanza eran esencialmente las actividades que los atraan, y que se diferenciaban delante de otras prcticas acadmicas, es decir, la libertad de poder investigar enseando, y la libertad de poder ensear investigando. La enseanza, la investigacin y la extensin son actividades sociales, de formacin, de respuesta a la sociedad, de socializacin de las producciones acadmicas. Sin embargo, a pesar de la libertad acadmica para constituir el proceso de produccin de ese trabajo, vienen determinadas por las condiciones de realizacin del trabajo acadmico. Y, en ese contexto, el factor productividad acadmica fue destacado en la investigacin en comento (BRIGO, 2003) como determinante de la actividad acadmica. Si partimos de la premisa de que el trabajo acadmico es una actividad social, una actividad de produccin, sera equivocado decir que ese trabajo no es productivo. Sin embargo, cuando hablamos de productividad acadmica, hablamos de las condiciones de trabajo como reflejo de la poltica neoliberal que exige de la Universidad comportamientos adaptativos y mercadotcnicos como una organizacin. Para atender a las exigencias de productividad acadmica, el profesor vive en, palabras de Das Sobrinho (2002: 165), un casimercado, una privatizacin disimulada, una pseudoprivatizacin, en el sentido de que todava no hay un abandono total del Estado en cuanto a la financiacin del trabajo acadmico, aunque esa financiacin sea esencialmente precaria. Lo que Das Sobrinho (2002) llama de casi mercado se traduce en la busca de los profesores por la financiacin de sus actividades acadmicas, con el fin de legitimar su trabajo ante la sociedad recaudando recursos para la viabilidad de su trabajo. La aceptacin acrtica del incremento de esta productividad acadmica la asocia Chau (1999) a la prdida de la libertad acadmica, lo que Santos (1999: 203) viene a llamar de riesgo de alteracin degenerativa de las prioridades cientficas. Pues el riesgo existe, ya que los investigadores posean la libertad de eleccin de los temas de investigacin en funcin de su inters ms intrnseco, del desafo que ponan a las teoras consagradas, pero los rganos de financiacin privados poseen prioridades, contenidos, formas, plazos de utilizacin que necesitan ser respetados, sometiendo las actividades de los investigadores; el Estado pasa a ser desentenderse de la responsabilidad por la investigacin en las instituciones pblicas; y las financiaciones privadas pasan a ser aceptadas como complemento salarial y suministro de infraestructura para los trabajos de investigacin, privatizando los espacios pblicos de la Universidad. Verificamos an que este incremento a la productividad produce una segregacin en la Universidad en reas ricas y pobres, debido a los trabajos articulados con el mercado que tiene preferencia por determinadas reas en detrimento de otras; estimula la competitividad entre reas y departamentos, en fin, cercena las relaciones entre algunos profesores que, de intelectuales cooperativos, se vuelven empresarios competitivos en bsqueda de lucros y venta de sus servicios; estimula la produccin acadmica cuantitativa en detrimento de una produccin acadmica cualitativa, dirigida a pensar la realidad con perspectivas crticas de transformacin. Esa segregacin, entre otros aspectos, desorganiza la Universidad como institucin social, el trabajo acadmico como manifestacin del espacio pblico de la Universidad Federal y la formacin del profesor como investigador. Pues si la enseanza, la investigacin y la extensin estuviesen dirigidas hacia el lucro, hay fuertes evidencias de que el profesor fortalecera el proceso de privatizacin y la individualidad del neoliberalismo, negando el fortalecimiento de lo social, de lo pblico. Con la privatizacin de las actividades del trabajo acadmico hay una tendencia a la disolubilidad de la enseanza, de la investigacin y de la extensin, pues hay una prdida de la relacin de interaccin entre ellas. Sus movimientos son enyesados en favor del capital, del fin nico, fragmentando la libertad acadmica en el proceso de desarrollo del espacio pblico y de la formacin del profesor.

206 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

Una mirada sobre el proceso de formacin como investigador en la Universidad Pblica Federal brasilea

3. Consideraciones finales
En el caminar del desarrollo de las reflexiones propuestas en este artculo, partimos de lo que tenamos ms concreto, es decir, las condiciones de realizacin del trabajo acadmico en el desarrollo del proceso de formacin del profesor como investigador en la Universidad Pblica Federal brasilea, frente a investigaciones ya realizadas. Sin embargo, no objetivamos obtener generalizaciones; pero en el desarrollo, aunque inicial, de la reflexin sobre el proceso de formacin del profesor como investigador en las universidades pblicas federales brasileas, es posible constatar que en la gestin de sus acciones la Universidad vive el antagonismo de lo que es necesario hacer y lo que verdaderamente se hace en el desarrollo de la enseanza, de la investigacin y de la extensin. Este antagonismo llega tambin a las acciones de gestiones administrativas y acadmicas internas de las Universidades, que frente a las necesidades impuestas por el contexto poltico educacional de deterioro y de racionalidad financiera y por la necesidad de legitimarse en esta sociedad mercantilizada, adoptan acciones que esencialmente la niegan como una institucin social. La Universidad vive una crisis de identidad en busca de ser una institucin social y, mediante sus acciones administrativas y acadmicas, viene legitimndose como una organizacin cualquiera, con fines mercadotcnicos. Como institucin social vive frente a las polticas pblicas educacionales los desafos contradictorios por las ansias sociales y por la lucha aislada de la supervivencia. Pues la sociedad eminentemente desconoce este apagar de las luces de la Universidad Pblica Federal, delante de su muerte silenciosa en detrimento del fomento de las polticas gubernamentales que a la vez que alardean de una Universidad pblica y de alto nivel de calidad, le niegan condiciones dignas de supervivencia. Como fruto de un proceso histrico, la Universidad ha ido constituyndose en el desarrollo de esta sociedad que ah est, mercantilizada y privatizada en sus espacios de constitucin, teniendo el mercado no como una oportunidad, sino como un delimitador de acciones. Rescatamos el argumento de Wood (2003) segn el cual, a partir de esa realidad, vivimos el embate de la democracia contra el capitalismo, siendo este, en su actual forma, excluyente en sus principios y fines; sin embargo, democrticamente los espacios pblicos son invadidos por la supremaca del mercado, de lo privado. Decimos democrticamente, pues se manifiesta como algo armnico de desarrollo de un mundo mejor, de una sociedad mejor, de una Universidad mejor. Esta Universidad ha ido constituyndose, histricamente, en el movimiento de desarrollo de la propia historia de vida y de supervivencia de los profesores como trabajadores. Se consolid como institucin en un continuo movimiento de desarrollo del trabajo acadmico. A partir de una visin fatalista, de un futuro inexorable para la Universidad pblica, negamos la comprensin de que los hombres construyen sus historias a partir de la interaccin que mantienen con su realidad. Negamos que, al cambiar esta su realidad cambia tambin, en las palabras de Marx (1984), su pensamiento y los productos de su pensamiento. Pero, para esto, hay una duda primordial: Qu Universidad queremos construir? Qu Universidad estamos construyendo? Qu realidad queremos cambiar? Queremos cambiar? En este contexto, delante de las condiciones de trabajo y de la propia constitucin de la Universidad como institucin social, el proceso de formacin del profesor como investigador viene constituyndose en un reto, que incluye tambin acciones que valoren la graduacin como un espacio de enseanza, investigacin y extensin. Por tanto, necesitamos de profesores en el proceso de formacin en nivel de graduacin dedicados exclusivamente, de modo que al interaccionar con la enseanza puedan desarrollar la investigacin y, al investigar, enseen con acciones indisociables del proceso de formacin, asociadas a la actividad de extensin, como esencia de la Universidad que la diferencia de cualquier otra institucin de enseanza superior. Sin duda, la extensin es una actividad que posibilita un canal de comunicacin de la Universidad con la sociedad. Ribeiro (2003: 71) hace una crtica resaltando que las actividades de extensin se estn analizando limitadamente como una fuente de renta. Advierte que la extensin debe ser el [...] modo como una universidad piensa su entorno, como piensa la sociedad que la cre y la mantiene.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

207

Carla Cristina Dutra Brigo & Clesar Luiz Loch

No hay duda de que limitar el anlisis de la actividad de extensin slo como una fuente de renta es limitar su finalidad mayor, de interaccin sistematizada con la comunidad, con vistas a contribuir con su desarrollo y en ella buscar conocimientos y experiencias para la evaluacin y revitalizacin de la enseanza y de la investigacin. Consideramos que la enseanza, la investigacin y la extensin son el trpode de la Universidad y se realizan a partir de una relacin de interaccin en el proceso de desarrollo de la actividad acadmica, pues, a la vez que la extensin puede ser fuente de renta, puede contribuir en la socializacin del conocimiento junto a la comunidad. Como resalta Eagleton (1999: 15), lo que pensamos y como actuamos son prcticas histricas que se constituyen a partir de la interaccin con la realidad. Sin embargo, advierte el autor que no hay prctica humana fuera del dominio del significado, de la interaccin y de la imaginacin. La prctica del hombre, en este estudio, la prctica del profesor, es objeto de su voluntad, de su consciencia, de la relacin que establece con la realidad, de su formacin y de las condiciones de trabajo a l propiciadas. Posibilitar el proceso de formacin del profesor como investigador a nivel de graduacin, como ya referenciamos, es un reto que en cierto sentido hace deconstruir lo que viene constituyndose por medio de las acciones de las polticas pblicas, que no pueden limitarse slo en la gerencia interna de las instituciones, pero requiere un querer compartido por la propia academia, por la fuerza de trabajo docente, que muchas veces ve de forma amorfa esta situacin que se va constituyendo. La falta de recursos es el gran agravante de la Universidad que determina las condiciones de vida y de trabajo del profesor. Por otro lado, la libertad acadmica y la posibilidad de la bsqueda de recursos junto a los rganos de cooperacin financiera hacen actualmente a la universidad pblica un espacio impar de realizacin del trabajo del profesor, comparado con otras instituciones de enseanza. Quizs una nueva Universidad est surgiendo, donde el Estado no ser ms el proveedor directo y responsable por esa institucin, sino un colaborador junto a los rganos de cooperacin de naturaleza pblica y privada. A partir de ese contexto, posiblemente la propia comunidad acadmica tenga que repensar qu constituye lo pblico, es decir, el espacio pblico. Hay contradicciones en el proceso de manifestacin del espacio pblico en el ejercicio del trabajo acadmico. Aun negando que no contribuyen al proceso de privatizacin de la Universidad, los profesores consciente o inconscientemente s lo hacen al proceso de segregacin, de privatizacin de los espacios pblicos existentes actualmente en esa institucin, como una forma antagnica de mantenerla y legitimarla en la sociedad frente a la omisin del Estado.

Referencias bibliogrficas
BRASIL (1993) Ley n 8.745, de 09 de diciembre. BRASIL (2007). Disposicin Interministerial n 22, de 30 de abril. BRASIL (2007a). Disposicin n 224, de 23 de julio. BRASIL (2007b). Programa de Apoio a Planos de Reestruturao e Expanso das Universidades Federais (REUNI). BRIGO, CARLA CRISTINA DUTRA (2003). O trabalho acadmico do professor universitrio no processo de

desenvolvimento do espao pblico na universidade federal: um estudo de caso na Universidade Federal de Santa Catarina e na Universidade Federal do Rio Grande do Sul. Tese (Doutorado em
Educao)Programa de PsGraduao em Educao, Faculdade de Educao, Universidade Federal do Rio Grande do Sul, Porto Alegre. BRIGO, CARLA CRISTINA DUTRA & LOCH, CLSAR LUIZ (2006). Reflexes sobre o processo de formao do professor a partir do contexto social, poltico e econmico que envolve a educao a distncia. Revista reflexo e aoRevista do departamento de educao da UNISCUniversidade de Santa Cruz do Sul 2, 14, 6584. CHAU, MARILENA DE SOUZA (1999). Ideologia neoliberal e universidade. En OLIVEIRA, FRANCISCO DE & POALI, MARIA CLIA (org.), Os sentidos da democracia: polticas do dissenso e hegemonia global. Petrpolis: Vozes, 2751. CHAU, MARILENA DE SOUZA (2000). A universidade em runas. En TRINDADE, HLGIO (org.), Universidades em runas: na repblica dos professores. Petrpolis: Vozes, 211222.

208 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

Una mirada sobre el proceso de formacin como investigador en la Universidad Pblica Federal brasilea

DAS SOBRINHO, JOS (2002). Universidade e avaliao entre a tica e o mercado. Florianpolis: Insular. EAGLETON, TERRY (1999). Marx e a liberdade. So Paulo: UNESP. KOURGANOFF, WLADIMIR (1990). A face oculta da universidade. So Paulo: UNESP. MARX, KARL (1984). A ideologia alem: teses sobre Feuerbach. So Paulo: Centauros. RIBEIRO, RENATO JANINE (2003). A universidade e a vida atual: Fellini no via filmes. Rio de Janeiro: Campus. SANTOS, BOAVENTURA DE SOUSA (1999). Pela mo de Alice: o social e o poltico na psmodernidade. So Paulo: Cortez. TRIVIOS, AUGUSTO NIBALDO SILVA; BRIGO, CARLA CRISTINA DUTRA & COLAO, MAGDA MARIA. (2003). A formao do educador como pesquisador. TRIVIOS, AUGUSTO NIBALDO SILVA (org.). A formao do educador como pesquisador no MERCOSULCONE SUL, (1760). Porto Alegre: UFRGS. WOOD, ELLEN MEIKSINS (2003). Democracia contra capitalismo: a renovao do materialismo histrico. So Paulo: Boitempo.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 201209

209

REFERENCIA: Ponce de Len, Ana; Valdemoros, M ngeles & Sanz, Eva (2010). El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes.


AnaPONCEDELENELIZONDO MngelesVALDEMOROSSANEMETERIO EvaSANZARAZURI
Correspondencia: AnaPoncedeLenElizondo Correoelectrnico: ana.ponce@unirioja.es Telfono: 941299329 MngelesValdemoros Correoelectrnico: mariadelosangeles.valdemoros @unirioja.es Telfono: 941299306 EvaSanzArazuri Correoelectrnico: eva.sanz@unirioja.es Telfono: 941299288 Direccinpostalcomn: UniversidaddeLaRioja Departamentode CienciasdelaEducacin EdificioVives C/LuisdeUlloa,s/n 26006Logroo (LaRioja,Espaa) Fax: 941299333 Recibido:1dejuniode2010 Aceptado:18deoctubrede2010

RESUMEN
Elpresenteestudiotieneporobjetodeterminarsielcolectivo de profesores influye y cmo en el abandono de la prctica fsicodeportivadelosjvenes. Para ello se ha llevado a cabo una triangulacin metodolgica, empleando tcnicas cuantitativas y cualitativas. La muestra de la fase cuantitativa asciende a 1.978sujetos,el51,7%mujeresyel48,3%hombres,conun nivel de confianza del 95% y un error de muestreo de +/2 sigmas. La variable dependiente analizada en el presente estudioeslasituacindeprcticafsicodeportivadeljoven, y las variables independientes son el sexo, la importancia concedida por los profesores a la actividad fsicodeportiva, el grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por la prctica fsico deportiva de tiempo libre, el nivel de acuerdo sobre si las clasesdeEducacinFsicalessirvieronparainiciarseeneste tipo de prcticas y el grado de acuerdo sobre si estas clases lesresultandivertidas. Sellevanacabounanlisisdescriptivounivariado,unanlisis bivariadoyunanlisisderegresinmultinomial,conelfinde detectar aquellos factores relacionados con los profesores condicionantesdelabandonodeprcticafsicodeportivade sus alumnos. El nivel de significacin considerado en todo casoesp<0,05. En el estudio cualitativo, un total de 41 sujetos han participadoencuatrogruposdediscusin:padres,profesores de Educacin Fsica, profesores de otras reas y los propios jvenes. Los resultados muestran que uno de cada cinco jvenes abandona la prctica fsicodeportiva. Este dato todava resulta ms preocupante entre las chicas, ya que por cada chicoquedejadepracticarhaytreschicasqueabandonan.El anlisis de regresin multinomial desvel diferencias entre chicosychicasenlorelativoalosfactorescondicionantesdel

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

211

Ana Ponce de Len, M ngeles Valdemoros & Eva Sanz

abandono de las actividades motrices. En el caso de los varones, la no consideracin de diversin en estas clases duplica las probabilidades de abandono frente a quienes las valorandivertidas.Enelcasodelasfminas,unaopininde que las clases de Educacin Fsica no les han ayudado a iniciarse en la prctica fsicodeportiva implica el doble de probabilidadesdeabandonarestetipodeexperiencias.

PALABRAS CLAVE: Educacin, actividad fsica, deporte, docentes, abandono.

Teachers educational effect on the abandonment of phyisicalsport practice by the youth


ABSTRACT
This study aims to determine whether and how teachers influence the youth in their physicalsport abandonment. Amethodologicaltriangulation,usingquantitativeandqualitativetechniques,hasbeencarriedout.The quantitativephasesampleconsistedof1978subjects,51.7%womenand48.3%male,withaconfidence levelof95%andasamplingerrorof+/2sigma.Thedependentvariableanalysedinthisstudyisthe physicalsport practice of the youth and the independent variables are: gender, the importance attachedtophysicalsportactivitiesbyteachers,thelevelofagreementonwhetherPhysicalEducation teachershelpedthemtobecomeinterestedinthepracticeofphysicalsportIntheirleisuretime,the level of agreement on whether Physical Education classes helped them get started in this type of practice,andthedegreeofagreementonwhethertheseclassesarefun. An univariate descriptive analysis, bivariate analysis and multinomial regression analysis were performedtoidentifyteachers'factorsdeterminingthephysicalsportabandonmentoftheirstudents. Thesignificancelevelwasestablishedatp<0.05. In the qualitative study, a total of 41 subjects participated in four focus groups: parents, physical educationteachers,teachersinotherareasandyoungpeoplethemselves. TheresultsshowthatoneinfiveyoungstersstoppractisingphysicalsportactivitiesThisfindingiseven moreworryingamonggirls,becauseforeveryboywhostopspractisingsports,threegirlsabandonthis activity.Themultinomialregressionanalysisrevealeddifferencesbetweenboysandgirlsinrelationto thedeterminantsofthemotoractivityabandonment.Formales,notconsideringtheseclassestobefun doublesthepossibilityofabandonmentvisvisthosewhoconsiderthemfun.Forwomen,aviewthat PhysicalEducationclasseshavenothelpedthemtakeupphysicalsportactivitiesmakesittwiceaslikely forthemtoabandonthistypeofexperiences.

KEY WORDS: Education,Physicalleisure,Sport,Teachers,Abandonment.

1. Introduccin
A pesar de que, entre los agentes educativos encargados de las labores de formacin y educacin de nuestros nios y adolescentes, es la familia la institucin por excelencia reconocida como pieza clave en este dispositivo pedaggico, no puede ni debe menoscabarse el rol fundamental del profesorado, dado que se constituye en generador cardinal del quehacer educativo en los ltimos tiempos.

212 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes

Los cambios en la entidad familiar acaecidos en las ltimas dcadas, que guardan relacin con la incorporacin de la mujer al mundo laboral, con mayores niveles de estrs profesional, con diversos imperativos que exigen pasar demasiado tiempo fuera del hogar, as como con las elevadas exigencias que imponemos a los nios en edad escolar relacionadas con su ocupacin en mltiples actividades, tambin extraescolares, traen consigo una realidad que, en ms ocasiones de las deseadas, priva a padres e hijos de disfrutar de una cantidad y calidad de tiempo que posibilite una atencin educativa idnea en el marco familiar. Estas y otras cuestiones derivan en el traspaso de compromisos educativos al colectivo docente, que hasta no hace muchos aos se constituan en competencia de la organizacin familiar. Estos aspectos no son ajenos al mbito fsicodeportivo en el espacio de ocio. De todos es sabido que son muchos los agentes educativos y sociales implicados en este cometido, caso de la familia, los amigos, los profesores y los tcnicos fsicodeportivos, entre otros. En el presente artculo focalizaremos nuestra atencin en el profesorado como agente educativo con poder condicionante en la prctica fsicodeportiva de nios y adolescentes. En concreto, se examinarn las posibles relaciones entre la influencia de este colectivo y el abandono de dicho estilo de vida entre los escolares, indagando en variables como la importancia concedida por el profesorado a la prctica fsicodeportiva, la valoracin que el alumnado realiza de las clases de Educacin Fsica y el sexo, entre otras. Dicho de otro modo, se centrar la atencin en aquellas variables relacionadas con los profesores que, de un modo u otro, favorecen la renuncia de la prctica fsicodeportiva de los discentes.

2. Estado de la cuestin
En primera instancia, en relacin con el influjo de la ayuda manifestada por los docentes para que el adolescente se interese por la prctica fsicodeportiva, autores como Piern, Ruiz de Juan & Garca Montes (2008) constatan que aquellos adolescentes que mantienen un estilo de vida activo se expresan claramente ms favorables a la opinin de que su profesor ha sido quien les ha ayudado a interesarse por dicho hbito que quienes se manifiestan inactivos motrizmente. Atendiendo al gnero, comprueban que es el sexo femenino quien mayoritariamente pone de manifiesto que el profesor no le ha ayudado a interesarse por la actividad motriz. En esta lnea, autores como MartnezLpez, Cachn & Moral (2009) constatan que una amplia mayora de adolescentes declara no recibir ningn tipo de recomendacin para la prctica fsico deportiva por parte de los docentes, y verifican que en los Institutos de Educacin Secundaria se ofrecen menos iniciativas para el fomento de la actividad fsicodeportiva a las chicas que a los chicos. En segundo lugar, aludiendo a la valoracin de las clases de Educacin Fsica por parte de los adolescentes, se descubren investigaciones que evidencian que, por un lado, es un alto porcentaje de alumnos quien percibe que no se est contribuyendo con estas clases a crear una prctica fsico deportiva habitual y sistemtica (RAMOS, VALDEMOROS, SANZ & PONCE DE LEN, 2007) y, por otro, que la evaluacin negativa es ms frecuente entre aquellos que manifiestan un estilo de vida inactivo que entre quienes practican este tipo de actividades, as como que la opinin positiva acerca de la utilidad de las clases de Educacin Fsica disminuye con la edad (PIERN ET AL., 2008). Otros autores ponen en evidencia que una percepcin positiva de estas clases no es suficiente para generar la prctica fsico deportiva (SNCHEZ BAUELOS, 1996). En esta lnea, Moreno & Cervell (2004) constatan, sin embargo, que las experiencias negativas vividas con los profesores de Educacin Fsica s pueden llegar a fomentar frustraciones y generar consecuencias determinantes para el abandono de la prctica fsicodeportiva en un futuro. Por ltimo, Gutirrez Sanmartn & Pilsa (2006) destacan que los adolescentes valoran ms a aquellos profesores que les ayudan cuando se presentan dificultades y que les gustara que sus profesores de Educacin Fsica se preocupasen ms por lo que ellos sienten.

3. Mtodo
En cuanto al mtodo, se proceder a una descripcin sucinta del proceso seguido en la investigacin, en el que se ha realizado una triangulacin metodolgica, operando con tcnicas cuantitativas y cualitativas en dos fases.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

213

Ana Ponce de Len, M ngeles Valdemoros & Eva Sanz

FASE CUANTITATIVA: En esta fase se ha pretendido conocer qu variables relativas al profesorado han podido influir en que determinados jvenes abandonen la actividad fsicodeportiva. El universo de trabajo, un total de 11.259 sujetos, abarca todos los adolescentes que cursan alguno de los cuatro niveles de Educacin Secundaria Obligatoria en los centros educativos de la Comunidad Autnoma de La Rioja (Espaa). La muestra se constituy por 1.978 sujetos, 51,7% mujeres y 48,3% hombres, valor obtenido para un nivel de confianza del 95% y un error de muestreo de +/2 sigmas. La variable analizada en el presente estudio se refiere a la situacin de prctica fsicodeportiva del joven y su posible influencia a partir de variables independientes como el sexo, la importancia concedida por los profesores a la actividad fsicodeportiva, el grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por la prctica fsicodeportiva de tiempo libre, el grado de acuerdo sobre si las clases de Educacin Fsica les sirvieron para iniciarse en este tipo de prcticas y si estas clases le resultan divertidas.

VARIABLES VARIABLE DEPENDIENTE Situacin de prctica fsicodeportiva del joven Sexo Importancia concedida por los profesores a la actividad fsicodeportiva Grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por la prctica fsicodeportiva de tiempo libre Grado de acuerdo sobre si las clases de Educacin Fsica les sirvieron para iniciarse en este tipo de prcticas Las clases de Educacin Fsica le resultan divertidas

CATEGORAS

No practico ni practicaba / No practico pero antes practicaba / Practico pero antes no practicaba / Practico y practicaba Mujer / Varn Nada / Poca / Bastante / Cada vez ms / Mucha / No sabe no contesta Totalmente en desacuerdo / En desacuerdo / Unas veces en desacuerdo otras veces en acuerdo / De acuerdo / Totalmente de acuerdo Totalmente en desacuerdo / En desacuerdo / Unas veces en desacuerdo otras veces en acuerdo / De acuerdo / Totalmente de acuerdo Totalmente en desacuerdo / En desacuerdo / Unas veces en desacuerdo otras veces en acuerdo / De acuerdo / Totalmente de acuerdo

VARIABLES INDEPENDIENTES

TABLA 1. Variables que intervienen en este estudio

Para la tcnica cuantitativa se utiliza como instrumento una parte del cuestionario MACOFYD (PONCE DE LEN ET AL., 2010), ya validado y configurado por un total de 39 tems, de los cuales se extrajeron los referidos a las variables anteriormente mencionadas. El anlisis y tratamiento de los datos recogidos con el cuestionario se realiz con ayuda del programa estadstico SPSS 15.0, efectuando un anlisis descriptivo univariado y un anlisis bivariado a travs del coeficiente V de Cramer. Todas las variables relacionadas significativamente, en el anlisis bivariado, con la situacin de prctica fsicodeportiva de los jvenes, fueron incluidas en un anlisis de regresin multinomial con el fin de detectar aquellos factores, relacionados con los profesores, que se establecen en condicionantes de la ausencia de prctica fsicodeportiva de los alumnos. El nivel de significacin considerado en todo caso es p<0,05. FASE CUALITATIVA: Se utiliz la tcnica de los grupos de discusin, quedando configurados cuatro grupos: padres, profesores de Educacin Fsica, profesores de otras reas, as como los propios jvenes, con un total de 41 participantes.

214 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes

La seleccin de los participantes fue estructural, eligiendo la formacin de los distintos colectivos segn criterios de pertenencia. Se tuvieron en cuenta los siguientes principios: homogeneidad en cuanto a colectivo educativo, heterogeneidad en funcin del sexo, tendencia a equilibrar el nmero en relacin con la procedencia capital o resto de la provincia y equilibrio en el tipo de centro pblico y concertado. La introduccin del tema se llev a cabo de manera denotada (RUBIO & VARAS, 2004) y se confeccion un protocolo de seguimiento, cuyas cuestiones se recogen en Valdemoros (2010). Para optimizar la fiabilidad, fue un nico investigador el encargado del anlisis de los datos y se opt por un criterio de flexibilidad en cuanto a la duracin de los grupos de discusin, finalizndolos cuando la saturacin o redundancia de los discursos comenzaba a ser evidente. Finalmente, se observ a lo largo de la intervencin de un mismo individuo si fluctuaba o no su opinin con respecto a una categora examinada. Los relatos surgidos en estos grupos de discusin fueron analizados con el apoyo del paquete informtico NUD*IST. Las categoras y subcategoras de anlisis se validaron a travs del juicio de expertos, los cuales identificaron las unidades textuales de uno de los grupos de discusin (profesores de Educacin Fsica), registrndolas en las categoras y subcategoras consideradas. Los datos obtenidos se transcribieron al SPSS 15.0, y se aplic la frmula Kappa de Cohen (COHEN, 1960; 1968) para medir la fiabilidad entre los evaluadores, de lo que result un proceso de validacin satisfactorio. Los coeficientes Kappa obtenidos entre el investigador principal y cada uno de los expertos, as como el grado de acuerdo estimado en funcin del ndice Kappa, segn los mrgenes propuestos por Landis & Koch (1977), son favorables. Respecto al grado de concordancia entre el resto de expertos, las puntuaciones en ningn momento han sido inferiores a 0,5, pues son ndices que reflejan un grado de acuerdo entre moderado, bueno y muy bueno. De esta forma, con los resultados obtenidos puede darse por satisfactorio el proceso de validacin de categoras de la presente investigacin.

4. Resultados
Al analizar la situacin de prctica fsicodeportiva de los jvenes se detecta que casi todos ellos (un 96,9%) han realizado a lo largo de su vida alguna actividad fsica en su tiempo libre. No obstante, este dato tan positivo presenta su parte negativa al descubrir que un elevado porcentaje de adolescentes (el 18,5%) ha dejado de ejercitarse motrizmente en su espacio de ocio (ver figura 1).

100 80 60 40 18,5% 20 0 3,1%


No practico ni practicaba No practico pero antes si practicaba

73,5%

4,9%
Practico pero antes no practicaba Practico y practicaba

FIGURA 1. Comportamiento fsicodeportivo pasado y presente.

Este abandono aumenta considerablemente en el colectivo de chicas, entre las que tres de cada diez han cesado su actividad fsica, mientras que en los chicos este ndice se reduce hasta el 8,92%. A este respecto, el anlisis relacional confirma que estas diferencias son significativas (V de Cramer: 0,264***)1 y, por lo tanto, ratifica que por cada chico que deja de practicar hay tres chicas que abandonan.
1

Los asteriscos que acompaan a cada coeficiente sealan su nivel de significacin: [*p significatividad<0,05; **p significatividad< 0,01; ***p significatividad<0,001]
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

215

Ana Ponce de Len, M ngeles Valdemoros & Eva Sanz

No practico pero antes practicaba 30 25 20 15 10 5 0 27,26%

8,92%

chicos

chicas

FIGURA 2. Comportamiento fsicodeportivo pasado y presente por sexo

Los resultados del anlisis de regresin multinomial certifican que las mujeres jvenes (odds ratio [OR]=4,248) tienen 4 posibilidades ms de abandonar su prctica fsicodeportiva que los hombres (Tabla 2).
Odds ratio (95% CI) 4,248 (3,2375,575)

Variables Sexo Constante

Categora referencia Hombre

1,446 3,491

SE () 0,139 0,383

P valor
< 0.001

TABLA 2. Resultados del anlisis de regresin multinomial

Continuando con el anlisis relacional bivariado, resulta interesante que la situacin de prctica fsicodeportiva de los jvenes no se asocia significativamente ni con la importancia que conceden los profesores a las actividades fsicodeportivas ni con el grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por la prctica fsicodeportiva de tiempo libre. Sin embargo, s se detectan diferencias significativas, aunque muy dbiles, en la situacin de prctica fsicodeportiva en funcin de si al adolescente le resultan divertidas las clases de Educacin Fsica (V de Cramer 0,064**) y de si considera que las clases de Educacin Fsica le han servido para introducirse en la prctica fsicodeportiva (V de Cramer 0,063**), tal y como se representa en la figura 3.

Resultan divertidas las clases de Educacin Fsica

,064**

Situacin de prctica actual y anterior


,063**

Importancia concedida por los profesores a la AFD

Las clases de Educacin Fsica le han servido para introducirse en la prctica fsicodeportiva
FIGURA 3. Anlisis relacional bivariado de la situacin de prctica actual y anterior

con las variables independientes del estudio.

216 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes

En esta lnea, el anlisis cualitativo nos muestra cmo las percepciones de los padres concuerdan con la realidad al considerar que los profesores de otras reas distintas de la Educacin Fsica no ejercen ningn tipo de influencia positiva sobre los adolescentes para la participacin en experiencias fsico deportivas. Las siguientes unidades textuales forman parte de los registros recogidos alusivos a esta materia:

Aunque hay unos temas transversales que se tocan en todas las asignaturas y uno de ellos es la salud y lo podan relacionar con el deporte, se hace de aquellas maneras, muy por encima. No se le dedica tiempo ni importancia.
Sin embargo, en contra de lo que se ha comprobado en los datos cuantitativos, los padres piensan que son los profesores de Educacin Fsica los nicos que ejercen influencia positiva sobre sus estudiantes que les lleva a realizar actividad fsica en el tiempo libre. As lo muestran las siguientes unidades textuales:

El nico que puede influir es el profesor de Educacin Fsica. Y depende de las ganas que tenga, de la edad y de lo informado que est.
Si descendemos un poco ms y realizamos el anlisis relacional segmentado por sexo, se revela que, mientras que la situacin de prctica y si al adolescente le resultan divertidas las clases de Educacin Fsica se asocian significativamente en el colectivo de hombres (V de Cramer 0,086*) pero no en el de mujeres, la situacin de prctica y si considera que las clases de Educacin Fsica le han servido para introducirse en la prctica fsicodeportiva se asocian significativamente en el colectivo de mujeres (V de Cramer 0,103**) pero no en el de hombres. Asimismo, a pesar de que para el conjunto de la poblacin adolescente no se ha detectado una relacin significativa entre la situacin de prctica y el grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por la prctica fsicodeportiva de tiempo libre, s se constata una asociacin significativa, aunque muy dbil, entre estas dos variables en el grupo de mujeres (V de Cramer 0,083*) pero no en el de hombres (Figura 4).

HOMBRES Resultan divertidas las clases de Educacin Fsica


,086*

Las clases de Educacin Fsica le han servido para introducirse en la prctica

Situacin de prctica actual y anterior


MUJERES

Importancia concedida por los profesores a la AFD

Las clases de Educacin Fsica le han servido para introducirse en la prctica

Situacin de prctica actual y anterior


,103**

Importancia concedida por los profesores a la AFD

Las clases de Educacin Fsica le han servido para introducirse en la prctica fsicodeportiva
FIGURA 4. Anlisis relacional bivariado de la situacin de prctica actual y anterior con las variables

independientes del estudio por sexo.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

217

Ana Ponce de Len, M ngeles Valdemoros & Eva Sanz

A partir de aqu, se realiza un anlisis de regresin multinomial centrndonos, por un lado, en los chicos jvenes que han abandonado la prctica fsicodeportiva y, por otro, en las chicas que tambin han dejado estas actividades. Los resultados desvelan que el hecho de que los chicos no estn de acuerdo con que las clases de Educacin Fsica sean divertidas (odds ratio [OR] = 2,181) duplica las posibilidades de que abandonen sus prcticas motrices frente a los chicos que estn totalmente de acuerdo con que sus clases de Educacin Fsica son divertidas.
Categora referencia Totalmente de acuerdo Odds ratio (95% CI) 2,181 (1,1484,141)

Variables Se muestran en desacuerdo ante la expresin las clases de Educacin Fsica resultan divertidas Constante

0,780 2,485

SE () 0,327 0,256

P valor
<0.05

TABLA 3. Resultados del anlisis de regresin multinomial en los chicos

Por su parte, aquellas chicas que estn totalmente en desacuerdo (odds ratio [OR] = 2,628) o simplemente en desacuerdo (odds ratio [OR] = 2,087) con que las clases de Educacin Fsica les hayan ayudado a introducirse en las actividades fsicas de ocio presentan el doble de probabilidades de abandonar este tipo de experiencias que aquellas chicas que se muestran totalmente de acuerdo. Sin embargo, la percepcin que tengan sobre si su profesor de Educacin Fsica les ha ayudado a introducirse en las prcticas motrices de tiempo libre, a pesar de asociarse con la situacin de prctica, no se constituye en causa del abandono fsicodeportivo de este colectivo.
Categora referencia Totalmente de acuerdo Odds ratio (95% CI) 2,628 (1,3015,309)

Variables Se muestran totalmente en desacuerdo ante la expresin las clases de Educacin Fsica te han ayudado a introducirte en la prctica fsicodeportiva Se muestran en desacuerdo ante la expresin las clases de Educacin Fsica te han ayudado a introducirte en la prctica fsicodeportiva Constante

SE ()

P valor

0,966

0,359

<0,05

Totalmente de acuerdo

0,736

0,337

2,087 (1,0784,041)

<0,05

TABLA 4. Resultados del anlisis de regresin multinomial en las chicas

5. Discusin
La alta participacin en actividades fsicodeportivas descubierta entre nuestros adolescentes esconde, en su perspectiva negativa, que una cota nada desestimable de los mismos acaban abandonando este estilo de vida, siendo especialmente preocupante entre el sexo femenino, dado que hemos podido constatar que las probabilidades de que una chica renuncie a este tipo de prcticas se cuadruplica con respecto al sexo masculino. A su vez, los resultados obtenidos en la presente investigacin constatan que la prctica fsico deportiva de los jvenes analizados no se relaciona ni con la importancia que otorgan los docentes a la actividad motriz ni con el grado de acuerdo sobre si el profesorado de Educacin Fsica les ha ayudado a interesarse por dicho hbito. Resultados que se contraponen a los obtenidos por Piern et al. (2008), quienes asociaron la inactividad motriz con la percepcin del adolescente de que su profesor no le haba ayudado a interesarse por la prctica motriz. Sin embargo, s se ha descubierto asociacin entre la situacin de prctica de los chicos y el hecho de que las clases de Educacin Fsica le resulten divertidas, y, en las chicas, su situacin de

218 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

El influjo educativo de los profesores en el abandono de la prctica fsicodeportiva de los adolescentes

prctica se relaciona con la consideracin de que estas clases le han servido para introducirse en las actividades fsicodeportivas. En esta lnea es preciso destacar, como aportacin de nuestra investigacin, las diferencias detectadas entre chicos y chicas en lo relativo a los factores condicionantes del abandono de dicho estilo de vida, que guarda relacin con el grado en que las clases de Educacin Fsica resultan divertidas, en el caso de los chicos, y con la consideracin de que estas clases les han servido para iniciarse en este tipo de actividades, en el caso de las chicas. En el caso de los varones, nuestros resultados sintonizan con la constatacin de Moreno & Cervell (2004), en cuanto a que las experiencias negativas en las clases de Educacin Fsica pueden derivar en la renuncia al hbito fsicodeportivo, si bien podemos verificar, como aportacin del presente estudio, que la no consideracin de diversin en estas clases duplica las probabilidades de abandono frente a quienes las valoran divertidas. A su vez, autores como Piern et al. (2008) y MartnezLpez et al. (2009), atendiendo al sexo femenino, comprueban que es quien mayoritariamente pone de manifiesto que el profesor no le ha ayudado a interesarse por la actividad motriz y que en los Institutos de Educacin Secundaria se ofrecen menos iniciativas para el fomento de la actividad fsicodeportiva a las chicas que a los chicos, respectivamente. Lejos de poder ratificar estas conclusiones en la investigacin que nos ocupa, s estamos en disposicin de aportar que en el caso de las chicas, una opinin de que las clases de Educacin Fsica no les han ayudado a iniciarse en la prctica fsicodeportiva implica el doble de probabilidades de abandonar este tipo de experiencias; sin embargo, la percepcin que tengan sobre si su profesor de Educacin Fsica les ha ayudado a introducirse en las prcticas motrices de tiempo libre no se constituye en causa del abandono. Conscientes de las limitaciones de nuestro estudio y consecuentes con la importancia que ha de concederse a las cuestiones de gnero en la prctica fsicodeportiva en el espacio de ocio del adolescente, se propone como prospectiva de este trabajo continuar profundizando en este tipo de cuestiones.

6. Conclusiones
1. Pese a la elevada proporcin de adolescentes con un antecedente fsicodeportivo activo, se constata una importante cota que ha renunciado a dicho hbito y que es preciso tener en consideracin. Se constata mayor ndice de abandono de la prctica fsicodeportiva entre las chicas que entre los chicos. La importancia que conceden los profesores a las actividades motrices, as como la ayuda que stos proporcionan para interesarse por dicho hbito, no se constituyen en factores determinantes de la situacin de prctica fsicodeportiva del adolescente. Los padres perciben que son los profesores de Educacin Fsica los nicos docentes que ejercen una influencia positiva sobre sus alumnos para inducirles a realizar actividad fsica en el tiempo libre. La opinin de los chicos, no as de las chicas, acerca de la diversin inherente a las clases de Educacin Fsica, se constituye en factor condicionante para el abandono de la prctica fsicodeportiva, en aquellos casos en los que el dictamen es negativo. La opinin de desacuerdo, por parte de las chicas, sobre que las clases de Educacin Fsica les han ayudado a interesarse por la prctica motriz, se establece en agente determinante para la renuncia al hbito fsicodeportivo.

2. 3.

4.

5.

6.

Referencias bibliogrficas
COHEN, J. A. (1960). Coefficient of agreement for nominal scales. Educational and Psychological Measurement (Charlottesville, VA) 20, 3746. COHEN, J. A. (1968). Weighted kappa: Nominal scale agreement with provision for scaled disagreement of partial credit. Psychological Bulletin (Washington) 70, 213220.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

219

Ana Ponce de Len, M ngeles Valdemoros & Eva Sanz

GUTIRREZ SANMARTN, M. & PILSA, C. (2006). Actitudes de los alumnos hacia la Educacin Fsica y sus profesores. Revista Internacional de Medicina y CC. de la Actividad Fsica y el Deporte, 24. LANDIS, J. R. & KOCH, G. (1977). The measurement of observer agreement for categorical data. Biometrics (Arlington, TX) 33, 159174. MARTNEZLPEZ, E. J., CACHN, J. & MORAL, J. E. (2009). Influences of the school and family context in the adolescents physical activity. Special attention to the obese pupil. Journal of Sport and Health Research, 1 (1), 2645. MORENO, J. A. & CERVELL, E. (2004). Pensamiento del alumno hacia la educacin fsica: su relacin con la prctica deportiva y el carcter del educador. Enseanza, 21, 345362. PIERN, M., RUIZ JUAN, F. & GARCA MONTES, M. E. (2008). La opinin del alumno de educacin secundaria sobre las clases de educacin fsica: un desafo para los profesores y los formadores. Revista de la Facultad de Ciencias de la Educacin, 8. PONCE DE LEN, A., SANZ, E., RAMOS, R. & VALDEMOROS, M. A. (2010). Cuestionario de motivaciones, actitudes y comportamientos en el ocio fsicodeportivo juvenil. MACOFYD. Logroo: Universidad de La Rioja. RAMOS, R., VALDEMOROS, M. A., SANZ, E. & PONCE DE LEN, A. (2007). La influencia de los profesores sobre el ocio fsico deportivo de los jvenes: percepcin de los agentes educativos ms cercanos a ellos. Revista de currculum y formacin del profesorado, 11, 2. Disponible en: http://www.ugr.es/~recfpro/. RUBIO, M. J. & VARAS, J. (2004). El anlisis de la realidad en la intervencin social. Madrid: CCS. SANCHEZ BAUELOS (1996). La actividad fsica orientada hacia la salud. Madrid: Biblioteca Nueva. VALDEMOROS, M. A. (2010). Los valores en el ocio fsicodeportivo juvenil. Anlisis y propuestas educativas. Logroo: Universidad de La Rioja.

Agradecimientos
Agradecemos a la Consejera de Educacin, Cultura y Deporte del Gobierno de La Rioja la financiacin a la investigacin, de la cual se deriva este artculo, dentro del marco del Plan Riojano de I+D+I del Gobierno de La Rioja (Ref. Fomenta 02/2007).

220 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 211220

REFERENCIA: Salavera Bords, Carlos (2010). Trabajando la prevencin: habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Trabajando la prevencin: habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela
CarlosSALAVERABORDS

Correspondencia: CarlosSalaveraBords Correoelectrnico: salavera@unizar.es Telfono: 976761000(4400) Direccinpostal: FacultaddeEducacin Dpto.dePsicologaySociologa C/SanJuanBosco,7 E50009Zaragoza (Espaa) Recibido:1dejuliode2010 Aceptado:18deoctubrede2010

RESUMEN
La esquizofrenia es una enfermedad mental grave que afectaal1%delapoblacin,independientementedesexo, clasesocialonivelacadmico.Semanifiestaalolargodela adolescencia, teniendo su efervescencia en torno a los 20 aos. Las personas afectadas comienzan a mostrar comportamientosextraos(retraimiento,aislamientosocial, abandono de la autoimagen) en la adolescencia, siendo la comunicacinunadelaspartesmsafectadas,conpobreza tanto del contenido como del propio discurso. Conocer la enfermedadporpartedelprofesoradopuedeserunabuena herramienta diagnstica que ayude a una intervencin precoz,quefreneeldeterioroyayudealosadolescentesa mantener su vida normal y poder continuar los estudios, evitandoelfracasoescolarquesedaenestapoblacin.

PALABRAS CLAVE: Prevencin, Escuela, Habilidades


comunicativas,Esquizofrenia.

Working on prevention: Communication abilities in schizophrenics. Knowing the disease to work from the school
ABSTRACT:
Schizophreniaisaseriousmentalillnesswhichaffects1%ofthepopulation,regardlessofgender,social class or academic background. It manifests itself throughout adolescence and it reaches its peak at around20.Thoseaffectedbythisillnessstartshowingstrangebehavioursinadolescence(i.e.shyness, social isolation, lack of concern with their selfimage); communication is one of the aspects most severelyaffected,thecontentanddiscoursecompetencebecomingverypoor.Iftheteachersareaware oftheillness,theymaybeabletodiagnoseit,thuscontributingtoitsearlydetection,whichmayslow downdeteriorationandhelpadolescentstocontinuewiththeirdailylifeandtheirstudiesandavoiding schoolfailure,whichisratherhighamongthispopulation.

KEY WORDS: Prevention,School,Communicationabilities,Schizophrenia.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

221

Carlos Salavera Bords

Introduccin y antecedentes
El presente artculo es continuacin de la Tesis Doctoral Habilidades comunicativas y trastornos formales del pensamiento en personas con esquizofrenia, presentada por Carlos Salavera Bords el 26 de febrero de 2010 en el Departamento de Psicologa y Sociologa de la Universidad de Zaragoza, con la direccin de los doctores Miguel Puyuelo Sanclemente y Rafael Penads Rubio. La prevencin y deteccin de las posibles dificultades que presentan nuestros alumnos se muestra de vital importancia en la atencin precoz de estos problemas, facilitando su permanencia en el sistema educativo. Los alumnos que comienzan a manifestar una enfermedad mental tienen afectado su tono afectivo, su conducta y la manera en que se comunican con otras personas. En el caso de la esquizofrenia, que en s significa mente escindida, las personas afectadas necesariamente sufren graves deterioros cognitivos y comportamentales. La edad de aparicin est comprendida entre los 15 y los 45 aos, aunque suelen comenzar al final de la adolescencia; tambin hay casos de aparicin en la infancia, que suelen enmascararse con problemas escolares o mal comportamiento. Con frecuencia, se hace crnico y discapacitante. Por su gravedad, es un problema de importancia para la salud, significando una carga tanto para las familias de los enfermos como para los propios enfermos (MORENO, JIMNEZ, GODOY, TORRES & PREZ, 2002). La comunidad cientfica y educativa est de acuerdo en conceptualizar la esquizofrenia como una enfermedad mental grave y, sin duda, uno de los mayores problemas de salud a los que la sociedad se enfrenta (ANDREASEN, 2000), llegando a cifrar que afecta al 1% de la poblacin mundial, padecindola las personas independientemente de la cultura, la raza o la clase social. La evolucin de la enfermedad se presenta variable. La enfermedad supone para la persona la prdida de funciones cognitivas y emocionales, adems de graves deterioros en el contacto social y en reas de estudio, empleo y actividades diarias, abandonando los estudios que estaban cursando. Muchas de las personas que la padecen experimentan un grado considerable de discapacidad (ANDREASEN, 1999). Los tratamientos disponibles reducen este sufrimiento considerablemente, pero aproximadamente 2/3 de las personas que desarrollan esquizofrenia precisan asistencia pblica del sistema sanitario, abandonando sus estudios la prctica totalidad de las personas afectadas (SALAVERA, 2008). A pesar de los aos de estudio y de los esfuerzos que se han hecho desde los ms amplios mbitos de la investigacin, sigue siendo una necesidad explorar diferentes aspectos del trastorno (cognitivos, sociales, relacionales, rehabilitadores) para mejorar su comprensin y tratamiento. En este sentido son muchos los trabajos que han explorado aspectos rehabilitadotes, tanto a nivel global como sobre aspectos especficos de la esquizofrenia, concluyendo en la necesidad de seguir investigando todos los matices que rodean y forman parte de una u otra manera de la esquizofrenia. El estudio del lenguaje en la esquizofrenia viene desde los propios comienzos de la enfermedad como tal, ya que tanto Bleuler (1911) como Kraepelin (1919), en su definicin de esquizofrenia situaban los problemas del lenguaje como un aspecto central en la misma. Pero tras unos comienzos esperanzadores en este campo, con estudios que abordaban una y otra vez la relacin entre lenguaje y esquizofrenia, la inquietud en este sentido cay en desuso. Tan slo alguna aportacin en los principios de los aos 80 (ANDREASEN, 1979a, b; CROW, 1980) rescat algo de este inters, para despus volver a distenderse. En ltimas fechas se ha reactivado este tema de estudio, con la aparicin de nuevos planteamientos que realizan un abordaje menos global y ms especfico sobre los distintos aspectos del lenguaje que aparecen daados en la esquizofrenia. As, se trabaja sobre la semntica, sintaxis, morfologa, fontica y pragmtica, pero tambin sobre aspectos coadyuvantes con estos: atencin, memoria, paralingstica, comunicacin no verbal o lenguaje escrito.

Definicin de esquizofrenia
En el caso de la esquizofrenia, la persona que la sufre experimenta una distorsin de los pensamientos y sentimientos. Lo que caracteriza a la esquizofrenia es que tiene una afectacin global en la persona, por lo que quien la padece comienza a sentir, pensar y hablar de forma diferente a como lo haca antes. Dicha persona puede empezar a estar extraa ms aislada, puede evitar salir con amigos, duerme poco o demasiado, habla solo o se re sin motivo aparente (aunque estos sntomas no tienen porque aparecer en todos los pacientes.)

222 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

Trabajando la prevencin: habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela.

Es muy importante no olvidar que la persona que tiene una esquizofrenia no puede explicar lo que le est sucediendo, tiene miedo de hacerlo o de creer que est enfermo y por lo tanto no pedir ayuda ni se quejar de lo que le sucede en la mayora de los casos. Por todo esto la mayor parte de ellos, y sobre todo al comienzo de la enfermedad, no aceptan tomar medicacin ni pedir ayuda a sus familiares, profesores o tutores. Segn el DSM IVTR (APA, 2002), la esquizofrenia tiene como sntomas caractersticos dos (o ms) de los siguientes: ideas delirantes, alucinaciones, lenguaje desorganizado, comportamiento catatnico o gravemente desorganizado y sntomas negativos, durante al menos un mes (o menos si se han tratado con xito). Adems produce una disfuncin social/laboral y tiene una duracin de al menos 6 meses, tiempo suficiente para que se produzca el abandono del sistema educativo.

Situacin en la escuela
En el trabajo diario con los alumnos, un pequeo porcentaje comienza a presentar problemtica de salud mental. Una de las diferencias existentes entre los alumnos con prdromos de esquizofrenia y alumnos con otro tipo de problemas psicolgicos o de comportamiento es que el primer grupo presenta una gran dificultad para mantener una conversacin ya no coherente, sino inteligible; estas dificultades que no son en principio observables en otro tipo de problemas psicolgicos. Una de las caractersticas de los alumnos con rasgos esquizofrnicos y de su enfermedad es el aislamiento social, que junto con la apata y la falta de atencin es lo que se denomin sntomas negativos de la enfermedad. Adems, hacen uso de una sintaxis correcta, pero su semntica es en ocasiones ilgica; de hecho, aunque sus habilidades lxicas, morfolgicas, fonolgicas, sintcticas y otras capacidades relacionadas no parecen estar mermadas, no sucede as en el campo de la semntica y la pragmtica (MCKENNA & OH, 2007). As, en la semntica, estos alumnos cambian el significado o la interpretacin del significado de un determinado smbolo, palabra, lenguaje o representacin formal: es lo que se denomina Trastornos Formales del Pensamiento. En el campo de la pragmtica se refleja en una pobreza de contenido de discurso, perseveracin y circunstancialidad (CRIDER, 1997); su oratoria es muy difcil de entender, no hacen uso de la habilidad para comunicar irona, tienen que pedir aclaracin y demuestran poca habilidad para instrucciones verbales. Si comparamos estos alumnos con rasgos esquizofrnicos con otros sin presencia de problemtica psicopatolgica, estas observaciones se acentan. Los alumnos con rasgos esquizotpicos, que en muchos casos, si no se trabaja desde la intervencin precoz, terminarn desarrollando esquizofrenia en la edad adulta, pueden utilizar el lenguaje de forma adecuada, pero no logran comunicarse bien debido a que no tienen en cuenta a sus interlocutores y las necesidades informativas de stos. Su actuacin cuando el nmero de elementos verbales es superior a tres o cuatro empeora drsticamente (ADDINGTON & ADDINGTON, 2006). Hay un exceso de monlogos en este tipo de alumnos; esto nos llevara a sealar que el discurso es pobre, que cuesta un gran esfuerzo por parte del interlocutorreceptor conseguir nexos de unin entre las frases que den consistencia a la conversacin, que el nmero de comentarios espontneos es mnimo, lo que obliga al receptor a forzar en todo momento la conversacin para darle una continuidad que no siempre se consigue, por no hablar de lo complicado que resulta para esta poblacin el cambio de tema a mitad del discurso, representando gran dificultad los mtodos tradicionales utilizados con este fin de cambio de tema: al hilo y a saltos (LEROY & BEAUNE, 2007; SALAVERA, 1999). Cuando una persona con esquizofrenia acta como emisor encuentra grandes dificultades a la hora de proporcionar informacin que le permita identificar un nico referente (ADDINGTON & ADDINGTON, 2008). Las descripciones ofrecidas son inadecuadas para las necesidades del oyente con respecto a la tarea que se quiere desarrollar, y el diseo en funcin del receptor es defectuoso, con las consecuencias que tiene esto en la interaccin con los dems y en el aula.

Participantes y seleccin de la muestra


En la investigacin para la tesis, la idea era analizar las habilidades de comunicacin utilizadas por las personas con esquizofrenia. Para la seleccin de la muestra se formalizaron dos grupos:

Grupo casos: Se tomaron pacientes, todos en tratamiento en Centro de Da, con diagnstico de esquizofrenia (criterios DSM IVTR). La poblacin de la investigacin consisti en pacientes con diagnstico de esquizofrenia que reciben un tratamiento ambulatorio en instituciones de Salud Mental.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

223

Carlos Salavera Bords

Grupo control: Personas sin patologa mental, grupo control, para contrastar lenguaje en personas con y sin esquizofrenia. El grupo de sujetos sanos (personas sin patologa mental), que servir como grupo control, estaban emparejados en cuanto a edad, sexo y nivel de estudios con el grupo casos.
Todos ellos (casos y controles) firmaron un consentimiento informado, aceptando su participacin voluntaria en el estudio tras ser informados de los objetivos del mismo. La tcnica de muestreo empleada es de tipo no probabilstica o emprica, en su modalidad intencional o intencionada, ya que, debido a las caractersticas del estudio, se tomaron en cuenta algunos criterios para la seleccin de la muestra con el fin de uniformizarla.

Procedimiento
Para la realizacin del estudio, se utilizarn por un lado, materiales para evaluar capacidades generales; por otro lado, rasgos psicolingsticos y trastornos formales del pensamiento. Adems, se realizarn entrevistas estructuradas de cara a evaluar el discurso del paciente. Se llevar a cabo en cuatro fases: 1) Evaluacin inicial de los dos grupos; 2) Contraste entre las diferentes escalas del estudio; 3) Contraste y anlisis: evaluacin de los resultados del grupo 1 y simultneamente del grupo 2; y 4) Anlisis de correlaciones entre los distintos valores obtenidos y comparacin intergrupos.

Material y mtodo
Para la evaluacin de la capacidad verbal actual se utiliz el test de inteligencia WAIS III (WESCHLER, 2000), por ser un instrumento que nos indica el estado general global de los pacientes, as como de sus capacidades, adems de una medida verbal tanto en el mbito de coeficientes como de ndices e interrelacin entre ellos. El apartado de pragmtica se analiz con el mdulo de Pragmtica del BLOCSR (PUYUELO, WIIG, RENOM & SOLANAS, 2004), instrumento diseado para nios pero que, en estudios previos, funcion bien en poblaciones clnicas. Tambin se utiliz el Test de Acentuacin de Palabras (T.A.P.) de GonzlezMontalvo (1991), que permite conocer la capacidad verbal previa en los sujetos de estudio. Es un test rpido y sencillo que nos permite conocer el nivel cultural e intelectual previo del paciente para poder inferir su situacin cognitiva actual. Es un test basado en el reconocimiento de palabras poco frecuentes en el habla diaria, escritas ntegramente en maysculas y sin tilde. Es un instrumento muy til para estimar el nivel cultural premrbido en pacientes en los que existan serias dudas sobre su nivel real y la presencia o no de deterioro significativo. La hiptesis es que para que el sujeto lea correctamente las palabras debe haberlas visto con anterioridad. A un nivel cultural previo ms alto se le supone una mayor riqueza lxica. Para el anlisis cualitativo de los rasgos psicolingsticos utilizaremos una serie de tres entrevistas estructuradas en las que se iban puntuando los diferentes rasgos segn la escala para valoracin de los trastornos del Pensamiento, Lenguaje y Comunicacin (T. L. C.) de Andreasen para analizar todo lo concerniente al lenguaje y su anlisis. Posteriormente para completar esta valoracin se realizarn tres entrevistas de treinta minutos con cada paciente, para ver la continuidad en el discurso y analizar aspectos de semntica y pragmtica.

Resultados
Los resultados de la investigacin muestran cmo el lenguaje a nivel de semntica y pragmtica en personas con esquizofrenia se encuentra alterado, con un deterioro evidente, utilizando de una manera peculiar las palabras, existiendo una estructura propia del lenguaje en esta enfermedad, pudiendo hablarse de un lenguaje esquizofrnico. Su sintaxis es correcta y tanto las habilidades lxicas, como las morfolgicas y fonolgicas no parecen estar mermadas, no ocurriendo lo mismo con semntica y pragmtica, que se encuentran muy daadas debido al procesamiento atencional que necesitan. Por otra parte, la utilizacin del apartado de Pragmtica del BLOCSR para el anlisis del lenguaje en personas con esquizofrenia se ha revelado como muy til y con una gran fiabilidad en este apartado, encontrndose adems la relacin entre psicopatologa y puntuaciones obtenidas en la prueba, lo que indica que la pragmtica est condicionada por el estado psicopatolgico de la persona con esquizofrenia. Ha quedado demostrada la relacin entre la presencia de trastornos del lenguaje y

224 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

Trabajando la prevencin: habilidades comunicativas en personas con esquizofrenia. Conocer la enfermedad para trabajar desde la escuela.

una mala ejecucin de las habilidades comunicativas, con un deterioro en las tareas comunicativas de las personas con esquizofrenia, que indicara que las producciones verbales de los esquizofrnicos estn afectadas sobre todo en su nivel superior, que tiene que ver con la semntica, la sintctica o la pragmtica. Adems, se encontr afectacin en el lenguaje de las personas con diagnstico de esquizofrenia, con puntuaciones inferiores tanto en el WAISVerbal como en el apartado de pragmtica del BLOCSR, siendo ste ltimo el que mayor peso tiene en este apartado, mostrndose como una prueba eficaz en el diagnstico de la esquizofrenia en funcin del lenguaje. Por otro lado, el Test de Acentuacin de Palabras seal bien los niveles premrbidos de los sujetos, no encontrndose afectado por la presencia o no de la enfermedad. Por otro lado, los sujetos con esquizofrenia obtuvieron unas puntuaciones inferiores en el WAIS equivalentes a media desviacin estndar, seal del deterioro que produce la enfermedad.

Discusin y conclusiones
Los resultados de la investigacin avalan la evaluacin de las habilidades comunicativas, de cara a plantear si stas pueden servir como elemento diagnstico de la esquizofrenia y permitir trabajar en la prevencin del deterioro de estas habilidades comunicativas en los alumnos en los que est comenzando a manifestarse la esquizofrenia. En la esquizofrenia el lenguaje, se encuentra gravemente afectado, implicando a otras reas de funcionamiento de las personas con esta enfermedad, pudindose hablar de un habla esquizofrnica (SALAVERA, 2008). La capacidad cognitiva, como sealan Addington & Addington (2006), sufre deterioro desde los primeros episodios de esquizofrenia, lo que afecta a su nivel comunicativo. Aspectos como la semntica y la pragmtica se encuentran seriamente alterados, condicionando el desempeo de estos alumnos con rasgos esquizofrnicos en su vida diaria (BELINCHN, 1987; CHAIKA, 1974; LEROY & BEAUNE, 2008; SALAVERA, 1999; TNYI, HEROLD, SZILI & TRIXLER, 2002). Diagnosticar estas dificultades ayudara en el trabajo diario en la escuela, permitiendo trabajar estos aspectos como refuerzo y proteccin de nuestros alumnos. Los datos obtenidos y el anlisis de los mismos nos lleva a confirmar las dos hiptesis iniciales: la primera, que indicaba que la esquizofrenia acarrea trastornos del lenguaje sobre todo a nivel de semntica y pragmtica determinando las habilidades comunicativas del sujeto; y una segunda, que indica cmo las distorsiones en el lenguaje de los esquizofrnicos son consecuencia de su propia enfermedad, lo que avalara el trabajo en un diagnstico y atencin precoz desde las aulas que ayudara a la permanencia de estos alumnos en el sistema educativo.

Referencias bibliogrficas
ADDINGTON, J. & ADDINGTON, D. (2006). Early interventions for psychosis: Who refers?. Schizophrenia Research, 84, 176177. ADDINGTON, J. & ADDINGTON, D. (2008). Social and cognitive functioning in psychosis. Schizophrenia Research, 99, 176181. AMERICAN PSYCHIATRIC ASSOCIATION (APA, 2002). Manual Diagnstico y Estadstico de las Enfermedades Mentales: Texto Revisado (DSM IVTR) (edicin en espaol). Barcelona: Masson. ANDREASEN, N. C. (1979a). Thought, language, and communication disorders I. Clinical assessment, definition of terms, and evaluation of their reliability. Archives of General Psychiatry, 36, 13151321. ANDREASEN, N. C. (1979b). Thought, language, and communication disorders II: diagnostic significance. Archives of General Psychiatry, 36, 13251330. ANDREASEN, N. C. (1999a). Understanding the causes of schizophrenia. The New England Journal of Medicine, 340, 645647. ANDREASEN, N. C. (2000). Schizophrenia: the fundamental questions. Brain Research Reviews, 31, 106112. BELINCHON, M. (1987). Esquizofrenia y lenguaje. En J. M. RUIZ VARGAS, Esquizofrenia: un enfoque cognitivo. Madrid: Alianza: 232258.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

225

Carlos Salavera Bords

BLEULER, E. (1911). Dementia praecox; or the group of schizophrenias. New York, International Universities Press. Traduccin al castellano: Demencia precoz; el grupo de las esquizofrenias (1993). Buenos Aires: HormePaids. CHAIKA, E. (1974). A linguist looks at schizophrenic language. Brain & Language, 1, 257276. CRIDER, A. (1997). Perseveration in schizophrenia. Schizophrenia Bulletin, 23, 6374. CROW, T. J. (1980a). Molecular pathology of schizophrenia: more than one disease process?. British Medical Journal, 280, 6668. GONZLEZMONTALVO, J. I. (1991). Creacin y validacin de un test de lectura para el diagnstico del deterioro mental en el anciano. Tesis doctoral. Madrid: Universidad Complutense. KRAEPELIN, E. (1919). Dementia praecox and paraphenia. Edimburgo: E & S. Livingstone. Traduccin al castellano: La demencia precoz (2008). Buenos Aires: Polemos. LEROY, F. & BEAUNE, D. (2008). Langage et schizophrnie: lintention en question. Annales Mdico Psychologiques, 166 (8), 612619. MCKENNA, P. J. & OH, T. (2005). Schizophrenic speech: Making sense of bathroots and ponds that fall in doorway. London: Cambridge University Press. MORENO, B., JIMNEZ, J. F., GODOY, J. F., TORRES, F. & PREZ, L. (2002). Variables predictoras de los ingresos hospitalarios en pacientes con esquizofrenia. Actas Espaolas de Psiquiatra, 30, (5), 279286. PUYUELO, M., RENOM, J., SOLANAS, A. & WIIG, E. H. (2004). Evaluacin del lenguaje BLOC Screening Revisado. Carpeta con 5 elementos. Barcelona: ElsevierMasson. SALAVERA, C. (1999). Anlisis de patologas del lenguaje en la esquizofrenia: aspectos psicolgicos. Cuadernos de ICIJA, 6, 185192. SALAVERA, C. (2008). Por qu no entendemos a las personas con esquizofrenia?. Documentos de trabajo social: Revista de trabajo y accin social, 4344, 155164. TNYI, T., HEROLD, R., SZILI, I. M. & TRIXLER, M. (2002). Schizophrenics shows a failure in the decoding of violations of conversational implicatures. Psychopathology, 35, 2527. WECHSLER, D. (2000). WAIS III Escala de inteligencia para adultosIII. Madrid: TEA.

226 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 221-226

REFERENCIA: Allueva, Pedro; Herrero, M Luisa & Franco, Juan Agustn (2010). Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas. REIFOP, 13 (4). (Enlace web: http://www.aufop.com - Consultada en fecha (dd-mm-aa):)

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas


PedroALLUEVATORRES MaraLuisaHERRERONIVELA JuanAgustnFRANCOMARTNEZ
Correspondencia: PedroAlluevaTorres Correoelectrnico: pallueva@unizar.es Telfono:976761343 Fax:976761345 InstitutodeCC.delaEducacin UniversidaddeZaragoza C/PedroCerbuna,12 50.009Zaragoza MaraLuisaHerreroNivela Correoelectrnico: mherniv@unizar.es Telfono:976761000(3472) Fax:976762071 FacultaddeEducacin UniversidaddeZaragoza C/SanJuanBosco,7 50.009Zaragoza JuanAgustnFrancoMartnez Correoelectrnico: franco@unex.es Telfono:924289300Ext.86266 Fax:924286201 EscueladeIngenierasAgrarias UniversidaddeExtremadura CarreteradeCceres,s/n. 06071Badajoz Recibido:10deenerode2010 Aceptado:18deoctubrede2010

RESUMEN
En el estudio se tomaron datos del alumnado de 1 curso, egresado y profesorado de 1 curso de la Universidad de Zaragoza en el curso 20082009, con el fin de analizar los diferentes perfiles de estilos de pensamiento predominantes para poder determinar qu metodologas y sistemas de evaluacin en el proceso de enseanza aprendizajepuedenfavorecerelaprendizajeydesarrollode habilidadesyaptitudesdelpensamientoenelalumnado.Al realizar el anlisis de los datos por grupos, reas de conocimiento y sexo, se aprecian diferencias significativas en los perfiles de los estilos de pensamiento de los participantes. PALABRAS CLAVE: Estilo de pensamiento, Habilidad de pensamiento,Metodologa,Evaluacin.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1-18

227

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

University students and lecturers thinking styles. Educational implications


ABSTRACT
Tocarryoutthisstudywecompileddatafromgraduatesand1styearstudentsandlecturers fromtheUniversityofZaragozain20082009inordertoanalysethedifferentprofilesofthe predominant thinking styles. The aim of this study is to determine what methodologies and evaluationsystemsintheTeachingLearningprocesscanpromotethestudents'learningand their development of thinking skills and attitudes. When analysing the data and taking into account class groups, knowledge areas and gender, significant differences were found in the profilesoftheparticipantsthinkingstyles.

KEY WORDS: Thinkingstyle,Thinkingskills,Methodology,Evaluation.

1. Introduccin
Los resultados de aprendizaje y el xito acadmico del alumnado estn relacionados no slo con sus aptitudes, sino tambin con su estilo de pensamiento y la afinidad de dicho estilo de pensamiento con el mtodo de enseanzaevaluacin que se realiza en las distintas asignaturas de la carrera. Un estilo de pensamiento es una forma particular de utilizar las aptitudes que tiene la persona a la hora de pensar. Los distintos mtodos de enseanza y evaluacin favorecen ms al alumnado con determinado estilo de pensamiento. Saber el estilo de pensamiento predominante del alumnado, tanto al inicio como al final de sus estudios universitarios, ayudar a conocer mejor la forma de llegar a ellos con una metodologa y evaluacin determinadas. La utilizacin de ciertos mtodos de enseanzaevaluacin favorecer el desarrollo de determinados estilos de pensamiento en el alumnado, de forma que sean capaces de realizar tareas propias de distintos estilos de pensamiento que les sean tiles para su futuro desempeo personal y profesional. El estudio que presentamos forma parte de un Proyecto de la Convocatoria de Innovacin Docente de la Universidad de Zaragoza 20082009. Para conocer el estilo de pensamiento predominante del alumnado de 1 curso, alumnado egresado y profesorado de 1 curso de la Universidad de Zaragoza se pas, a una muestra de los tres grupos, el cuestionario de SternbergWagner (STERNBERG, 1999) de los estilos legislativo, ejecutivo y judicial. El trmino estilo de pensamiento ha sido utilizado por distintos autores con diferentes significados. Para Herrmann (1995):

El estilo de pensamiento es la manera particular de cada individuo de percibir al mundo, pensar, crear y aprender. Segn l, hay una ntima relacin entre la dominancia cerebral y las preferencias de estilo de pensamiento, lo que impacta aquello en que ponemos atencin y el cmo y el qu aprendemos mejor. Cada uno de los cuatro cuadrantes o centros cerebrales, en el modelo del cerebro total de Herrmann, est asociado con diferentes funciones especializadas de pensamiento o con diferentes estilos de pensamiento. (ROJAS, SALAS & JIMNEZ, 2006: 55).
La siguiente definicin que nos ofrece Sternberg (1999: 38) es la que compartimos en el presente estudio:

Un estilo es una manera caracterstica de pensar. No se refiere a una aptitud, sino a cmo utilizamos las aptitudes que tenemos. No tenemos un estilo, sino un perfil de estilos. Las personas pueden ser prcticamente idnticas en cuanto a sus aptitudes y aun as tener estilos muy distintos.

228 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

Otro significado de estilo de pensamiento es el que nos dan GonzlezPienda et al. (2004). En su estudio, presentan una estructura de estilos de pensamiento sustancialmente distinta a la ofrecida por Sternberg. Apoyan una estructura factorial de segundo orden de tres factores: legislativo/judicialliberal, ejecutivoconservador y oligrquicoexterno. Diferentes estudios realizados en los distintos niveles educativos apoyan la importancia que tiene conocer el estilo de pensamiento del alumnado para poder adecuar las enseanzas a los estilos de pensamiento, buscando un mayor rendimiento en el proceso de enseanza aprendizaje. Gonzlez et al. (2000) estudiaron la posible relacin existente entre los estilos de pensamiento del profesorado, el alumnado de secundaria y el rendimiento acadmico sin encontrar resultados concluyentes, llegando a la determinacin de que deben realizarse ms estudios en este campo. Otra conclusin de este estudio fue que el tipo de estilo intelectual

participa notablemente en la definicin de una orientacin a meta, lo cual es necesario para definir qu tipo de estrategia se seguir a la hora de trabajar con estrategias escolares. (Gonzlez et al. 2000: 221). Por tanto, destacan la importancia que tiene conocer el estilo
intelectual del alumnado para poder trabajar con determinadas estrategias de aprendizaje. Por su parte, Zhang & Sternberg (2002) validaron la teora del autogobierno de Sternberg en una muestra de profesorado de primaria y secundaria de Hong Kong, demostrando la validez y confiabilidad del inventario para evaluar los estilos de pensamiento. En el nivel universitario, Mogolln (2007) realiz un estudio comparativo entre los estilos de pensamiento del alumnado de la Universidad Pblica de Navarra y de la Universidad de Pamplona de Colombia, en el que encontraron importantes resultados en cuanto a la correlacin entre la carrera y el estilo de pensamiento, no encontrando diferencias significativas entre los estilos de pensamiento del alumnado de los dos pases. En la misma lnea, Gonzlez, Castro & Gonzlez (2008) identificaron la correspondencia entre estilos de pensamiento y grupos de carreras. As, el grupo de ciencias exactas mostr un perfil ms legislativo, el grupo de ingeniera un perfil ms ejecutivo, el grupo de ciencias sociales se caracterizaba por un perfil entre legislativo y judicial, y el grupo de psicologa presentaba un perfil ms ejecutivo. El presente estudio se encuentra en la lnea de los dos ltimos estudios comentados. El objetivo general es realizar un anlisis comparativo del perfil de estilos de pensamiento que

tiene el alumnado que ingresa en la Universidad de Zaragoza y el egresado de la misma, as como del profesorado de 1 de carrera, con la finalidad de poder determinar qu mtodos de enseanzaevaluacin pueden favorecer un mejor aprendizaje y desarrollo cognitivo del alumnado. Por tanto, con este estudio se persigue conocer para poder actuar. Conocer qu
perfil de estilos de pensamiento predominante tiene el alumnado al iniciar sus estudios en la Universidad. En la medida que se conozca mejor el estilo de pensamiento del alumnado se pueden disear metodologas de enseanzaevaluacin ms acordes con sus estilos de pensamiento y con los que se consideren ms adecuados para su desarrollo personal y profesional. Conocer el estilo de pensamiento del profesorado que les imparte las clases es relevante dado que cuando los estilos de pensamiento del profesorado y del alumnado coinciden el proceso de enseanzaaprendizaje se ve facilitado. Por otra parte, el conocimiento del perfil de estilos de pensamiento del alumnado egresado es de gran utilidad para poder analizar la evolucin de dichos estilos de pensamiento en las distintas titulaciones y reas de conocimiento, as como para conocer si los estilos de pensamiento predominantes del alumnado egresado son los ms adecuados profesionalmente. El estudio se ha basado en la teora del autogobierno mental de Sternberg (1999), ms concretamente en los estilos de pensamiento Legislativo, Ejecutivo y Judicial: A las personas legislativas les gusta hacer las cosas a su aire y prefieren decidir por s mismas qu harn y cmo lo harn. A las personas legislativas les gusta establecer sus propias reglas y prefieren los problemas que no estn estructurados o planteados de antemano. A las personas ejecutivas les gusta seguir reglas y prefieren los problemas

estructurados y planteados de antemano. Les gusta rellenar las lagunas de estructuras ya existentes en vez de crear estructuras ellas mismas.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1-18

229

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

A las personas judiciales les gusta evaluar reglas y procedimientos, y prefieren problemas donde se analicen y evalen cosas e ideas ya existentes. (STERNBERG, 1999: 49). Las puntuaciones de los estilos de pensamiento obtenidas de las muestras de los tres grupos se analizaron segn sexo (mujeres y varones) y 8 reas de conocimiento (1. Ciencias, 2. Econmicas y Empresariales, 3. EducacinPsicologa, 4. Estudios SocialesDerecho, 5. Filosofa y Letras, 6. Ingeniera, 7. SaludDeporte y 8. Veterinaria).

2. Metodologa
Del estudio formaron parte un total de 3.630 participantes, 2.211 mujeres y 1.419 varones. De los 2.766 estudiantes de 1 curso 1.682 fueron alumnas y 1.084 alumnos. De los 609 estudiantes egresados el nmero de alumnas fue de 414 y el de alumnos de 195. De los 255 participantes de la muestra del profesorado 115 fueron profesoras y 140 profesores. La recogida de datos se realiz mediante el Cuestionario de SternbergWagner (STERNBERG, 1999) para los estilos de pensamiento Legislativo, Ejecutivo y Judicial. El mtodo utilizado en la recogida de datos fue el de Encuesta Transversal, pasando el cuestionario a tres muestras de poblaciones distintas en el mismo momento: a) alumnado de 1 curso; b) alumnado egresado; c) profesorado de 1 curso.

3. Resultados
Para realizar el anlisis comparativo del perfil de estilos de pensamiento se ha tenido en cuenta el % correspondiente a la puntuacin obtenida en los estilos de pensamiento (A Legislativo; B Ejecutivo; C Judicial) en funcin de la muestra de cada grupo, de forma que puedan compararse los % de las puntuaciones obtenidas aun siendo muestras diferentes. Bien es cierto que, dependiendo del nmero de la muestra, el anlisis de los datos y las conclusiones que de ellos se desprendan debern interpretarse y generalizarse con la debida cautela. El total de alumnado de 1 curso, incluidos los centros adscritos, matriculados en el curso 20082009 en la Universidad de Zaragoza es de 6.586; por tanto, el nmero de la muestra del alumnado de 1 curso (2.766) se encuentra dentro del margen de confianza del 95,5% a un error muestral del 2%.

VALORES TOTALES EN % DEL ESTILO DE PENSAMIENTO DEL ALUMNADO DE 1, EGRESADO Y PROFESORADO DE 1 50 45 40 35 30 25 20 15 10 5 0 1 A 2 B 3 C 4 AyB 5 AyC 6 By C 7 A, B y C

Al 1 Egre Prof

GRFICO 1. Valores totales en % del estilo de pensamiento del alumnado de 1 curso, alumnado egresado y profesorado de 1 curso Curso 200809.

230 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

VALORES TOTALES EN % DEL ESTILO DE PENSAMIENTO SEGN SEXO DEL ALUMNADO DE 1, EGRESADO Y PROFESORADO DE 1 50 45 40 35 30 25 20 15 10 5 0 1 A 2 B 3 C 4 AyB 5 AyC 6 ByC 7 A, B y C Al 1-M Al 1-V Egre-M Egre-V Prof-M Prof-V

Grfico 2. Valores totales en % del estilo de pensamiento del alumnado de 1 curso, alumnado egresado y profesorado de 1 curso, segn sexo Curso 200809.

Al analizar los datos de la Tabla 1, comprobamos como el perfil medio de los estilos de pensamiento predominantes en el alumnado de 1 curso, egresado y profesorado de 1 curso es similar. El orden de las puntuaciones obtenidas por los tres grupos en los distintos estilos es el siguiente: 1. Estilo Legislativo, 2. Estilo Ejecutivo y 3. Estilo Judicial (Grfico 1). Separadas las puntuaciones de los grupos por sexo (Grfico 2) se mantiene el orden predominante de los estilos de pensamiento. No obstante, dependiendo del grupo y de las reas de conocimiento se dan perfiles de estilos de pensamiento diferentes (Tablas 2, 3 y 4). Las puntuaciones en A y B, A y C, B y C y A, B y C quieren decir que esos participantes han obtenido la mxima puntuacin en los dos o tres estilos de pensamiento correspondientes (ALegislativo, BEjecutivo y CJudicial). Lo ms destacable de estos datos es la puntuacin obtenida por los profesores en A y B con un 7,14% y por las profesoras en A y C con un 6,09%. Por otra parte, si hiciramos un reparto proporcional de estas puntuaciones, sumando la puntuacin correspondiente al estilo legislativo (A), ejecutivo (B) y judicial (C), no obtendramos cambios muy significativos en los resultados. Por ejemplo, si hacemos el reparto proporcional de las puntuaciones (A y B, A y C y A, B, y C) obtenidas por el alumnado de 1 curso (Tabla 1) entre los estilos A, B y C sumando las puntuaciones correspondientes, los valores del estilo legislativo (A) sern los siguientes: total 49,75%, mujeres 47,44% y varones 53,32%, mantenindose una diferencia del 5,88% de mayor puntuacin de los alumnos sobre las alumnas en el estilo legislativo, siendo un poco inferior a la que se desprende de la Tabla 1 que es de un 6,30%.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1-18

231

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

ALUMNADO DE 1 CURSO ESTILO DE PENSAMIENTO A (Legislativo) B (Ejecutivo) C (Judicial) AyB AyC ByC A, B y C Muestra Total % Total de la Muestra MUESTRA y %
1.277 986 264 130 62 39 8 46,17 35,65 9,54 4,70 2,24 1,41 0,29

ALUMNADO EGRESADO MUESTRA y %


286 189 92 18 17 7 0 46,96 31,03 15,11 2,96 2,79 1,15 0

PROFESORADO DE 1 CURSO MUESTRA y %


103 77 46 16 10 2 1 40,39 30,20 18,04 6,27 3,92 0,78 0,39

MUJERES y %
735 644 157 86 38 19 3 43,70 38,29 9,33 5,11 2,26 1,13 0,18

VARONES y %
542 342 107 44 24 20 5 50,00 31,55 9,87 4,06 2,21 1,85 0,46

MUJERES y %
196 135 58 10 12 3 0 47,34 32,61 14,01 2,42 2,90 0,72 0

VARONES y %
90 54 34 8 5 4 0 46,15 27,69 17,44 4,10 2,56 2,05 0

MUJERES y %
45 38 17 6 7 2 0 39,13 33,04 14,78 5,22 6,09 1,74 0

VARONES y %
58 39 29 10 3 0 1 41,43 27,86 20,71 7,14 2,14 0 0,71

2.766 100

100

1.682 60,81

100

1.084 39,19

100

609 100

100

414 67,98

100

195 32,02

100

255 100

100

115 45,10

100

140 54,90

100

TABLA 1. Alumnado de 1 curso, alumnado egresado y profesorado de 1 curso segn sexo y estilo de pensamiento predominante Curso 200809.

232 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

ESTILO DE PENSAMIENTO (A Legislativo; B Ejecutivo; C Judicial) REA DE CONOCIMIENTO 1. Ciencias 2. Econ. y Empresariales 3. EducacinPsicologa 4. E. SocialesDerecho 5. Filosofa y Letras 6. Ingeniera 7. SaludDeporte 8. Veterinaria TOTAL Total 99 521 367 343 343 470 475 148 2.766 A 51 181 188 167 163 225 221 81 1.277 % 51,52 34,74 51,23 48,69 47,52 47,87 46,53 54,73 46,17 B 29 239 115 117 98 173 176 39 986 % 29,29 45,87 31.34 34,11 28,57 36,81 37,05 26,35 35,65 C 11 47 24 35 50 36 47 14 264 % 11,11 9,02 6,54 10,20 14,58 7,66 9,89 9,46 9,54 AyB 4 33 29 11 12 19 17 5 130 % 4,04 6,33 7,90 3,21 3,50 4,04 3,58 3,38 4,70 AyC 0 12 7 9 13 7 7 7 62 % 0 2,30 1,91 2,62 3,79 1,49 1,47 4,73 2,24 ByC 4 8 3 4 5 9 5 1 39 % 4,04 1,54 0,82 1,17 1,46 1,91 1,05 0,68 1,41 A, B y C 0 1 1 0 2 1 2 1 8 % 0 0,19 0,27 0 0,58 0,21 0,42 0,68 0,29

TABLA 2. Alumnado de 1 curso segn rea de conocimiento y estilo de pensamiento predominante Curso 200809.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

233

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

ESTILO DE PENSAMIENTO (A Legislativo; B Ejecutivo; C Judicial) REA DE CONOCIMIENTO 1. Ciencias 2. Econ. y Empresariales 3. EducacinPsicologa 4. E. SocialesDerecho 5. Filosofa y Letras 6. Ingeniera 7. SaludDeporte 8. Veterinaria TOTAL Total 104 131 18 75 128 53 66 34 609 A 53 58 9 38 62 25 29 12 286 % 50,96 44,27 50 50,67 48,44 47,17 43,94 35,29 46,96 B 27 49 3 26 34 13 25 12 189 % 25,96 37,4 16,67 34,67 26,56 24,53 37,88 35,29 31,03 C 15 17 4 7 24 10 7 8 92 % 14,42 12,98 22,22 9,33 18,75 18,87 10,61 23,53 15,11 AyB 4 3 1 1 3 2 3 1 18 % 3,85 2,29 5,56 1,33 2,34 3,77 4,55 2,94 2,96 AyC 2 3 1 2 5 2 1 1 17 % 1,92 2,29 5,56 2,66 3,90 3,77 1,52 2,94 2,79 ByC 3 1 0 1 0 1 1 0 7 % 2,88 0,76 0 1,33 0 1,89 1,52 0 1,15 A, B y C 0 0 0 0 0 0 0 0 0 % 0 0 0 0 0 0 0 0 0

TABLA 3. Alumnado egresado segn rea de conocimiento y estilo de pensamiento predominante Curso 200809.

234 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

ESTILO DE PENSAMIENTO (A Legislativo; B Ejecutivo; C Judicial) REA DE CONOCIMIENTO 1. Ciencias 2. Econ. y Empresariales 3. EducacinPsicologa 4. E. SocialesDerecho 5. Filosofa y Letras 6. Ingeniera 7. SaludDeporte 8. Veterinaria TOTAL Total 14 38 31 5 31 91 13 32 255 9 10 16 3 12 33 3 17 103 A % 64,29 26,32 51,61 60 38,71 36,26 23,08 53,13 40,39 4 14 5 1 5 37 6 5 77 B % 28,57 36,84 16,13 20 16,13 40,66 46,15 15,63 30,20 1 7 9 1 8 14 2 4 46 C % 7,14 18,42 29,03 20 25,81 15,38 15,38 12,5 18,04 AyB 0 1 1 0 2 7 2 3 16 % 0 2,63 3,23 0 6,45 7,69 15,38 9,38 6,27 AyC 0 5 0 0 3 0 0 2 10 % 0 13,16 0 0 9,68 0 0 6,25 3.92 ByC 0 0 0 0 1 0 0 1 2 % 0 0 0 0 3,23 0 0 3,13 0,78 A, B y C 0 1 0 0 0 0 0 0 1 % 0 2,63 0 0 0 0 0 0 0,39

TABLA 4. Profesorado de 1 curso segn rea de conocimiento y estilo de pensamiento predominante Curso 200809.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

235

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

Los resultados ms destacables son los siguientes: Tanto mujeres como varones de los tres grupos obtienen la puntuacin ms alta en el estilo legislativo. Son los alumnos de 1 curso los que obtienen los valores ms altos y las profesoras los ms bajos. Las mujeres puntan ms alto que los varones en el estilo ejecutivo en los tres grupos, siendo las alumnas de 1 curso las que ms alto puntan y los alumnos egresados los que menos. Los varones puntan ms alto en el estilo judicial en los tres grupos, siendo los profesores los que puntan ms alto y las alumnas de 1 curso las que puntan ms bajo. Con el 64,29% en el estilo legislativo, el profesorado del rea de Ciencias es el que obtiene la puntuacin ms alta de los tres estilos y de los tres grupos en las ocho reas. En el rea de Econmicas y Empresariales el profesorado y alumnado de 1 curso obtienen puntuaciones ms altas en el estilo ejecutivo, y el alumnado egresado en el legislativo. El profesorado del rea de EducacinPsicologa es el que obtiene la mayor puntuacin de los tres grupos en el estilo judicial con el 29,03%, superando a la puntuacin del estilo ejecutivo en un 12,9%. El alumnado egresado tambin punta ms alto en el estilo judicial que en el ejecutivo. En el rea de Estudios SocialesDerecho, el profesorado obtiene la misma puntuacin (20%) en los estilos judicial y ejecutivo, mientras que el alumnado de 1 curso y egresado mantienen valores similares en el orden de perfil de estilos de pensamiento legislativo, ejecutivo y judicial. En el rea de Filosofa y Letras, el estilo de pensamiento predominante en los tres grupos es el legislativo, el menor valor lo obtiene el profesorado. En el alumnado de 1 curso y egresado el estilo ejecutivo es el que obtiene la segunda puntuacin ms alta; sin embargo, en el profesorado la segunda puntuacin ms alta la obtiene el estilo judicial. En el rea de Ingeniera, el estilo de mayor puntuacin tanto en el alumnado de 1 curso como en el egresado es el legislativo; sin embargo, en el profesorado la mayor puntuacin la obtiene el estilo ejecutivo. Es destacable la diferencia de las puntuaciones del estilo judicial entre el alumnado de 1 curso (7,66%) y el egresado (18,87%). El profesorado del rea de SaludDeporte es el que ms alta puntuacin obtiene en el estilo ejecutivo de los tres grupos, con un 46,15%. Tanto el alumnado de 1 curso como el egresado obtienen un perfil de estilos de pensamiento legislativo, ejecutivo y judicial con puntuaciones similares los tres grupos. En el rea de Veterinaria, alumnado y profesorado de 1 curso destacan en el estilo legislativo seguido del ejecutivo; el profesorado punta algo ms en el judicial en detrimento del ejecutivo. El alumnado egresado de Veterinaria es el que tiene los valores de los tres estilos ms similares. Tienen la misma puntuacin (35,29%) en los estilos legislativo y ejecutivo, y un 23,53% en el judicial.

4. Discusin
La discusin de los resultados la presentamos dividida en tres apartados: A. Interpretacin de los resultados; B. Implicaciones educativas; C. Conclusiones. A. INTERPRETACIN DE LOS RESULTADOS En los datos hemos podido constatar cmo, a nivel general, el perfil de estilos de pensamiento predominante en los tres grupos, alumnado de 1 curso, alumnado egresado y profesorado de 1 curso de la Universidad de Zaragoza, en el curso 20082009, es similar, obteniendo una mayor puntuacin en el estilo legislativo, seguido del estilo ejecutivo y finalmente del estilo judicial, aunque dependiendo de grupo y/o rea de conocimiento los perfiles de estilos de pensamiento varan.

236 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

Queremos destacar cuatro afirmaciones que se desprenden de los datos analizados y que nos parecen especialmente relevantes: Comparando los estilos de pensamiento predominantes del alumnado de 1 curso y del alumnado egresado observamos que dicho perfil de estilos cambia o puede cambiar durante el periodo de realizacin de los estudios universitarios. Las diferencias en los perfiles de los estilos de pensamiento predominante entre el alumnado de 1 curso y el alumnado egresado de algunas reas de conocimiento pueden ser debidas, entre otros factores, a la metodologa utilizada por el profesorado, a los contenidos de la titulacin, diferentes variables del profesorado, la maduracin, etc. Comparando el perfil de estilos de pensamiento del alumnado de 1 curso, el alumnado egresado y profesorado, observamos que no hay un cambio de perfil en los estilos de pensamiento del alumnado egresado que haga pensar que el alumnado tienda a tener un perfil de estilos de pensamiento similar al del profesorado. Ni los estudios realizados por parte del alumnado en la Universidad de Zaragoza, ni el estilo de pensamiento del profesorado son determinantes para los cambios de perfil de estilos del alumnado, aunque s que influyen en algunos casos y, especialmente, en algunas reas de conocimiento.

Del anlisis de los datos obtenidos en el estudio y de las afirmaciones realizadas anteriormente se desprenden una serie de interrogantes que, sin ser objeto de este estudio, estimamos conveniente plantear como posibles lneas de investigacin futuras que ayuden a profundizar en el conocimiento de este tema. Los varones conforme adquieren ms formacin y/o edad disminuyen en el estilo legislativo? Los valores ms altos en el estilo ejecutivo de las mujeres, comparativamente con los varones, pueden ser debidos a un componente gentico, ambiental, a ambos, a ninguno de los dos? El estilo judicial se ve incrementado con la formacin y/o la edad? Depende del tipo de formacin, aumentando en el profesorado? El mayor incremento en los varones es debido a un componente gentico, ambiental, a ambos, a ninguno de los dos? Hay reas de conocimiento en las que se desarrolla especialmente un estilo de pensamiento determinado, por ejemplo, el estilo de pensamiento legislativo en el rea de conocimiento de Econmicas y Empresariales, o el estilo de pensamiento judicial en las reas de conocimiento de Ingeniera, EducacinPsicologa y Veterinaria? Existe correlacin entre el estilo de pensamiento predominante y la eleccin de estudios? Existe correlacin entre el estilo de pensamiento predominante y la eleccin de estudios dependiendo del sexo? Cuando se constata un cambio de perfil de estilos de pensamiento entre el alumnado de 1 curso y el alumnado egresado de una misma titulacin, a qu variables es debido (contenido de las materias, metodologa utilizada por el profesorado, estilo de pensamiento del profesorado, maduracin)? Los resultados de este estudio realizado en la Universidad de Zaragoza pueden ser generalizables al resto de universidades espaolas?

B. IMPLICACIONES EDUCATIVAS Independientemente del perfil de estilos de pensamiento predominante de cada grupo y/o rea de conocimiento, en todo grupo de clase hay alumnado con distintos perfiles de estilos de pensamiento, a todos ellos se debe ser capaz de transmitir los conocimientos necesarios, como tambin ensear a utilizar los estilos de pensamiento ms convenientes en las distintas materias y tareas que deban desempear tanto a nivel personal como profesional. No hay estilos de pensamiento buenos o malos, lo que hay son estilos de pensamiento ms adecuados a las distintas tareas que haya que realizar. El perfil de estilos de pensamiento puede variar a lo largo de la vida, por tanto se puede educar, se puede (se debe) ensear a utilizar distintos estilos de pensamiento en funcin de las tareas y situaciones. El

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1-18

237

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

contenido de las titulaciones y, muy especialmente, el profesorado y la metodologa utilizada pueden ser decisivos en los estilos de pensamiento predominantes del alumnado al finalizar sus estudios. En cada rea de conocimiento, titulacin, asignatura o incluso en cada materia concreta puede ser ms conveniente la utilizacin de las aptitudes y habilidades del pensamiento desde un estilo de pensamiento determinado. Es importante desde cada rea de conocimiento, y ms especficamente desde cada asignatura, identificar qu perfil de estilos de pensamiento es el ms adecuado para desenvolverse bien en dichas materias y, partiendo del perfil de estilos de pensamiento que tiene el alumnado, ensear a utilizar el pensamiento de distintas formas y desde diferentes estilos de pensamiento, a pesar de que tengan preferencia por alguno de ellos. Estamos de acuerdo con Kaufman & Grigorenko (2009) cuando dicen que hay personas que puede gustarles pensar de una determinada manera, pero no piensan as, y tambin puede suceder lo contrario. Lo importante es saber pensar, utilizando el pensamiento de la forma ms eficiente segn la tarea que se tenga que realizar. Saber combinar el estilo de pensamiento con las aptitudes del pensamiento dar una mayor optimizacin de las potencialidades de la persona desarrollando habilidades del pensamiento. De acuerdo con Vygotski (1996: 138) el buen aprendizaje es slo aquel que precede al desarrollo. Por tanto, no slo debemos procurar el aprendizaje de nuevos conocimientos sino que, igualmente, debemos procurar el desarrollo de habilidades y aptitudes del pensamiento que les sean tiles a nivel personal y profesional. Coincidimos con Esquivias y Gonzlez (2005: 23) en que Los retos

actuales en materia educativa, se pueden agrupar en diversos rubros, uno de ellos es precisamente la educacin de las habilidades del pensamiento.
Es conveniente tanto en el proceso de enseanzaaprendizaje como en la evaluacin de los conocimientos hacerlo desde la variedad de estilos de pensamiento, teniendo en cuenta que los estilos pueden variar en funcin de los contextos y de las tareas que haya que realizar. Los estilos de pensamiento no se dan en las personas de forma constante en todas las actividades que desarrollan en su vida. Aunque predomine un estilo de pensamiento sobre otros, debido a las situaciones o tareas a desempear en los diferentes contextos, se pueden desempear estilos de pensamiento distintos. El estilo de pensamiento ms adecuado ser el que resulte ms eficaz en la resolucin de una tarea y contexto determinado. (ALLUEVA, 2007: 137). La forma de trabajar del alumnado ante una materia depende fundamentalmente del planteamiento general de la asignatura, de la metodologa especfica utilizada durante el curso y muy especialmente del mtodo de evaluacin. Dependiendo del estilo de pensamiento predominante del alumnado, el rendimiento ser mayor con determinadas metodologas y sistemas de evaluacin. Tanto el estilo de pensamiento del alumnado como el del profesorado deben ser flexibles, de forma que sean capaces de adaptarse a distintos tipos de procesos de enseanzaaprendizaje. Si el alumnado es capaz de adaptarse a las enseanzas desde distintos estilos de pensamiento lograr un mayor y mejor aprovechamiento de las enseanzas del profesorado en general. Por su parte, si el profesorado es capaz de adaptarse en sus enseanzas y evaluaciones a los diferentes estilos de pensamiento lograr llegar a un mayor nmero de alumnado. Para que el profesorado disee metodologas de enseanzaevaluacin adaptadas a los distintos estilos de pensamiento, debe conocer el perfil de estilos de pensamiento del alumnado, y qu metodologa de enseanzaaprendizaje y de evaluacin se les da mejor a las personas en funcin de su estilo de pensamiento predominante. Algunas caractersticas generales de las personas segn su estilo de pensamiento predominante relacionadas con el proceso de enseanzaaprendizaje, son las siguientes: A las personas con un estilo de pensamiento legislativo les gusta, y se les suele dar bien, hacer preguntas y buscar respuestas a esas y otras cuestiones, realizar tareas relacionadas con la creatividad como invenciones, creaciones literarias, creaciones de negocios, diseo de proyectos, etc. El estilo de pensamiento ejecutivo es el de personas que se les da bien resolver los problemas del tipo de tests de inteligencia, pruebas, exmenes. Se desenvuelven bien en pruebas analticas o que requieren de la ejecucin de unos mtodos ya establecidos, como problemas matemticos planteados, aplicar reglas a problemas, hacer cumplir normas, dar conferencias o clases de teoras o material ya elaborado por otras personas, etc.

238 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

Estilo de pensamiento del alumnado y profesorado universitario. Implicaciones educativas

Cuando las tareas a desarrollar tienen relacin con el anlisis, evaluaciones, contrastes, comparaciones o realizacin de juicios, como dar opinin a diferentes cuestiones, emitir juicios de personas o laborales, evaluar actividades, etc., se favorece un estilo de pensamiento judicial.

Algunas caractersticas generales de las personas segn su estilo de pensamiento predominante relacionadas con los mtodos de evaluacin, son las siguientes: Se favorece el estilo legislativo cuando la tarea de evaluacin requiere imaginacin y creatividad, como por ejemplo el desarrollo de proyectos. Se desenvuelven peor en el formato tipo examen. Se favorece el estilo judicial cuando hay que enjuiciar, analizar, evaluar, comparar o contrastar, como por ejemplo el formato tipo examen. El estilo ejecutivo se ve favorecido cuando se tiene que responder a cuestiones como qu? quin? cmo? cundo? dnde?, o tareas que requieren una descripcin o resumen. Tambin suele favorecerle la realizacin de pruebas objetivas.

La pregunta que nos podemos plantear ahora es la siguiente: qu metodologa de enseanza evaluacin es ms conveniente utilizar en cada rea de conocimiento, titulacin, materia, etc.? No se debe trabajar en ningn rea de conocimiento desde un nico perfil de estilos de pensamiento, fundamentalmente por dos razones: en primer lugar, si queremos llegar a un mayor nmero de alumnado ser conveniente combinar metodologas y sistemas de evaluacin que favorezcan a los diferentes perfiles de estilos de pensamiento. En segundo lugar, el profesorado, como especialista de la materia que imparte, debe conocer qu estilos de pensamiento pueden ser los ms favorables para desenvolverse eficientemente en esa materia. A partir de este conocimiento aplicar las metodologas de enseanzaevaluacin que mejor se adapten al alumnado y a la materia, guiando y orientando al alumnado para que utilice sus aptitudes del pensamiento desde los diferentes estilos que favorezcan el mejor desempeo de las tareas que tengan que realizar. C. CONCLUSIONES Los resultados obtenidos nos muestran los perfiles de estilos de pensamiento predominante del alumnado de 1 curso, alumnado egresado y profesorado de 1 curso de la Universidad de Zaragoza en el curso 20082009. A partir de los datos mostrados en las tablas y grficos, y del anlisis e interpretacin realizada, el profesorado de un rea determinada puede efectuar un anlisis e interpretacin ms minucioso de los datos por grupo y rea de conocimiento que ayude a conocer mejor los perfiles de los estilos de pensamiento del alumnado de esa rea de conocimiento. A modo de conclusin final y como resumen del anlisis realizado en el estudio, queremos destacar tres ideas para su posible aplicacin educativa: 1. El estilo de pensamiento del alumnado y del profesorado debe ser flexible, de forma que sean capaces de adaptarse a distintas metodologas y sistemas de evaluacin en el proceso de enseanzaaprendizaje. El profesorado, desde una metodologa y sistema de evaluacin adecuados puede llegar ms fcilmente al alumnado con estilos de pensamiento diferentes, potenciando as sus aptitudes y habilidades del pensamiento. El profesorado debe guiar y orientar al alumnado en la utilizacin de los diferentes estilos de pensamiento, especialmente en los que considere ms idneos para el desempeo eficiente de la materia y para su desarrollo cognitivo.

2.

3.

Referencias bibliogrficas
ALLUEVA, P. (2007). Habilidades del Pensamiento. En LIESA, M., ALLUEVA, P. & PUYUELO, M. (Coords.) Educacin y acceso a la vida adulta de Personas con Discapacidad. Barbastro, Huesca: Fundacin Ramn J. Sender, 133158. ESQUIVIAS, M. T. & GONZLEZ, A. (2005). El docente como estudiante: pensamiento, actitudes y rendimiento acadmico. REIFOP, 20, Vol. 8 (5), 2332. Consultado el 3 de diciembre de 2009, de http://www.aufop.com/aufop/uploaded_files/articulos/1247165107.pdf.

ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 1-18

239

Pedro Allueva, M Luisa Herrero & Juan Agustn Franco

GONZLEZ, J. A. (Director) (2000). Estilos de pensamiento, evaluacin del aprendizaje y rendimiento acadmico en la ESO. Memoria del Proyecto de Investigacin financiado por el Centro de Investigacin y Documentacin Educativa. GONZLEZ, G., CASTRO, A. & GONZLEZ, F. (2008). Perfiles aptitudinales, estilos de pensamiento y rendimiento acadmico. Anuario de investigaciones, volumen XV, 3341. Buenos Aires: Universidad de Buenos Aires. GONZLEZPIENDA, J. A. ET AL. (2004). Estilos de pensamiento: anlisis de su validez estructural a travs de las respuestas de adolescentes al Thinking Styles Inventory. Psicothema 2004. Vol. 16, n 1, 139148. HERRMANN, N. (1995). The Creative Brain. Lake Lure N.C.: The Ned Herrmann Group. En ROJAS, G., SALAS, R. & JIMNEZ, C. (2006). Estilos de aprendizaje y estilos de pensamiento entre estudiantes universitarios. Estudios Pedaggicos XXXII, N1, 4975. Temuco (Chile): Universidad Mayor. KAUFMAN, J. C. & GRIGORENKO, E. L. (Eds) (2009). The essential Sternberg: essays on intelligence, psychology, and education. New York: Springer. MOGOLLN, O. M. (2007). Estilos de pensamiento de los estudiantes de la Universidad Pblica de Navarra y de la Universidad de Pamplona, Colombia. Tesis doctoral no publicada. En depsito en la biblioteca de la Universidad Pblica de Navarra. STERNBERG, R. J. (1999). Estilos de pensamiento. Claves para identificar nuestro modo de pensar y enriquecer nuestra capacidad de reflexin. Barcelona: Paids. VYGOTSKI, L. S. (1996). El desarrollo de los procesos psicolgicos superiores. Barcelona: Crtica. ZHANG, L. & STERNBERG, R. J. (2002). Thinking styles and teachers' characteristics. International Journal of Psychology, Volume, 37, 312. Psychology Press. COLABORADORES EN LA RECOGIDA Y TRASCRIPCIN DE LOS DATOS Pilar Abs Olivares, Jess Astigarraga Goenaga, Blanca Bauluz Lzaro, Ana Cristina Blasco Serrano, M Dolores Cepero Ascaso, Marta Faj Pascual, Cristina Fernndez Fernndez, Daniel Hbner, Marta Liesa Ors, Teresa Lorenzo Burillo, Rosa Lors Sanz, Pilar Martn Hernndez, Jos Emilio Mesonero Gutirrez, Miguel Miranda Aranda, M Antonia Nern Rotger, Begoa Pea Pellicer, Inmaculada Plaza Garca, Jess Sallan Arasanz, Pedro Snchez Sellero, Reyes Torres Snchez y Javier Usoz Otal.

240 ISSN 1575-0965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 227-240

REFERENCIA: Heredia Manrique, Alfonso (2010). Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza
AlfonsoHEREDIAMANRIQUE
Correspondencia: AlfonsoHerediaManrique Correoelectrnico: aheredia@unizar.es Telfono: 976761000(3998) Direccinpostal: Dpto.CienciasdelaEducacin FacultaddeEducacin UniversidaddeZaragoza C/SanJuanBosco,7 50.009Zaragoza (Espaa) Recibido7deoctubrede2009 Aceptado18deoctubrede2010

RESUMEN
Este artculo trata sobre el rendimiento acadmico del alumnadodelaFacultaddeEducacindelaUniversidadde Zaragoza. Es un estudio cuantitativo de seguimiento sobre ocho promociones de sus titulados y no titulados en tres niveles sucesivos de anlisis; el primero de carcter global, el segundo comparativo entre seis especialidades de Maestro y el tercero segn la va de entrada y en cada especialidad. Tambin complementariamente se observan las tendencias que se producen en las promociones estudiadasendichosnivelesdeanlisisparaajustarmejorla cuestininvestigada.Alfinalseconstataclaramenteloque se intua y tema, a saber: que existe un problema importanteydedeterioroalarmantedelrendimientodelos alumnosdeestaFacultad.

PALABRAS CLAVE: Educacin Superior, Formacin del Profesorado, Rendimiento Acadmico.

An analysis of academic achievement among Teacher Education students at the Faculty of Education of the Universidad de Zaragoza (Spain)
ABSTRACT
ThisarticlefocusesonthestudentsschoolachievementattheUniversidaddeZaragoza,inSpain.Itisa quantitativestudytrackinggraduateandnongraduatestudentsineightacademicyears,followingthree levelsofanalysis:(1)anoverallanalysis,(2)acomparativeanalysisacrosssixspecialities,(3)ananalysis basedonthewayofenteringthedegreeineachspeciality.Tendenciesinthethreeanalyticallevelsare alsoobservedforabetteradjustmenttothefocusofanalysis.Resultsclearlyshowwhatwasexpected and feared, namely, that there is a serious problem in the lowering of the students academic achievementatthisFaculty.

KEY WORDS: HigherEducation,TeacherEducation,AcademicAchievement.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

241

Alfonso Heredia Manrique

El objetivo que pretende esta investigacin es proporcionar informacin concreta y objetiva sobre el rendimiento acadmico de los alumnos de la carrera de Maestro de la Facultad de Educacin de la Universidad de Zaragoza, entendido ste como titulados y no titulados o abandono de los estudios. Este propsito vena a ser coincidente con la preocupacin de las autoridades acadmicas que aludan a este problema. As, en el documento Extracto del Programa Electoral (marzo, 2004) del candidato a Rector de la Universidad de Zaragoza D. Felipe Ptriz, elegido Rector posteriormente, apareca dentro de los objetivos y propuestas el aspecto de: Avanzar en la cultura de calidad, anticipacin y planificacin por objetivos; aqu se consideraba que la Universidad de Zaragoza deba disponer de mecanismos de planificacin y evaluacin de todas sus actividades: docencia, investigacin y gestin; y para ello se proponan siete puntos, de los cuales uno, el que nos interesa expresamente, tratara de: Analizar las tasas de xito, fracaso y abandono por titulacin para arbitrar polticas de mejora e innovacin. Tambin en documentos internos a la propia Facultad de Educacin se observaba la misma problemtica. Estos documentos a los que nos referimos eran los siguientes: documento Propuesta de lneas programticas de la candidatura InicioFac a Junta de Facultad (Zaragoza, noviembre de 2001) y documento Candidatura al Decanato de la Facultad de Educacin Dra. Mara del Carmen Molina Ortn (Inicio.Fac) (Zaragoza, 25 de enero de 2002). En ambos documentos, el apartado de las lneas programticas sobre Calidad Educativa deca lo siguiente: 1. Iniciar una reflexin acerca de

las altas tasas de fracaso y abandono de los alumnos en las diferentes especialidades de la Diplomatura de Maestro en esta Facultad.
Por tanto, se observa a travs de los documentos sealados que tanto a nivel de la Universidad como a nivel de la Facultad de Educacin se pensaba que haba un importante problema de rendimiento en los alumnos, el cual se traduca en altas tasas de abandono y fracaso generalizado en los estudios universitarios. Adems, si nos fijamos en las fechas de los documentos (2001, 2002 y 2004), indican que vena ya de largo; sin embargo, an siendo conscientes del problema de una manera global, faltaban datos ms concretos y sistematizados para conocer de verdad la magnitud real del problema. Es a esto a lo que quiere responder esta investigacin, empezando por presentar los datos cuantificados y organizados para sacar las primeras conclusiones orientadoras. A veces puede resultar sorprendente que este tipo de datos tan bsicos sean bastante desconocidos para la mayora y se tenga ms bien una percepcin global confusa de algo que se intuye como problema importante pero de lo que se carece de informacin fiable y segura, aunque se tengan ciertos datos generales; en este caso no tener datos concretos sobre rendimiento impide hacer un diagnstico correcto para luego poner el remedio. Tambin hemos de indicar que los datos con los que se trabaja en este estudio han sido autorizados y facilitados por el Servicio de Gerencia de la Universidad de Zaragoza. Los alumnos considerados en el estudio son los matriculados por primera vez en la anteriormente denominada Escuela Universitaria de Formacin de Profesorado de EGB y hoy Facultad de Educacin de la Universidad de Zaragoza, en las promociones de los cursos siguientes: 1994/97 1995/98 1996/99 1997/00 1998/01 1999/02 2000/03 y 2001/04. Estas ocho promociones estudiadas corresponden a los alumnos de las especialidades de Maestro siguientes: Audicin y Lenguaje, Educacin Especial, Educacin Fsica, Educacin Musical, Educacin Primaria y Lengua Extrajera. Se utiliza toda la poblacin de alumnos de las promociones citadas y en todas las especialidades de Maestro sealadas; por tanto se trabaja con datos absolutos para conseguir la mxima fiabilidad, es decir, el costoso esfuerzo realizado de seguimiento de alumnos se justifica por tratar de llegar a conocer con la mayor certeza la magnitud del problema de rendimiento acadmico. Este seguimiento realizado en ocho promociones corresponde a la mitad de las que ha habido en el plan de estudios vigente; lo cual supone una amplia representatividad para la validez de los datos obtenidos sobre el tema investigado. Lo que hace diferente a este estudio de otros de la misma naturaleza es que los datos obtenidos son a partir del seguimiento individualizado de los alumnos dentro de sus promociones y eso hace que sean ms fiables en cuanto a su aproximacin a la realidad, de manera que las estimaciones realizadas con los mismos son tambin ms ajustadas a la situacin real; esa es al menos la pretensin y justificacin del trabajo. Se ha tratado de seguir meticulosamente a todos y cada uno de los alumnos de las promociones y especialidades apuntadas; desde el inicio de la carrera cuando se matriculan por primera vez hasta cuando la acababan o no volvan a aparecer matriculados en la especialidad, y hasta el ltimo curso del que se tena informacin. Esta metodologa conlleva una alta fiabilidad de los datos, tambin un alto coste en esfuerzo y horas de trabajo, quedando un porcentaje residual pequeo de error, el cual deriva fundamentalmente del hecho de que si el seguimiento acaba en el curso 2004/05 las ltimas promociones tienen menor seguimiento comparativamente que las primeras; pero se

242 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza

observa que los titulados disminuyen considerablemente en general una vez que se ha titulado el grueso de la promocin. Formalmente el estudio se presenta en tres niveles de anlisis, desde una perspectiva global de los datos hasta consideraciones ms concretas y parciales vistas comparativamente. As, primero tenemos los datos globales y la tendencia del rendimiento acadmico entendido como titulacin o abandono en la carrera; un segundo nivel sobre los datos comparativos de las distintas especialidades de Maestro y sus tendencias de rendimiento; y finalmente, en un tercer nivel, tenemos los datos de rendimiento acadmico segn la va de entrada a la Facultad de Educacin y sus tendencias, tambin segn las especialidades de Maestro.

I. Anlisis y tendencia global de titulados y abandono de la carrera


A. ANLISIS GLOBAL El primer nivel de anlisis es tener un resultado global que detecte el problema general de rendimiento acadmico que se supone existe en la Facultad de Educacin para, una vez confirmado, poder pasar a otros niveles y aspectos de estudio que vayan delimitando dnde se est produciendo en mayor medida dicho problema y a partir de ah ya se tratara en su momento de remontar hacia las causas y sus posibles soluciones. Este artculo quiere centrarse exclusivamente en el estudio cuantitativo del problema de rendimiento de la Facultad de Educacin de la Universidad de Zaragoza. Para el anlisis global de los titulados y el abandono de la carrera utilizamos el indicador ms relevante, como es el porcentaje correspondiente que cuantifique el problema, una vez hecho el seguimiento de todas las promociones sealadas, desde la de 1994/97 hasta la de 2001/04, y en todas las especialidades de Maestro de la Facultad de Educacin: Audicin y Lenguaje, Educacin Especial, Educacin Fsica, Educacin Musical, Educacin Primaria y Lengua Extranjera. As los resultados obtenidos segn la Tabla 1 son los siguientes: El 60% (59,9%) de los alumnos obtiene la carrera de Maestro en alguna de sus especialidades. Y por tanto el 40% (40,1%) de los alumnos matriculados en la Facultad de Educacin no se titulan o abandonan la carrera.

Estos primeros resultados globales ponen de manifiesto cuantificndolo la existencia de un problema importante de rendimiento acadmico, puesto que hay un gran porcentaje de abandono en la carrera, el 40,1% de alumnos matriculados.

Magisterio Promociones (1994/97 2001/04) Educacin Fsica Educacin Especial Educacin Primaria Audicin y Lenguaje Lengua Extranjera Educacin Musical Totales

Total Alumnos 642 774 827 630 684 654 4211

Total Titulados 446 498 485 363 384 347 2523

% Titulados 69,5 64,3 58,6 57,6 56,1 53,1 59,9

% No Titulados 30,5 35,7 41,4 42,4 43,9 46,9 40,1

TABLA 1. Alumnos titulados y no titulados en las especialidades de Maestro en las promociones que van desde la de 1994/97 hasta la de 2001/04 en la Facultad de Educacin de la Universidad de Zaragoza. B. TENDENCIA GLOBAL DE TITULADOS Y ABANDONO DE LA CARRERA Los primeros datos presentados, tan relevantes sobre titulados y abandono, nos dan una primera idea sobre el problema global del centro en cuanto al rendimiento acadmico; sin embargo, esa realidad
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

243

Alfonso Heredia Manrique

queda sobrepasada por los datos que nos ofrece la tendencia global que existe desde la perspectiva temporal de las promociones estudiadas, la cual descubre otra realidad ms interesante. Si comparamos la primera promocin estudiada 1994/97 en todas las especialidades de Maestro con la ltima promocin estudiada 2001/04 en cuanto al porcentaje de titulados y abandono, tenemos lo siguiente:
Titulados Promocin 1994/97: Promocin 2001/04: Tendencia: 62,6% 41,9% 20,7% No Titulados 37,4% 58,1% +20,7%

____________________________

Como se ve, en los aos estudiados ha habido un vuelco en los datos de rendimiento acadmico desde la primera promocin estudiada a la ltima; hay ms de un 20% (20,7%) menos de titulados y por tanto el mismo porcentaje de incremento en el fracaso o abandono de la carrera. As, el abandono de la carrera por los alumnos en la ltima promocin estudiada, casi el 60% (58,1%), es muy superior al porcentaje de titulados algo ms del 40% (41,9%). Por tanto, la situacin es contraria a la que representa el dato global inicialmente presentado. Esto quiere decir que el problema de rendimiento acadmico es ms importante que lo que nos indican los datos globales del conjunto, puesto que los datos de tendencia son ms cercanos a la actualidad; evidentemente hay un desfase hasta justo el momento actual porque ha habido ms promociones, de las cuales no sabemos su tendencia hasta que no se estudie.

II. Anlisis comparativo y tendencias por especialidades de titulados y abandono de la carrera


A. ANLISIS COMPARATIVO ENTRE ESPECIALIDADES Las perspectivas globales dan por su naturaleza una primera visin sinttica del problema que se quiere detectar, pero no es toda la realidad; conocerla mejor supone acercarse ms a la misma en lo que sea posible, por eso profundizamos en distintos niveles de anlisis. Siguiendo esta lnea, el segundo nivel de anlisis corresponde a ver el problema en las distintas especialidades, puesto que cada una presenta su propia cara en el tema del rendimiento acadmico, como vamos a ver. Observamos en la Tabla 1 que hay diferencias entre los porcentajes de titulados y abandono de la carrera de Maestro entre unas y otras especialidades. As tenemos que en E. Fsica algo ms de dos tercios (69,5%) de los alumnos se titulan, frente a poco ms del cincuenta por ciento (53,1%) que lo hacen en E. Musical, lo cual supone ms de un 16% menos de titulados en esta especialidad. Hay tres especialidades donde el promedio de titulados es muy parecido: Educacin Primaria (58,6%), Audicin y Lenguaje (57,6%) y Lengua Extranjera (56,1%). Y Educacin Especial (64,3%) es la segunda especialidad con mayor porcentaje de titulados, por encima de las anteriores. Por tanto, hay dos especialidades E. Fsica y E. Especial donde el porcentaje de abandono de la carrera es menor y est alrededor de un tercio del alumnado. Y en el resto de especialidades el abandono se sita por encima del 40% del alumnado, hasta el 46,9% de E. Musical. Segn los datos anteriores diramos que el problema de rendimiento acadmico an siendo importante en general como ya hemos comentado en el apartado anterior, se presenta en mayor o menor medida segn la especialidad; es decir, el abandono de la carrera incide ms en unas especialidades que en otras. B. TENDENCIAS EN LAS ESPECIALIDADES DE MAESTRO SOBRE TITULADOS Y ABANDONO DE LA CARRERA La tendencia en la evolucin de los titulados y abandono de la carrera por especialidades entre la primera promocin estudiada (1994/97) y la ltima (2001/04) presenta los siguientes resultados de mayor a menor valor porcentual:

244 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza

Tendencias E. Primaria E. Musical E. Especial L. Extranjera Audicin y L. E. Fsica 40,7% 29,4% 18,7% 11,0% 9,5% 6,1%

1994/97 69,3% 60,6% 65,0% 50,0% 55,7% 68,6%

2001/04 28,6% 31,2% 46,3% 39,0% 46,2% 62,5%

La tendencia en la evolucin de los titulados de las promociones en todas las especialidades es a la baja, todas presentan un descenso en el porcentaje de titulados. Incluso hay un notable descenso en la mitad de las especialidades, donde hay que destacar sobre todo a Educacin Primaria donde se titulan un 40% (41,7%) menos de los que lo hacan, a Educacin Musical donde se titulan un 30% menos ( 29,4%) y a Educacin Especial donde hay casi un 20% menos de titulados (18,7%); slo en Educacin Fsica (6,1%) se mantendra el nivel de titulados. Tambin, como vemos, las diferencias de rendimiento acadmico entre las distintas especialidades es importante. Hay que destacar a Educacin Primaria, que era la especialidad donde ms alumnos se titulaban en la promocin 1994/97 con un 69,3% y sin embargo se convierte en la que menos se titulan con un 28,6% en la promocin 2001/04; esto se traduce en el abandono de casi las tres cuartas partes del alumnado. Y Educacin Musical reduce a la mitad su porcentaje de titulacin en las promociones estudiadas desde el 60,6% al 31,2%; esto supone un abandono prcticamente de los dos tercios del alumnado. En general, las tendencias de titulacin nos indican que el abandono de la carrera afecta con gran diferencia a las especialidades de Maestro; no obstante diramos que es un abandono masivo, puesto que en cinco de las seis especialidades est por encima del 50% del alumnado (Qu formacin tiene el alumnado que est viniendo a hacer esta carrera?) .

III. Anlisis y tendencia global segn la va de entrada de titulados y abandono de la carrera


A. ANLISIS GLOBAL POR VA DE ENTRADA El tercer y ltimo nivel de anlisis que hacemos del rendimiento acadmico es respecto a las distintas vas de entrada a la Facultad de Educacin, a saber: Pruebas de Acceso, Formacin Profesional, Titulados y Pruebas de Mayores de 25 aos.

Vas de entrada a la Facultad de Educacin Acceso Formacin Profesional Titulados Mayores de 25 aos Totales

Titulados 68,8% 42,5% 32,2% 32,7% 59,9%

No Titulados 31,2% 57,5% 67,8% 67,3% 40,1%

TABLA 2. Porcentaje de titulados y no titulados segn la va de entrada a la Facultad de Educacin. Observando la Tabla 2, vemos que casi el 70% (68,8%) de los alumnos de Acceso obtienen la titulacin, algo ms de los dos tercios de dicho alumnado, frente al 42,5% de la va de Formacin Profesional y a un tercio del alumnado tanto de la va de Titulados (32,2%) como de la de Mayores de 25 aos (32,7%); esta ltima va presenta muy poco alumnado en trminos absolutos. Por tanto, un tercio del alumnado de Acceso (31,2%) no obtiene la titulacin de Maestro y casi el 60% (57,5%) del alumnado de la va de Formacin Profesional tampoco obtiene el ttulo. En las otras dos vas, los dos
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

245

Alfonso Heredia Manrique

tercios de su alumnado no obtienen la titulacin, la de Titulados el 67,8% y la de Mayores de 25 aos el 67,3%. En todas la vas de entrada a la Facultad de Educacin se presentan porcentajes importantes de no titulacin, aunque con diferencias entre las distintas vas; las tres ltimas, Formacin Profesional, Titulados y Mayores de 25 aos, suponen en realidad un gran fracaso acadmico porque hay ms abandonos que titulados. Llama la atencin la va de Titulados porque estos alumnos ya tienen experiencia universitaria por haber cursado ya una carrera y, sin embargo,son los que presentan mayor porcentaje de fracaso (se vuelven malos alumnos en este centro?). B. TENDENCIA GLOBAL POR VA DE ENTRADA Como ya hemos hecho en apartados anteriores, vamos a matizar los datos globales presentados anteriormente porque a veces la realidad que representan no es la ms ajustada; as, viendo la tendencia comparativa entre la primera y la ltima promocin estudiada, en este caso segn la va de entrada, tendremos probablemente un cuadro de la realidad ms ajustado. No obstante, con los datos globales ms la tendencia podemos hacernos una buena idea de la realidad del rendimiento en la Facultad de Educacin, en este caso desde la perspectiva de las vas de entrada. Observando las tendencias globales por la va de entrada pareceran contradictorias, porque en las vas de Acceso y Formacin Profesional s se observa esa tendencia muy negativa; sin embargo en las vas de Titulados y Mayores de 25 aos la tendencia que se presenta es aparentemente positiva. As, vamos a hacer el anlisis de cada va:
Tendencias Acceso F.P. Titulados > 25 aos 30,7% 15,4% 3,1% 20,0% 1994/97 76,1% 42,9% 21,9% 0,0% 2001/04 45,4% 27,5% 25,0% 20,0%

Los anlisis anteriores de tendencias ya apreciaban el vuelco que se produce en el rendimiento entre la primera y ltima promocin estudiada. En la va de Acceso se produce la mayor tendencia negativa con casi un tercio del alumnado (30,7%); en trminos absolutos son 77 titulados menos (de 267 a 190), lo que supone pasar de titularse el 76,1% de los alumnos a hacerlo el 45,4% de los mismos, es decir, pasar de un fracaso del 23,9% de este alumnado de Acceso al 54,6%, que es ms del doble de fracaso al final del periodo estudiado. En la va de Formacin Profesional hay una cada de titulados del 15,4%, es decir, pasar del 42,9% de titulados al 27,5%; por tanto, el fracaso pasa del 57,1% a ms de los dos tercios (72,5%); en trminos absolutos son la mitad de titulados (de 45 a 22), que en realidad parecen menos que la impresin causada al verlo en trminos porcentuales. En la va de Titulados hay un aumento porcentual (3,1%) al ser considerada la tendencia entre dos promociones, la inicial y la final, pero es irreal dado que hay muy pocos alumnos en esta va; los porcentajes no acercan la realidad en este caso, puesto que estamos hablando de 11 titulados menos (pasar de 14 a 3). En la va de Mayores de 25 aos ocurre lo mismo que en la anterior, hay un aumento porcentual importante aparentemente (20%) que en realidad es solo un alumno que se titula; las cifras de alumnos en esta va son insignificantes. Hay que destacar que la va de Acceso es la ms importante, cuantitativamente supone dos tercios (67,4%) de la matrcula en la promocin 1994/97 y ms del 80% (81,2%) de la matrcula de la promocin de 2001/04; as, al aumento de la matrcula de alumnos le sigue una cada de los titulados. (Indicara esto una clara menor preparacin de este alumnado para entrar en la Universidad?).

VI. Anlisis comparativo y tendencias por especialidades segn las va de entrada de titulados y abandono de la carrera
A. ANLISIS COMPARATIVO ENTRE ESPECIALIDADES SEGN LAS VAS DE ENTRADA Los datos que presentan el anlisis comparativo entre especialidades segn la va de entrada respecto a la titulacin y abandono son los siguientes:

246 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza

Va de Acceso:
Titulados E. Especial E. Fsica Audicin y L. E. Primaria E. Musical L. Extranjera Global 79,3% 77,6% 71,4% 66,7% 61,0% 61,0% 68,8% No Titulados 20,7% 22,4% 28,6% 33,3% 39,0% 39,0% 31,2%

_____________________________

Habra diferencias entre las especialidades de Magisterio segn la va de Acceso; as mientras tenemos dos especialidades, E. Especial (79,3%) y E. Fsica (77,6%), que rondan cerca del 80% de titulados de los alumnos que entran por esta va, hay otras dos sobre el 60% de titulados, que son E. Musical (61%) y L. Extranjera (61%). Por tanto tenemos especialidades con cerca de un 40% de abandono o no titulacin en los alumnos de Acceso, E. Musical (39%) y L. Extranjera (39%); frente a las que el abandono ronda sobre el 20%, E. Especial (20,7%) y E. Fsica (22,4%). Y las otras dos especialidades restantes tendran un abandono sobre un tercio del alumnado, Audicin y Lenguaje (28,6%) y E. Primaria (33,3%).

Va de Formacin Profesional:
Titulados E. Fsica E. Especial L. Extranjera E. Primaria Audicin y L. E. Musical Global 59,9% 44,5% 40,0% 37,7% 31,3% 29,3% 42,5% No Titulados 40,1% 55,5% 60,0% 62,3% 68,7% 70,7% 57,5%

_____________________________

Hay dos especialidades muy por encima del resto en cuanto al nmero de alumnos en esta va de entrada y que vienen a coincidir con las de mayor porcentaje de titulados, E. Fsica (59,9%) y E. Especial (44,5%). Y otras dos especialidades, E. Musical (29,3%) y Audicin y Lenguaje (31,3%), que tienen muy pocos titulados, sobre un tercio de su alumnado; en todo caso tienen muy poca matrcula comparada con las otras especialidades. Por tanto, hay un alto porcentaje de no titulados en esta va de entrada que va desde el 40 al 70% de los alumnos segn especialidad; lo cual indica que tambin hay diferencias considerables entre las distintas especialidades; en cuatro de las seis estn entre el 60 y el 70% de no titulados: Lengua Extranjera (60,0%), E. Primaria (62,3%), Audicin y Lenguaje (68,7%) y E. Musical (70,7%).

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

247

Alfonso Heredia Manrique

Va de Titulados:
Titulados E. Fsica Audicin y L. E. Especial L. Extranjera E. Musical E. Primaria Global 46,7% 42,5% 33,3% 32,0% 25,0% 11,1% 32,2% No Titulados 53,3% 57,5% 66,7% 68,0% 75,0% 88,9% 67,8%

_____________________

En esta va todas las especialidades tienen un porcentaje de no titulados por encima del 50%, y las diferencias entre ellas son muy considerables, de tal manera que hay dos que destacan sobre manera, E. Musical con el 75% de no titulados y, sobre todo, E. Primaria con casi el 90% (88,9%) de no titulados (3 titulados de 27 matriculados). Esta va, que cabra pensar en que debera ser exitosa porque sus alumnos tienen ya otra titulacin universitaria, resulta ser en realidad de muy bajo rendimiento considerando cada una de las especialidades de Maestro (ya comentbamos en cuanto al global que dos tercios del alumnado no obtienen la titulacin).

Va de Mayores de 25 aos:
Titulados Audicin y L. E. Musical E. Primaria E. Especial E. Fsica L. Extranjera Global 50,0% 45,4% 33,3% 28,6% 22,2% 20,0% 32,7% No Titulados 50,0% 54,6% 66,7% 71,4% 77,8% 80,0% 67,3%

_____________________

Aqu los porcentajes estn muy sujetos a las cifras absolutas, porque hay muy pocos alumnos matriculados en esta va y su rendimiento por especialidades es muy bajo (igual el rendimiento general); como vemos, en las dos especialidades con mejores resultados el porcentaje de no titulados est igual o por encima del 50%, Audicin y Lenguaje (50,0%) y E. Musical (54,6%); y las especialidades con peores resultados se sitan entre el 70 y 80% de no titulados, E. Especial (71,4%), E. Fsica (77,8%) y Lengua Extranjera (80,0%). Esta va, igual que la anterior, es poco exitosa y aunque tenga pocos alumnos sus porcentajes indican la importante falta de rendimiento de esos pocos alumnos que la utilizan. B. TENDENCIAS EN LAS ESPECIALIDADES SEGN LAS VAS DE ENTRADA Dentro de este tercer y ltimo nivel de anlisis cuantitativo que hacemos, lo ms afinado del mismo, se refiere a las tendencias que presentan las distintas especialidades segn la va de entrada de sus alumnos a la Facultad de Educacin.

248 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza

Va de Acceso
Tendencias E. Musical E. Primaria E. Especial Audicin y L. L. Extranjera E. Fsica Global 51,8% 43,5% 40,9% 27,2% 14,5% 6,7% 30,7% 1994/97 83,3% 76,0% 90,9% 78,0% 56,5% 80,0% 76,1% 2001/04 31,5% 32,5% 50,0% 50,8% 42,0% 73,3% 45,4%

___________________________________

Esta va, como hemos dicho, es la ms importante con diferencia en cuanto a la procedencia del alumnado de la Facultad de Educacin, e incluso su importancia cuantitativa aumenta considerablemente en la ltima promocin estudiada. Por tanto, todo lo que ocurra en ella en cuanto al rendimiento marcar la tendencia general. Vemos que todas las especialidades presentan tendencias negativas, pero hay diferencias considerables entre las mismas. Tenemos que en E. Musical hay una cada espectacular en el porcentaje de titulacin, ms del 50% (51,8%), de tal manera que siendo la segunda especialidad que ms porcentaje de titulados tena por encima del 80% (83,3%) cae a un tercio de la matrcula (31,5%), la especialidad con menor porcentaje de titulados. Tambin E. Primaria presenta una cada espectacular en sus titulados (43,5%), de manera que si antes se titulaban las tres cuartas partes (76,0%) del alumnado ahora lo hace sobre un tercio del mismo (32,5%); es decir, el fracaso pasa del 24%, una cuarta parte, a ser de dos tercios (67,5%). Y la tercera cada espectacular es en E. Especial (40,9%), pasando de ser la mejor especialidad con el 90,9% de titulados y por tanto con fracaso muy bajo del 9,1%, a tener un fracaso del 50,0% de su alumnado. En cuanto a Audicin y Lenguaje tiene tambin una prdida importante del 27,2%, pero sin embargo en titulados reales mantiene la misma cifra (32 titulados). Finalmente las dos especialidades con una menor tendencia negativa son Lengua Extranjera (14,5%), que mantiene un porcentaje de fracaso entre el 43,5% y 58,0%, el cual aun no siendo pequeo tampoco es un desequilibrio equiparable a las especialidades anteriores. Y la otra es E. Fsica (6,7%), esta especialidad mantiene su porcentaje de titulados muy por encima del resto de las especialidades (del 80% al 73,3%) e incluso esa supuesta prdida porcentual en trminos de titulados reales es un aumento importante de los mismos (de 32 a 44 titulados).

Va de Formacin Profesional
Tendencias E. Musical E. Primaria E. Fsica E. Especial Audicin y L. L. Extranjera Global 35,0% 32,1% 25,8% 10,6% 1,5% 3,3% 15,4% 1994/97 60,0% 41,2% 59,1% 42,4% 31,8% 16,7% 42,9% 2001/04 25,0% 9,1% 33,3% 31,8% 33,3% 20,0% 27,5%

___________________________________

Es la segunda va ms importante de entrada a la Facultad de Educacin pero a gran distancia de la va anterior de Acceso, aunque pierde peso de alumnos en la ltima promocin estudiada (pasa del 20,1% al 15,5%). Observamos que hay diferencias importantes en las tendencias de rendimiento y abandono de las distintas especialidades en esta va de entrada, pero no son tan considerables como en la va de Acceso; adems hay tanto tendencias positivas como negativas. La especialidad que presenta la
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

249

Alfonso Heredia Manrique

mayor tendencia negativa es E. Musical con ms de un tercio de prdida de titulados (35%); era la especialidad que tena mayor porcentaje de titulados (60%) de esta va, aunque como es la especialidad a la que accede menos alumnado de Formacin Profesional, la prdida del nmero real de titulados es poco relevante (de 3 a 1 titulado). La especialidad de E. Primaria tiene una cada muy fuerte de titulados en el periodo considerado, del 41,2% al 9,1%. Esto supone un enorme fracaso, pues pasa del 58,8% de fracaso al fracaso casi total del 90,9%; no obstante en el nmero de titulados reales supone bajar de 7 a 1 titulado. Las especialidades de E. Fsica (25,8%) y E. Especial (10,6%) que al final de la tendencia se sitan en una parte intermedia de prdida porcentual, quedndose sobre un fracaso de los dos tercios de su alumnado, en cifras absolutas de nmero de titulados se convierten en las que pierden ms titulados, sobre el 50%, aunque es verdad que no estamos hablando de muchos alumnos. Las otras dos especialidades restantes, Audicin y Lenguaje (1,5%) y Lengua Extranjera (3,3%), presentan una tendencia positiva engaosa, porque la primera mantiene el fracaso sobre los dos tercios de su alumnado y en cifras reales hay una prdida de 2 titulados (de 7 a 5) en ese periodo; y en el caso de Lengua Extranjera se mantiene el mayor fracaso de su alumnado pasando del 83,3% al 80%. Son la primera y segunda especialidad con mayor fracaso en el periodo considerado; no obstante, en nmero real de titulados es muy poco relevante pues pasa de tener 1 titulado a 2 titulados.

Va de Titulados
Tendencias E. Fsica Audicin y L. L. Extranjera E. Primaria E. Musical E. Especial Global 37,5% (3/0) 25,0% (2/0) 14,3% (1/0) 0.0% (0/0) 29,2% (5/1) 45,3% (3/2) 3,1% (14/3) 1994/97 37,5% 25,0% 14,3% 0,0% 20,8% 21,4% 21,9% 2001/04 0,0% 0,0% 0,0% 0,0% 50,0% 66,7% 25,0%

___________________________________________

Las tendencias que presentan las especialidades en la va de Titulados tienen grandes diferencias porcentuales, son tanto positivas como negativas; en este caso hay que hablar en trminos de titulados reales, porque los porcentajes son muy engaosos dado el poco alumnado matriculado en esta va de entrada. Hay dos especialidades, E. Fsica (37,5%) y Audicin y Lenguaje (25,0%), con importantes porcentajes de prdida, pero que en realidad corresponden a perder a los 3 y 2 titulados respectivamente que tenan. Otras dos especialidades, E. Musical (29,2%) y E. Especial (45,3%), tienen un importante porcentaje positivo que tambin es totalmente engaoso, porque en realidad supone una prdida de 4 y 1 titulados respectivamente.

Va de Mayores de 25 aos
Tendencias Audicin y L. E. Especial E. Fsica E. Musical E. Primaria L. Extranjera Global 0,0% (0/0) 0,0% (0/0) 0,0% (0/0) 0,0% (0/0) 0,0% (0/0) 50,0% (0/1) 20,0% (0/1) 1994/97 0,0% 0,0% 0,0% 0,0% 0,0% 0,0% 0,0% 2001/04 0,0% 0,0% 0,0% 0,0% 0,0% 50,0% 20,0%

_________________________________________

250 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

Estudio del rendimiento acadmico de los alumnos de Magisterio de la Facultad de Educacin de la Universidad de Zaragoza

Las tendencias que presentan las especialidades de maestro en la va de Mayores de 25 aos no existen para el periodo considerado: hay un 0% de titulados porque tampoco aparecen alumnos matriculados; solamente hay una excepcin en Lengua Extranjera con un 50% de aumento, que en realidad es 1 titulado de dos matriculados en la ltima promocin estudiada. Por tanto, una va prcticamente inexistente, no utilizada, para acceder a los estudios de Maestro.

Conclusiones
Todos los datos de los distintos niveles analizados confirman objetivamente, dada la sistemtica cuantificacin realizada, el importante problema de rendimiento general existente en el alumnado de la Facultad de Educacin de Zaragoza; el cual se ve agravado por las tendencias negativas que se presentan en la comparacin de promociones y todo ello queda matizado por las grandes diferencias que existen igualmente entre especialidades dentro del fracaso general y en las vas de entrada que nutren de alumnado a esta Facultad. Sin embargo, estas cifras de fracaso acadmico ya importantes de por s no dicen todo lo que est ocurriendo en este tema con respecto al alumnado de la Facultad de Educacin de la Universidad de Zaragoza.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 241251

251

APROXIMACIONES DIDCTICAS

REFERENCIA: Arlegui de Pablos, Javier & Ibarra Murillo, Julia. (2010). El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin
JavierARLEGUIDEPABLOS JuliaIBARRAMURILLO
Correspondencia: JavierArlegui dePablos Correoelectrnico: arleguip@unavarra.es Telfono: +34948169460 Direccinpostal: Dpto.dePsicologayPedagoga UniversidadPblicadeNavarra CampusArrosada 31006Pamplona/Iruea (Espaa) JuliaIbarraMurillo Correoelectrnico: maider@unavarra.es Telfono: +34948169493 Recibido:8dejuniode2009 Aceptado:18deoctubrede2010

RESUMEN
Elaprendizajeporindagacinencienciasexperimentalesse entiende como un aprendizaje de resolucin de problemas basado en la construccin y uso de modelos, y tiene actualmente su modelizacin didctica en la teora de las organizaciones praxeolgicas. En este marco, los valores numricos de las medidas juegan un papel preciso y de suma importancia; actan como herramienta (til) en la construccin semntica delasmagnitudesdelfenmeno,y como objeto de conocimiento en el proceso de modelizacin de dicho fenmeno. Se muestra esta doble funcinenelcasodelaelasticidaddeunresorte.

PALABRAS CLAVE: Aprendizaje de ciencias, Modelos, Indagacin,Praxeologa.

The role of the numerical values of experimental mesaurements in InquiryBased Learning


ABSTRACT
Inquirybasedlearningisunderstoodinexperimentalsciencesasproblemsolvinglearningbasedonthe building and use of models. It currently has its didactic grounding in the theory of praxeology. Within thisframework,thenumericalvaluesofmeasurementsareofgreatrelevanceandplayakeyrole:they actasaworkingtoolinthesemanticbuildingofthemagnitudesofthephenomenonandasthelearning aim in the process of modeling the phenomenon. This double function is shown in relation to the elasticityofaspring.

KEY WORDS: Sciencedidactics,Models,Inquiry,Praxeology

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

255

Javier Arlegui de Pablos & Julia Ibarra Murillo

1. Un modelo para el aprendizaje escolar de las ciencias: el aprendizaje por indagacin


Podramos definir la indagacin como un proceso de cuestionamiento y de bsqueda interactiva de informacin en el mundo, como mtodo de alcanzar el conocimiento y la verdad El proceso de indagacin se inicia con la recogida de informacin (datos) a travs de los sentidos y/o de los instrumentos de medida para dar respuesta a un problema de carcter general que porta sobre el sentido que podemos atribuir al conjunto de datos, sobre un texto que explique, al menos, el cmo suceden dichos datos, una propuesta de sntesis sobre el conocimiento que nos aportan. Los datos son, as, el soporte del conocimiento (EXLINE, 2004). Pero son precisamente las habilidades de los alumnos para debatir y construir el conocimiento a partir de los referentes empricos, esto es, sus habilidades indagatorias, lo que la escuela debe promover como su objetivo primordial. La escuela actual reconoce y propugna como modelo didctico el aprendizaje por indagacin, y en torno a l se basan importantes propuestas de renovacin en enseanza de las ciencias. Uno de los grandes movimientos europeos contemporneos para la revisin de la enseanza de las ciencias es el Proyecto La Main la Pte cuyo nombre ha sido intencionalmente escogido para explicitar el carcter activo y experimental de la ciencia escolar que propugna. El objetivo de este amplio movimiento es el de promover, en el seno de la escuela primaria, el proceso de investigacin cientfica (que los alumnos) construyan los conocimientos por la exploracin, la experimentacin y la discusin. Se aprende ciencia por la accin, implicndose confundindose explicitando su punto de vista y confrontndolo a los resultados experimentales para verificar su pertinencia y validez. Un segundo ejemplo lo constituye el caso norteamericano, donde el National Research Council public en 1996 los National Science Education Standards, los cuales propugnan un aprendizaje de los contenidos cientficos a travs de la indagacin/investigacin (inquiry); privilegiando la ciencia como proceso donde los estudiantes aprenden a observar, inferir y experimentar.. a describir objetos y

eventos, plantear preguntas, construir explicaciones y contrastarlas con el conocimiento cientfico ya establecido.

2. La indagacin entendida como la resolucin de problemas mediante la construccin y el uso de modelos


El nfasis que el aprendizaje por indagacin hace sobre la construccin de conocimientos de carcter general que sean, adems, conocimientos funcionales, hace que dicho aprendizaje de la ciencia entronque con el enfoque de la ciencia escolar que la concibe como una transposicin didctica de la ciencia sabia; le savoir savant de Chevallard (1999) o Johsua & Dupin (1993), de la que retiene aspectos epistemolgicos bsicos: la recopilacin de hechos como base de nuestra experiencia, la medida como dispositivo de atribucin de valores a los rasgos de las cosas y de los sistemas, lo que conocemos como propiedades, atributos o cualidades; la medida cuantitativa, con la asignacin de numerales a los grados o cantidades de las magnitudes. Magnitudes que son las cualidades variables o extensivas de los objetos (longitud, masa, fuerza); las variables de estado, parmetros o variables discriminativas de los estados de un fenmeno; las leyes empricas, como la formulacin de enunciados de carcter general que expresan relaciones invariantes entre las propiedades observables/mensurables de un fenmeno, y lo modelizan en un sistema formal; las predicciones deducidas de las leyes, relativas a casos determinados y que se formulan en el lenguaje de observacin o de medida; las teoras, entendidas aqu simplemente como leyes superiores o leyes de alto nivel de las cuales cabe deducir otras leyes, de las que del mismo modo pueden deducirse otras leyes en

256 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin

una cadena deductiva hasta llegar a las leyes empricas y a los hechos que, finalmente, se deducen de las mismas. Todo ello queda recogido cuando formulamos la actividad cientfica en el aula como un proceso de resolucin de problemas basado en la construccin y aplicacin de modelos, o de resolucin de problemas por modelizacin tal como plantea Gascn (1994).

3. Un modelo para la representacin de la ciencia a ensear: las organizaciones praxeolgicas


3.1 DESCRIPCIN ESTTICA DE LAS PRAXEOLOGAS En este marco, presentaremos sintticamente la nocin de praxeologa tal como aparece en Chevallard (1999) y la desarrollan Bosch & Gascn (2005); de todo ello nos interesar su aplicacin a la actividad cientfica en la escuela. Una praxeologa es una estructura formal que constituye una visin integrada del saber y del saberhacer sobre el mundo. Es una visin que recoge la doble vinculacin de todo saber: con su referente ms terico que lo explica y con su referente ms prctico del que es su explicacin. La descripcin esttica de una praxeologa se articula en torno a la descripcin de trminos tales como tarea, tcnica, tecnologa y teora que exponemos a continuacin.

Tareas: En la raz de la nocin de praxeologa se encuentran las nociones solidarias de tarea y de tipo de tareas. Una tarea, elemento primitivo de la teora, se representa habitualmente por un verbo y
corresponde a un concepto antropolgico ms amplio que el que el lenguaje corriente atribuye a una

accin humana. Tcnicas: Una praxeologa relativa a un tipo de tareas requiere una manera de realizar las tareas. A una determinada manera de hacer se le da, aqu, el nombre de tcnica (del griego tekhn, saber hacer). Una praxeologa relativa a un cierto tipo de tareas contiene, as, un bloque constituido por el tipo de tareas y su correspondiente praxeologa, que se denomina bloque prcticotcnico y que se identifica con lo que comnmente se denomina un saberhacer. Tecnologas: Se entiende por tecnologa un discurso racional (el logos) sobre la tcnica (la tekhn), cuyo primer objetivo es justificar racionalmente la tcnica para asegurarse de que permite realizar el tipo de tareas que pretende. Teoras: citando a Chevallard, A su vez, el discurso tecnolgico contiene afirmaciones ms o menos explcitas, de las que se puede pedir razn. Se pasa entonces a un nivel superior de justificacin explicacinproduccin, el de la teora, que retoma, en relacin con la tecnologa el papel que sta ltima tiene respecto a la tcnica.
El estatus de lo que aqu denominamos como teora es en realidad un ingrediente de abstraccin progresiva, que sube y es creciente desde las tareas a las tcnicas, las tecnologas y las teoras.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

257

Javier Arlegui de Pablos & Julia Ibarra Murillo

3.2 LOS RECORRIDOS PRAXEOLGICOS Las praxeologas pueden construirse por dos caminos: De abajo arriba, esto es, desde la prctica a la teora, o desde una clase de textos al metatexto que los generaliza y que constituye su referente explicativo. Es el proceso inductivo de construccin progresiva de saberes cada vez ms generales y tericos. El reconocimiento y la resolucin repetida de cada uno de los problemas de una misma clase permite inducir eventualmente una tcnica comn de resolucin para dicha clase de problemas. Tngase en cuenta que una tarea se resuelve, por definicin, si se conoce la tcnica correspondiente. En caso contrario (cuando todava no se conoce la tcnica) la tarea se presenta como problemtica y se denomina, simplemente, un problema (que deber resolverse por ensayo y error y/o por imitacin). Equivalentemente, el reconocimiento de las semejanzas y diferencias entre una clase de tcnicas, permite eventualmente inducir una tecnologa que las describe de modo unificado, etc. De arriba abajo, esto es, de la teora a la prctica, o desde un saber a sus aplicaciones y/o ejemplificaciones. Es el proceso deductivo de construccin de conocimientos de carcter progresivamente ms particular. Si se posee el conocimiento significativo de una tecnologa se puede, especificando los parmetros particulares de una tcnica, obtener por deduccin formal dicha tcnica. Igualmente, a partir del conocimiento de una tcnica puede deducirse la resolucin de una tarea como un caso particular de los que ejemplifican dicha tcnica. 3.3 LAS RELACIONES ENTRE LOS ELEMENTOS DE UNA ORGANIZACIN PRAXEOLGICA Hemos descrito anteriormente la estructura esttica y dinmica de las organizaciones praxeolgicas. Queda ahora simplemente explicitar la naturaleza de los vnculos entre los distintos niveles jerrquicos en una praxeologa. Una tcnica, por ejemplo, est vinculada hacia abajo con una clase de tareas y hacia arriba est vinculada a una tecnologa. Vemos que la relacin descendente vincula a la tcnica con su mbito de aplicacin y produccin, con sus ejemplificaciones y los casos particulares, con los hechos que de deducen de la misma. Esta relacin remite a la validacin emprica de la verdad de la tcnica: Si los n casos deducidos del texto de la tcnica son empricamente ciertos, la tcnica mantiene su carcter de verdadera en la medida en que (todava) no ha sido falsada Vemos que la relacin ascendente vincula a la tcnica con la tecnologa. Segn Chevallard (1999): Se entiende por tecnologa un discurso racional el logos sobre la tcnica la thekn, discurso cuyo primer objetivo es justificar racionalmente la tcnica , para

asegurarse de que permite realizar las tareas del tipo T, es decir, realizar lo que se pretende.
La tecnologa tiene un a funcin justificativa. Cabe sealar despus, con Chevallard, que una segunda funcin de la tecnologa es la de explicar, de hacer inteligible, de aclarar la tcnica. Si la primera funcin justificar la tcnica consiste en asegurar que la tcnica da lo pretendido, esta segunda funcin consiste en exponer por qu es correcta. Finalmente, la tecnologa tiene una funcin de produccin de tcnicas, al ser una generalizacin de las mismas.

4. Las praxeologas como base de una Didctica en el mbito de las Ciencias Experimentales
Las organizaciones praxeolgicas nos permiten establecer un modelo para la actividad cientfica escolar. En ciencias experimentales, las tareas coinciden con los hechos. Una clase de hechos constituye un fenmeno. La construccin de una tcnica es la construccin (y formulacin) de una ley emprica, experimental o de primer nivel. La construccin de una tecnologa supone la construccin de una ley de segundo nivel (ms general, ms abstracta, en funcin de ms variables) que generaliza toda una clase de leyes de primer orden Podramos probar (lo que est fuera del objetivo de esta

258 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin

comunicacin) que la estructura de las organizaciones praxeolgicas recoge en esencia, y modeliza, todas las caractersticas mencionadas anteriormente de la ciencia como un proceso de investigacin.

Para el nivel escolar de la Educacin Primaria se considera como suficiente la construccin de estructuras praxeolgicas como las de la figura adjunta, donde en los recorridos ascendentes es suficiente con alcanzar una ley de nivel tecnolgico. Se propone, igualmente, que los recorridos de investigacin y de construccin de las leyes se inicien escolarmente de abajo arriba, por un proceso de indagacin (enquiry) que es en esencia un proceso de modelizacin. Supone la actividad de exploracin, por diferentes equipos de alumnos, de varias clases de fenmenos semejantes, que permitan inducir varias leyes tcnicas y, finalmente (si el tipo de fenmeno y el nivel de desarrollo de los alumnos lo permite), inducir una ley tecnolgica que las unifique. 4.1 LA UNIDAD DIDCTICA BSICA EN LA ENSEANZA DE LAS CIENCIAS El ncleo didctico mnimo de esta actividad de indagacin es la construccin inductiva de una

ley tcnica.
Esta actividad modelizadora supone: La formulacin de un problema cientfico como un problema relativo a una clase de hechos (constitutivos de un fenmeno), que desencadene el proceso de indagacin; una etapa de laboratorio experimental (de interaccin exploratoria con el mundo), en la que se recogen los datos de diferentes estados del fenmeno, esto es, los valores que las variables sistmicas toman en cada uno de los hechos que observamos relativos al fenmeno en estudio; una etapa de laboratorio tcnico (lgicomatemtico) (de exploracin formal de los datos experimentales), en la que a partir de los datos del laboratorio precedente se formula y verifica una relacin hipottica entre los mismos, para llegar a formular lo que conocemos como una ley (un saber tcnico en la nomenclatura praxeolgica). 4.2 UNA PROPUESTA DE PROGRAMACIN DE UNA UNIDAD DIDCTICA DE CIENCIAS EXPERIMENTALES En este marco didctico, la secuencia prototpica de situaciones didcticas que configurara una unidad didctica bsica en Ciencias Experimentales sera la siguiente: 1. Formulacin del problema: 1.1. Proposicin inicial de un problema adidctico. El profesor, en el aula, formula un problema, con base en la vida diaria (para asegurar la significatividad del problema para los alumnos), en relacin con el saber a ensear objeto de la unidad. El problema debe contener los nombres de las variables fsicas en cuyos trminos ser finalmente construido el saber. 1.2. Reformulacin del problema como un problema cientfico:

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

259

Javier Arlegui de Pablos & Julia Ibarra Murillo

Se reformula el problema adidctico como un problema de conocimiento cientfico, que busca como solucin la creacin y aplicacin de un modelo sistmico. Habitualmente se formula como la bsqueda de una relacin entre variables. 1.3. Devolucin del problema a los alumnos: El profesor propondr a los alumnos asumir la solucin del problema, trabajando por indagacin experimental. 2 Resolucin del problema, laboratorio 1: adquisicin y representacin de la experiencia sobre el fenmeno (El laboratorio 1 es un laboratorio emprico, que permite una interaccin exploratoria fsica con el fenmeno para su observacin). 2.1. Previsin de una posible etapa de exploraciones iniciales: Los alumnos pueden desarrollar inicialmente una serie de exploraciones (acciones) por ensayo y error para tratar de adquirir experiencia inicial sobre el fenmeno y los dispositivos de medida. 2.2. Observacin sistemtica de estados del fenmeno: Una etapa de observacin sistemtica de una clase de hechos relativos al fenmeno, en la que los alumnos toman datos, asignando valores a las variables de estado del fenmeno. Con alumnos experimentados se debe tender a producir en esta etapa un verdadero diseo experimental con control de variables. El resultado final es la formulacin sistemtica de textos descriptivos de estados particulares del fenmeno, expresados por escrito, mediante una tabla de datos y/o su correspondiente representacin grfica de puntos experimentales. 3 Resolucin del problema, laboratorio 2: modelizacin de los datos de la experiencia (El laboratorio 2 es un laboratorio informtico, que permite una interaccin exploratoria formal con los datos del fenmeno para su modelizacin). 3.1. Modelizacin del fenmeno: A partir de los datos del fenmeno, los alumnos tratarn de formular hiptesis sobre relaciones entre las variables que puedan ser invariantes en el conjunto de los datos y constituir un modelo del fenmeno. Y sometern dichas hiptesis a una verificacin operatoria para su aceptacin o rechazo. 3.2. Institucionalizacin del saber: El profesor, retomando ahora los saberes personales que han propuesto los alumnos, har un trabajo de reformulacin para producir con el conjunto de la clase un texto cannico con el texto definitivo del modelo. 4. Uso del modelo para la solucin de problemas de la misma clase: Se usa ahora el modelo como herramienta para deducir nuevos hechos de la misma clase que los que se observaron en el Laboratorio 1. 5. Generalizacin del modelo y discusin tecnolgica. Solucin de problemas de fenmenos anlogos (eventualmente el del problema adidctico): El profesor, y los propios alumnos, trabajarn otros problemas del mismo campo. De este modo, generalizarn el modelo inicial a una clase de modelos semejantes. Y si es posible, tratarn de tomar esa clase de modelos (tcnicos) como objeto de estudio para su generalizacin emprica, construyendo as un modelo de nivel superior (tecnolgico) que d cuenta de todos ellos.

5. Un ejemplo: indagando la elasticidad de una banda de goma


A modo de ejemplo, extraemos, en lo que sigue, las fases de tratamiento de datos por los alumnos en una unidad de aprendizaje por indagacin; slo discutiremos aqu los epgrafes de la propuesta de programacin 4.2 anterior que tienen que ver con el trabajo en los dos laboratorios: emprico y formal.

260 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin

5.1 FORMULACIN DEL PROBLEMA CIENTFICO: Est relacionada la longitud que se estira una goma elstica (L) con la fuerza (F) con que tiramos de su extremo? Puedes encontrar una relacin L = f (F)?

extremo fijo goma

goma F L L

5.2 OBSERVACIN Y REPRESENTACIN DE SITUACIONES EXPERIMENTALES (LABORATORIO 1): Nuestra variable independiente es F; nuestra variable dependiente es L. Realizamos una serie sistemtica de experiencias en las que observamos los estiramientos de una goma elstica con distintos valores de la variable independiente F. Hemos tomado los siguientes valores F = 1, 2, 3, 4 y 5 Newtons. Los resultados se muestran en la tabla siguiente:

F 0 1 2 3 4 5

L exper 0,0 2,4 4,7 7,4 10,8 14,7

Y los hemos representado grficamente en un diagrama de ejes F, L:

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

261

Javier Arlegui de Pablos & Julia Ibarra Murillo

estiramiento de una goma elstica datos experimentales


16,0 14,0 12,0 10,0 8,0 6,0 4,0 2,0 0,0 0 1 2 3 4 5 F (Newtons)

5.3 MODELIZACIN DE LAS REPRESENTACIONES (LABORATORIO 2): Buscamos una funcin algebraica sencilla L = f (F) que reproduzca lo mejor posible los valores L experimentales anteriores. Para ello llevamos los datos experimentales a una hoja excel y programamos relaciones funcionales entre F y L lo ms sencillas posible que ajusten en lo posible a los datos experimentales. 5.3.1 Modelo lineal (y = k * x) De la tabla y la grfica anteriores vemos que la tendencia de los datos es mantener una relacin de proporcionalidad del tipo a ms ms, esto es, a mayores valores de F, mayores valores de L. Probamos, por ello, una relacin que sea estrictamente proporcional. Probamos la funcin lineal de proporcionalidad directa: L = k * F Programamos esta relacin en la hoja excel anterior, escribiendo el clculo funcional de los valores L tericos en una columna a la derecha de los valores L experimentales. Probamos a ajustar los valores tericos a los experimentales asignando a k distintos valores. El resultado es que nuestra funcin lineal no ajusta todo el rango de los valores experimentales, y slo podemos ajustar los valores iniciales con valores pequeos de F. Ello se representa en la siguiente tabla y grfica excel:
L = k*F F 0 1 2 3 4 5 L exper 0,0 2,4 4,7 7,4 10,8 14,7 L terica 0,0 2,4 4,8 7,2 9,6 12,0

262 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

El rol de los valores numricos de las medidas experimentales en el aprendizaje por indagacin

estiramiento de una goma elstica modelo lineal (ley de Hooke)


16,0 14,0 12,0 10,0 8,0 6,0 4,0 2,0 0,0 0 1 2 3 4 5 F (Newtons) exper terica

La mejor aproximacin se consigue para k = 2,4, siendo nuestro modelo lineal de estiramiento (que se conoce como Ley de Hooke) para nuestra goma: L = 2,4 * F En este momento los alumnos han construdo una praxeologa local con un modelo lineal para el proceso de elongacin de la goma. La discusin tecnolgica posterior, sobre la insuficiencia del modelo para los valores superiores de la fuerza, lleva a tratar de mejorar la tcnica anterior, con una tcnica ampliada: la hiptesis cuadrtica.

5.3.2 Modelo cuadrtico (y = k1* x + k2* x2 )


Probamos ahora a ajustar a los datos experimentales un funcin cuadrtica: L = k1 *F + k2 * F 2 Calculamos en una hoja excel los valores tericos de L segn esta expresin, obteniendo los resultados de la tabla y la grfica siguientes:

L = k1*F + k2*F*F F 0 1 2 3 4 5 L exper 0,0 2,4 4,7 7,4 10,8 14,7 L teorica 0,0 2,2 4,8 7,7 10,9 14,5

k1= k2=

2,05 0,17

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

263

Javier Arlegui de Pablos & Julia Ibarra Murillo

estiramiento de una goma elstica modelo cuadrtico


16,0 14,0 12,0 10,0 8,0 6,0 4,0 2,0 0,0 0 1 2 3 4 5 F (Newtons)

exper terica

Este ajuste se consigue para k1= 2,05 y para k2= 0,17, obteniendo: L = 2,07 *F +0,17 * F 2 un modelo cuadrtico que ajusta muy bien todo el rango de valores experimentales.

Conclusin
En definitiva, las organizaciones praxeolgicas nos permiten disear un modelo de actividad cientfica experimental para la escuela, que lleva a los alumnos a la construccin de una ley o de una teora sobre el fenmeno o el hecho que investigamos. Con estos modelos se consigue una secuencia de trabajo para los alumnos (los escolares o nuestros alumnos de Magisterio) que va desde la interaccin con objetos fsicos (la goma elstica en nuestro ejemplo) para construir saberes tcnicos, hasta la elaboracin de los saberes tericos que explican el fenmeno.

Referencias bibliogrficas
BOSCH, M. & GASCN, J. (2005). TwentyFive Years of the Didactic Transposition. ICMI Bulletin 58. CHEVALLARD, Y. (1999). El anlisis de las prcticas docentes en la teora antropolgica de lo didctico. Recherches en Didactique des Mathmatiques, vol. 19, 2: 221266. EXLINE, J. (2004). Workshop: InquiryBased Learning. Educational Broadcasting Corporation. GASCN, J. (1994). El papel de la Resolucin de Problemas en la Enseanza de las Matemticas. Revista Educacin Matemtica, 6, 3: 3751. JOHSUA, S. & DUPIN, J. J. (1993). Introduction la Didactique des Sciences et des Mathmatiques. Paris: Presses Universitaires de France. LA MAIN A LA PATTE: http://www.inrp.fr/lamap/accueil.html. NATIONAL SCIENCE TEACHING ASSOCIATION: http://www.nsta.org/standards.

264 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 255264

REFERENCIA: Gonzlez Garca, Javier (2010). Anlisis del andamiaje en un proceso de lectura conjunta. REIFOP, 13 (4). (Enlace web: http://www.aufop.com Consultada en fecha (ddmmaa):)

Anlisis del andamiaje en un proceso de lectura conjunta


JavierGONZLEZGARCA

Correspondencia: JavierGonzlezGarca Correoelectrnico: jr2000x@yahoo.es Telfono: 01(473)7331269(22) Direccinpostal: UniversidaddeGuanajuato InstitutoInvestigac.enEducacin Ctra.GuanajuatoJuventinoRosas Km.9.0 Col.LaHierbabuena 36250Guanajuato Mxico Recibido:30deagostode2010 Aceptado:10denoviembrede2010

RESUMEN
Observamos la evolucin de dos sistemas de andamiaje en un proceso de construccin conjunta a partir de la lectura de cuentos durante el ltimo curso de Educacin Infantil. Elaboramos un sistema de anlisis que intenta estudiar las interacciones en grupo reducido, para poder observar la evolucin de las estrategias de interaccin desplegadas, tantoporlasmaestrascomoporpartedelosalumnos.Los resultadosabreneldebatesobrelapuestaenprcticadela lecturaapoyadaenladiscusin,dentrodelosprogramasde formacin del profesorado. Tambin pueden ayudar a establecer ndices para mejorar la formacin de los nios como lectores e intrpretes de narraciones, generando pautasparaacercarlalecturacomounaprcticasocial. PALABRAS CLAVE: Discusin, Narraciones, Socializacin cognitiva,Andamiaje,EducacinPreescolar.

An Analysis of scaffolding in a joint reading process


ABSTRACT
We observe the evolution of two systems of scaffolding in a joint construction process from reading storiesinthelastyearofInfantEducation.Wedevelopedasystemofanalysisthatattemptstoanalyse interactionsinsmallgroupstoobservethedevelopmentoftheinteractionstrategiesdeployedbothby teachersandbystudents.Thefindingsopenthedebateontheimplementationofreadingsupportedby discussion within teacher education programs. They can also help establish indices to improve the trainingofchildrenasreadersandinterpretersofnarratives,creatingguidelinestoapproachreadingas asocialpractice.

KEY WORDS: Discussion,Narratives,Cognitivesocialization,Scaffolding,EarlyChildhoodEducation.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

265

Javier Gonzlez Garca

1. Introduccin
Contamos con un apreciable nmero de trabajos que, acogindose a distintos rtulos (anlisis de la interaccin educativa, anlisis del discurso en el aula, anlisis de las prcticas educativas), nos han familiarizado con el tipo de patrones de interaccin ms comunes (IRE, IRF), con la existencia de ciertos recursos discursivos muy extendidos (recapitulacin, reformulacin, evocacin, entre otros) o con ciertas unidades de anlisis (episodio, mensaje, actuacin, actividad, por nombrar algunas de ellas). Observamos las enormes diferencias en el modo de acometer el anlisis de las interacciones entre unos investigadores y otros (SNCHEZ & ROSALES, 2005), lo que a la postre dificulta o impide generar un cuerpo de conocimientos slido y compartido. Por supuesto, esta dispersin es comprensible. En primer lugar, es lo esperable en una primera fase en el desarrollo de un campo de conocimientos: dada la ausencia de tradiciones consolidadas, es casi inevitable que cada investigador desarrolle su propia manera de analizar unas cuestiones que han de resultar relativamente nuevas: qu tiene que ver el estudio de cmo alumnos y profesores de Educacin Infantil hablan de sus experiencias durante el fin de semana con lo que ocurre cuando hacen un clculo matemtico o leen un cuento con la ayuda de su profesor? Al menos en apariencia, las situaciones objeto de estudio son tan diferentes unas de las otras que los investigadores pueden pensar que lo que han hecho los dems no les resulta til, sintindose as inclinados a empezar de nuevo casi de cero en su intento de concebir un sistema de anlisis que se adapte a la naturaleza y caractersticas concretas de la situacin estudiada. En segundo lugar, cada uno de los tres fenmenos o situaciones mencionados hablar de las actividades del fin de semana, hacer un clculo matemtico, leer un cuento encierra una complejidad intrnseca considerable e inabarcable. Con el fin de poder hacer frente a esta complejidad, los investigadores se ven abocados a optar por uno u otro esquema bsico de anlisis de la situacin, y esta opcin implica decisiones tanto sobre las informaciones que finalmente se van a recabar como sobre su anlisis. Finalmente, hay que tener en cuenta que las metas de los investigadores pueden ser tambin muy diferentes y que esto acabar teniendo igualmente un reflejo en los procedimientos de recogida y anlisis de los datos. Hacemos sntesis de las lneas abiertas en Espaa. La primera contribucin corresponde al grupo liderado por Csar Coll, de la Universidad de Barcelona, y ofrece una panormica de los trabajos empricos desarrollados en su seno, el marco terico que ha guiado su trabajo y, por supuesto, alguna de las nociones (patrones de actuacin, segmentos de interactividad, mensajes) acuadas para abordar el anlisis de la interaccin. La segunda contribucin procede del grupo encabezado por Rosario Cubero, de la Universidad de Sevilla, y nos da la oportunidad de constatar el rico entramado de perspectivas que se anan en el anlisis de la prctica educativa, adems de mostrarnos su modo de encarar la tarea del anlisis y el tipo de resultados que pueden obtenerse. Finalmente, la tercera contribucin proviene del grupo de la Universidad de Salamanca, liderado por Emilio Snchez, que ofrece una reflexin sobre algunas opciones metodolgicas presentes en el anlisis de la prctica educativa y las consecuencias que puede tener este tipo de estudios en el desarrollo profesional de los docentes. Repasando a manera de resea histrica, comenzamos con Wood, Bruner & Ross (1976), que aportan la nocin de andamiaje que desarrolla y aplica el concepto de ZDP (VYGOTSKY, 1989). El andamiaje hace referencia a los diferentes niveles de ayuda ofrecidos por el adulto al nio en una situacin familiar, con el fin de facilitar al aprendiz la terminacin de la tarea que no habra sido capaz de resolver por s solo. A partir de este tipo de interaccin social se genera un espacio simblico o intersubjetividad (WERTSCH, 1988), en donde compartimos nuestras manifestaciones: miradas, gestos, contactos, creencias, intenciones hacia un objetivo comn: la comprensin mutua. Edwards & Mercer (1988) estudian el discurso producido en el aula desde la perspectiva del instrumento que permite la construccin del conocimiento compartido, preguntndose sobre la esencia del acto de compartir conocimiento. Introducen la nocin de reglas bsicas del discurso educacional extrayndola de los estudios sobre cognicin y cultura en Liberia, realizados por Cole, Gay, Glick & Sharp (1971); con esta nocin se refieren a las comprensiones implcitas que deben tener los que participan en la conversacin, con el objeto de dar el sentido correcto a lo que el otro est intentando expresar. El problema surge cuando las reglas para la construccin del conocimiento no se comparten o conocen, dndose los malentendidos que llevan, a veces, a pensar en fracasos individuales de los alumnos. El concepto piagetiano de conflicto sociocognitivo tiene un potencial interesante para el estudio de la actividad conjunta del aula. Pero los neopiagetianos no han estudiado la conversacin real implicada en los conflictos de ideas. Algunos de los neovygotskianos han investigado la actividad conjunta de los alumnos, tendiendo a poner de relieve la cooperacin en lugar del conflicto. Otros han

266 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

Anlisis del andamiaje en un proceso de lectura conjunta

sugerido que tener que explicar tus propias ideas a alguien con el que ests aprendiendo, al margen de su habilidad relativa, es til porque promueve el desarrollo de un tipo de comprensin ms explicito, organizado y distanciado. Pero advierten que todava carecemos de conceptos adecuados para tratar este proceso (MERCER, 1997: 100101). Los nios de cinco a seis aos son capaces de expresar sus opiniones, pero necesitan desarrollar sus destrezas a la hora de elaborarlas y argumentarlas. La revisin terica parece indicar que el aula no es necesariamente un medio que restringe la calidad y la cantidad de intercambios. La primera idea que los profesores tienen que romper para poder trabajar desde esta perspectiva es que los alumnos deben realizar un aprendizaje de tipo pasivo basado en la acumulacin de un conocimiento objetivo, que tiene como portadores a maestros o libros de texto. Esta concepcin lleva a aplicar una instruccin directa y slo despus la practica aplicada al alumno (MELERO & FERNNDEZ, 1995). Por tanto, para poder llegar a autnticas situaciones de comunicacin en el aula, que favorezcan la construccin de conocimientos nuevos mediante la investigacin y discusin de los distintos puntos de vista, el profesor debe creer en la cooperacin y tambin debe haber aprendido a ensear a interactuar, desarrollando habilidades tanto en la organizacin y direccin de la interaccin como en la participacin de los nios (DEZ VEGAS, 2002). La construccin compartida del conocimiento se elabora como un proceso de desarrollo, en el que las experiencias anteriores proporcionen las bases para dar sentido a las siguientes. Ejemplos de todo esto son las frases del tipo nosotros, reelaboraciones, resmenes, demandas de conocimientos y experiencias previas (MERCER, 1997). En este sentido es clave el concepto de Cognicin Distribuida (HUTCHINS, 2000): lo que construimos desde nios es negociado con otros y distribuido entre ellos. Llegar a saber algo es a la vez una accin distribuida y mediada. La accin situada se concibe dentro de un continuo cultural (BRUNER, 1991). Partimos en esta investigacin de que dentro del grupo de pares pueden originarse interesantes conflictos sociocognitivos, que pueden ser canalizados y coordinados en forma constructivista por las maestras. Estamos hablando de entender la discusin como comprensin compartida. Como material inicial de todo esto proponemos el cuento. Son varias las lneas revisadas que muestran cmo el cuento tradicional por s mismo acta como andamiaje introduciendo al chaval dentro de la ZDP. La contribucin de la metfora en las narraciones tiene importantes aplicaciones para el desarrollo del aprendizaje. Ocurre que la propensin natural hacia la imagen mental en su razonamiento no es paralela a una facilidad para la imagen verbal, sta toma su tiempo para desarrollarse. A partir de que los nios son capaces de desarrollar cuentos tradicionales, como oyentes y narradores, desarrollan ideas sofisticadas y abstractas en forma narrativa. Los relatos dotan de material apropiado para que los nios desarrollen esta capacidad. El relato tradicional contiene en su estructura un equivalente metafrico del andamiaje que un adulto provee mientras lee con el nio, llegando a lograr con su ayuda ms que manejndolo l solo. Los trabajos de Vygotsky, Bruner, Fox, Goodman, Dombey, Cole y Bakhtin as lo sugieren. La forma dada al relato por los narradores da el mismo soporte al nio en su relectura que la ayuda del adulto a la lectura del nio (COLLINS, 1999). Este trabajo pretende hacer una pequea contribucin en esta rea, plantendonos la coherencia entre los objetivos y los estilos docentes a la hora de llevar a cabo un proceso de puesta en discusin de lectura de cuentos en grupo reducido, en nios de cinco a seis aos. OBJETIVOS Analizar la coherencia entre los objetivos y las estrategias docentes en la construccin conjunta del conocimiento a partir de tres cuentos infantiles. Observar la evolucin de los sistemas de andamiaje que se van estableciendo. Registrar tanto los enunciados docentes como los emitidos por los alumnos.

2. Metodologa
MUESTRA La grabacin de la observacin se realiza a los mismos alumnos en el aula de cinco a seis aos, en tres tomas que coinciden con los trimestres del curso 20022003. La muestra est formada por dos clases de dos escuelas pblicas de Burgos capital, Espaa. Cada clase es dividida en 6 grupos de 3 nios. Los nios no han presentado reactividad frente a la cmara de vdeo, admitiendo la presencia de un observador ajeno a la clase.
ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

267

Javier Gonzlez Garca

La formacin de cada grupo se delega en las maestras. Ambas optan por un criterio de azar, siguiendo la lista de clase: la maestra A parte de los grupos ya existentes, la maestra B divide por la mitad los grupos de seis nios con los que ya trabaja en el aula. Pretendemos controlar el efecto del nivel de expresin y comprensin en cada nio, usando tanto grupos homogneos como heterogneos. PROCEDIMIENTO

Recogida de datos
Registramos la situacin educativa en la biblioteca del centro, sin intervencin del investigador. Se graba en vdeo cada sesin de observacin, mientras el resto de compaeros sigue trabajando en el aula ordinaria. En total han sido grabadas 36 sesiones, lo que supone un total de 7016 turnos de intervencin, de los que 5967 turnos se centran en los contenidos de los textos.

Actuacin del investigador


El investigador principal ya es conocido en las dos aulas analizadas, puesto que el curso anterior haba realizado un estudio piloto. Siempre se mantuvo al margen de la actividad. En ocasiones, acompaa en sus tareas al resto del grupo, mientras las maestras realizan la actividad de la investigacin.

Actividad
Las maestras establecen la misma actividad, en tres pasos: 1) Eleccin del texto con unos objetivos de aprendizaje. 2) Cada maestra divide la clase en grupos de tres nios. 3) Lee el texto elegido y acompaa y estructura libremente todo el proceso de discusin. La lectura previa no ha sido recogida en el anlisis, quedando abierta para otras investigaciones. A continuacin se establece una discusin, que es la parte analizada en esta investigacin. Se han eliminado los dibujos y vietas, reduciendo la lectura al texto escrito, para favorecer que los nios reaccionen nicamente a las palabras, y que las maestras aumenten el uso de distintos recursos de voz: inflexiones, cambios de ritmo y onomatopeyas, normalmente sustituidas por las pausas para mostrar cada ilustracin.

Descripcin del material: tres cuentos


La eleccin de los cuentos se ha realizado conjuntamente con las maestras. La coleccin elegida es Derechos del Nio, formada por diez libros editados por Altea en 1978, dedicados a ilustrar el declogo Los derechos del nio proclamado por la ONU en 1959. Se eligen tres cuentos, teniendo en cuenta las caractersticas narrativas que las maestras estimaron iban a captar mejor su atencin: accin, movimiento, color y animismo. PROCESO DE CATEGORIZACIN El proceso comienza por la trascripcin de las grabaciones realizadas. Se escribe literalmente el dilogo entre los nios y su maestra, indicando entre parntesis los componentes prosdicos: pausas y entonacin; y paralingsticos: gestos de afirmacin o negacin, seales con el dedo y brazos, movimientos de cabeza o corporales. Las categoras de anlisis nacen a partir de definir y operativizar una unidad de anlisis: el turno conversacional, que forma parte de una unidad molar de observacin: cada sesin de trabajo con cada grupo de tres nios. Se parte de un primer registro en forma de lista de rasgos que se sistematiza progresivamente: 1. Generamos inductivamente los criterios de observacin a partir de la revisin del material audiovisual. 2. Agrupamos estos criterios para definir las diferentes dimensiones de anlisis. 3. Volvemos a las conversaciones con esas dimensiones de anlisis para observar cmo varan internamente, y discriminamos las categoras que las componen. 4. Finalmente, compatibilizamos las dimensiones de anlisis acotando sus criterios para que las categoras de cada dimensin sean mutuamente excluyentes, mientras que las categoras de diferentes dimensiones de anlisis no lo sean. Esto permite observar su multifuncionalidad. 5. Tras la elaboracin del sistema de categoras codificamos cada una de las sesiones. Se lleva a cabo por el investigador principal junto con dos psiclogos, ajenos a la construccin de las

268 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

Anlisis del andamiaje en un proceso de lectura conjunta

categoras y a los fines de la investigacin. Es clave el acuerdo interobservadores, por lo que repetimos la codificacin de aquellas sesiones que no muestren un acuerdo ptimo. SISTEMA El sistema de categorizacin est integrado por cuatro dimensiones de anlisis. Este instrumento nos sirve para estudiar bajo diferentes perspectivas interrelacionadas cada turno de intervencin (NEWMAN, GRIFFIN & COLE, 1989). Se observa una estrecha interconexin entre las dimensiones de anlisis, pues al analizar cada una no podemos prescindir del resto:

I. BLOQUES DE CONTENIDO

II. TIPOS DE INFORMACION

IV. PROCESO DE ELABORACIN III. PARTICIPACION ESTRATEGIAS FORMATOS

1. CENTRADO

LO EXPLICITO
1. INSTRUCCIONES 2. TEXTO EXPLCITO

INICIO
1. DEMANDA 2. AFIRMACION .

LO DADO
1. REPETICIN 2. REPRODUCCIN

1. DETALLE 2. SECUENCIA 3. EPISODIO 4. SIGNIFICADO CENTRAL 5. NARRACIN COMPLETA

2. REGULACIN SOCIAL

LO IMPLCITO

LO NUEVO CONTINUACIN
3. REELABORACION 3. DEMANDA 4. APORTACIN 4. AFIRMACION

3. INFERENCIA 4. EXPERIENCIA 3. AJENO 5. IMAGINACION

6. SOLICITUD ABIERTA DE PRODUCCIN

TABLA 1: Cuadro general de dimensiones y categoras

I.

Bloques de contenido. Es el contenido bsico del enunciado, criterio inicial que responde a la pregunta a qu bloque temtico pertenece cada enunciado?

II. Tipos de informacin. Son las fuentes de partida del proceso de elaboracin de la informacin. Registramos dos tipos de informacin explcita: instrucciones y texto explcito. Y tres tipos de informacin implcita: texto implcito o inferencia, experiencia e imaginacin. III. Proceso de participacin. Es una dimensin de anlisis que sigue criterios comunicacionales. Sirve para describir la posicin de cada turno con respecto al resto de participantes: inicio o continuacin, y de llevarse a cabo, cmo lo hace: pregunta o afirma. IV. Proceso de elaboracin conjunta: estrategias y formatos. Es el proceso de creacin y produccin que emana de los tipos de informacin. Esta dimensin est formada por dos subdimensiones: estrategias, que son las acciones que permiten ir del conocimiento dado (repeticin y reproduccin) al nuevo (reelaboracin y aportacin), y formatos de elaboracin (detalle, secuencia, episodio, significado central), que son los productos de esas acciones. Este sistema se aplica por igual a maestras y alumnos, motivado por el objetivo de analizar las estrategias docentes de comunicacin como referentes para comprender el discurso infantil, defendiendo un anlisis conjunto del proceso de enseanza y aprendizaje:

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

269

Javier Gonzlez Garca

La lectura horizontal entre las distintas dimensiones recoge la pluralidad de variables que se entrecruzan en el debate postnarrativo analizado (COLL & ONRUBIA, 1996: 59). Las cinco dimensiones de anlisis se unen en un mismo proceso. La lectura en sentido vertical nos ayuda a concretar, estableciendo niveles en cada una de las cinco dimensiones de anlisis.

CONTRASTE: ENTREVISTA A LAS MAESTRAS Al finalizar la observacin nos propusimos constatar los puntos de partida docentes en cada grupo. Para ello realizamos una entrevista al finalizar el proceso de observacin. En el primer bloque analizamos los estilos docentes en el uso de la discusin y la narracin. En el segundo recogemos los objetivos que se han marcado. Y en el tercero observamos sus valoraciones sobre el desempeo propio y el de sus alumnos.

MAESTRA A 1. Objetivo general Observar la comprensin que los nios tienen tras la lectura del cuento, y su evolucin a lo largo de los tres trimestres. Evolucin de la comprensin por medio de la expresin oral.

MAESTRA B

Observar la evolucin de la expresin oral de sus alumnos y sus niveles de comunicacin.

2. Objetivos especficos Desarrollar la capacidad de escucha. Reparto del discurso, a travs de una regulacin social que busca la simetra de turnos de intervencin. Promover la interaccin social, especialmente el respeto de turnos y el desarrollo de la capacidad de escucha. Iniciar la autonoma en la participacin, para que cada nio pueda manifestarse libremente, sin que haya repeticin de los mismos contenidos y aportaciones al tener que justificar por qu lo ha dicho. La comprensin del texto es un objetivo secundario. 3. Objetivos alcanzados Guiar una secuenciacin temporal a partir de la lectura previa, generando un seguimiento lgico de las distintas secuencias que componan cada cuento. Partiendo de su madurez expresiva, que cada nio sea capaz de dar con el detalle que llama su atencin, o con la secuencia ms relevante para la comprensin. Este es el verdadero trabajo de indagacin de la maestra. Lograr una mayor fluidez verbal en los nios. Descubrir el respeto de las normas de la conversacin de una forma ldica y diferente. Comprobar cmo los nios son capaces de escucharse y de respetar el turno. Mejora y ampliacin de su vocabulario. Correccin y revisin del estado actual del habla de sus alumnos. Conocer qu es lo que ms gusta a cada nio. Observar una interaccin entre iguales. Confirmar la posibilidad de justificar la propia respuesta y la de otros.

270 ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

Anlisis del andamiaje en un proceso de lectura conjunta

4. Observaciones Lo que hemos llevado a cabo es un aspecto,

comprensin y expresin, pero hay otros muchos.


Lo que hemos hecho no daba pie a otro objetivo,

La comprensin del texto ha sido secundaria, centrndonos en detalles. Me importa, ante todo, que los nios hablen. Puede ser que las preguntas muy abiertas han

lea el cuento ejercitando su capacidad de escucha, para poder despus expresar lo que han comprendido.
Ah se notaba cmo algunos nios que

podido conducirles a perderse sobre detalles, de sus experiencias de vidas, con poca importancia para el desarrollo del cuento.

expresaban detalles sobre lo ya dicho, o los que dicen lo primero se les pasa por la cabeza, sin pararse a pensar en el antes o despus, es decir, con la incapacidad de ver la estructura del cuento. El resto de cosas no lo hemos trabajado, ah lo cortbamos.

TABLA 2: Entrevista Objetivos marcados por las maestras

Resultados y discusin
Entramos en la revisin de las categoras que constituyen cada una de esas dimensiones. BLOQUES DE CONTENIDO

1 00 % 90% 80% 70% 60% 50% 40% 30% 20% 10% 0%


C EN T R A D O R EG U LA C IO N S O C IA L A JE N O

G RUP O A

GRU PO B

GRFICO :1 Bloques de contenido

Decamos que los bloques de contenido es el filtro para cribar los turnos de intervencin que estn centrados en el cuento, discriminando las primeras diferencias entre las maestras. La maestra A se centra en el desarrollo del texto del cuento, teniendo un menor porcentaje de turnos dedicados a su regulacin social que la B. Los nios tienen el texto como nico eje de referencia, sabiendo a qu atenerse en el desarrollo de la actividad discursiva. Mientras que la maestra B tiene un considerable porcentaje de turnos con contenidos ajenos a la lectura, 7,8% en la maestra y 12,7% en los nios, posiblemente debido a que produce demandas con contenidos muy abiertos, mientras en el grupo A apenas aparece este bloque de contenido ajeno. En cuanto al bloque regulacin social, el grupo B dedica un mayor porcentaje de turnos que el grupo A, posiblemente debido al desarrollo de una tarea de discusin ms abierta y cambiante propuesto por la maestra B, y a su objetivo de promover la interaccin social, especialmente el respeto de turnos y el desarrollo de la capacidad de escucha.

ISSN 15750965 Revista Electrnica Interuniversitaria de Formacin del Profesorado, 13 (4), 265281

271

Javier Gonzlez Garca

TIPOS DE INFORMACIN

GRFICO 2: Tipos de informacin

Observamos en el grfico 2 cmo la maestra A se centra en la informacin explcita del cuento, y a partir de un uso creciente de inferencias reconstruye la informacin implcita, es decir, lo que subyace al texto, informacin que estaba ah pero no era manifiesta para el nio sin la ayuda de la maestra. De esta manera, los nios tienen el texto como eje constante de referencia, sabiendo ms fcilmente a qu atenerse en el desarrollo de la actividad discursiva. La meta es clara, se sita en comprender la lectura previa y en expresar esa comprensin. En contraste, la maestra B tiene un registro ms amplio de tipos de informacin, llegando a mezclar el texto explcito con otros tipos de informacin implcita, acudiendo al texto y fuera de l. Lo implcito no nace directamente de lo explcito a partir de inferencias, ms bien como su reflejo indirecto. El texto queda en segundo plano, y cede el protagonismo a experiencias personales relacionadas y a ejercicios de proyeccin sobre los conflictos y desafos que ha suscitado el texto. Las metas son muy abiertas y se sitan en la expresin y valoracin de enunciados durante una discusin. La instruccin que demanda ajustarse sin ms al cuento puede no surtir efecto. La maestra B est continuamente retomando las directrices de la actividad, al dejarla siempre abierta. Se muestra tanto