Está en la página 1de 428

El desarrollo psicolgico

a lo largo de la vida
El desarrollo psicolgico
a lo largo de la vida
Coordinadores
Sonia Mariscal
Marta Gimnez-Das
Nuria Carriedo
Antonio Corral
MADRID BOGOT BUENOS AIRES CARACAS GUATEMALA LISBOA MXICO
NUEVA YORK PANAM SAN JUAN SANTIAGO SO PAULO
AUCKLAND HAMBURGO LONDRES MILN MONTREAL NUEVA DELHI PARS
SAN FRANCISCO SIDNEY SINGAPUR ST. LOUIS TOKIO TORONTO
ELDESARROLLOPSICOLGICOALOLARGODELAVIDA
No est permitida la reproduccin total o parcial de este libro, ni su tratamiento
informtico, ni la transmisin de ninguna forma o por cualquier medio, ya sea
electrnico,mecnico,porfotocopia,porregistrouotrosmtodos,sinelper miso
previoyporescritodelostitularesdelCopyright.
DirjaseaCEDRO(CentroEspaoldeDerechosReprogrfcos,www.cedro.org)si
necesitafotocopiaroescanearalgnfragmentodeestaobra.
DERECHOS RESERVADOS 2009, respecto a la primera edicin en espaol, por
McGRAW-HILL/INTERAMERICANADEESPAA,S.A.U.
EdifcioValrealty,1.planta
Basauri,17
28023Aravaca(Madrid)
ISBN:978-84-481-7128-5
Depsitolegal:M.
Editor:CristinaSnchezSinz-Trpaga
Diseodecubierta
Compuestoen:GrfcasBlanco,S.L.
Impresoen:
IMPRESOENESPAA-PRINTEDINSPAIN
CoedicinconlaUniversidadNacionaldeEducacinaDistancia(UNED)
:Tropart,S.L.L.
Autores
NuriaCarriedoLpez
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
AntonioCorraligo
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
BegoaDelgadoEgido
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
MarangelesGarcaNogales
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
MartaGimnez-Das
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
SoniaMariscalAltares
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
InmaculadaSnchezQueija
DepartamentodePsicologaEvolutivaydelaEducacin
FacultaddePsicologa
UNED
vii
Contenido
ix
Prefacio.................................................................................................................................. xv
Introduccin
Captulo 1. El estudio del desarrollo humano: fundamentos
y principales enfoques tericos . ............................................................................. 3
1. IntroduccinalaPsicologadelDesarrollo............................................................. 7
2. PresupuestostericosyconceptosfundamentalesenlaPsicologadelDesarrollo 9
3. Lospresupuestosseexpresanenteoras.................................................................. 11
4. Lasgrandesteorasdeldesarrollohumano:PiagetyVygotski............................... 12
4.1. Lateorapiagetiana......................................................................................... 12
4.2. Lagnesissocialdelaconciencia:lateoradeVygotski.............................. 24
4.3. ComparacinentrelasteorasdePiagetyVygotski...................................... 36
5. Amododeconclusin:eldesarrollohumanoensuconjunto................................. 37
Lecturascomplementarias............................................................................................... 38
Actividades...................................................................................................................... 39
Solucionesalasactividades............................................................................................ 40
Bloque I
El desarrollo temprano
Captulo 2. El desarrollo cognitivo del beb.............................................................. 45
Introduccin..................................................................................................................... 47
1. Elrecinnacido........................................................................................................ 47
1.1. Estadosyritmos.............................................................................................. 49
1.2. Sistemaspararecibirinformacin:lossentidos............................................. 50
1.3. Sistemasparaactuarenelmundo:losrefejos............................................... 51
1.4. Sistemasparatransmitirinformacin:elllantoylasonrisa.......................... 53
1.5. Elcerebrodelrecinnacido........................................................................... 54
2. Lascapacidadesperceptivasdelbeb...................................................................... 56
2.1. Lapercepcinvisual....................................................................................... 57
2.2. Lapercepcinauditiva.................................................................................... 63
2.3. Elolfato,elgustoyeltacto............................................................................ 66
2.4. Lapercepcinintermodal............................................................................... 67
3. Laexplicacinpiagetianadelperodosensoriomotor............................................. 70
Lecturascomplementarias............................................................................................... 77
Actividades...................................................................................................................... 77
Solucionesalasactividades............................................................................................ 79
x Contenido
Captulo 3. Los inicios de la comunicacin y el lenguaje....................................... 81
Introduccin..................................................................................................................... 83
1. Comunicacinylenguaje......................................................................................... 83
1.1. Defnicindeconceptos.................................................................................. 83
1.2. Componentesdellenguaje.............................................................................. 85
2. Desarrollotempranodelacomunicacin:delnacimientohastalos18meses....... 86
2.1.Cundocomienzalacomunicacinintencional?Requisitoscognitivosyso-
ciales................................................................................................................ 86
2.2. El papel del adulto: sobreinterpretacin de las actividades del nio como
conductasgenuinamentecomunicativas......................................................... 90
2.3. Principaleshitoseneldesarrollocomunicativoduranteelprimeraoyme-
diodevida....................................................................................................... 92
2.3.1. Faseneonatalycomunicacindeafectos(2-3meses)...................... 92
2.3.2. Lamitaddelprimerao:conductasanticipatorias............................ 93
2.3.3. Elperodode8a12meses:eliniciodelaconductaintencional..... 94
2.3.4. Elperodode12a18meses:gestoscomunicativosyvocalizaciones.. 95
3. Desarrollotempranodellenguaje:delnacimientohastalos3aos....................... 96
3.1. Atencintempranaallenguaje....................................................................... 97
3.2. Lapercepcininicialdelhabla....................................................................... 98
3.3. Hacialasprimeraspalabras............................................................................ 100
3.4. Eliniciodeldesarrollogramatical.................................................................. 103
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre
lapolmica................................................................................................................ 104
Lecturascomplementarias............................................................................................... 106
Actividades...................................................................................................................... 106
Solucionesalasactividades............................................................................................ 108
Captulo 4. Desarrollo afectivo, emocional y social................................................. 111
Introduccin..................................................................................................................... 113
1. Aproximacinhistricaalestudiodelapego........................................................... 114
1.1. Lainvestigacinconanimalesyladeprivacinafectiva............................... 114
2. Formacindelapego................................................................................................ 116
2.1. Laorientacinsocialyemocionaldelbebenelmomentodelnacimiento.. 117
2.1.1. Lasprimerasexpresionesemocionalesdelbeb............................... 118
3. Desarrollodelapego................................................................................................. 121
4. Tiposdeapego.......................................................................................................... 123
5. Factoresqueafectanalaformacindelvnculodeapego...................................... 125
6. Loselementosdelvnculodeapego........................................................................ 126
7. Estabilidaddelvnculodeapego.............................................................................. 127
Lecturascomplementarias............................................................................................... 129
Actividades...................................................................................................................... 129
Solucionesalasactividades............................................................................................ 130
Bloque II
El desarrollo durante la primera infancia
Captulo 5. El desarrollo del pensamiento.................................................................. 135
Introduccin..................................................................................................................... 137
Contenido xi
1. ElniopequeoenlateoradePiaget..................................................................... 138
1.1. Losrasgosdelpensamientopreoperatorio..................................................... 139
1.2. AlgunaslimitacionesdelateoradePiaget................................................... 145
2. ElniopequeoenlateoradeVygotski................................................................ 147
3. Lateoradelamente................................................................................................ 150
3.1. Laatribucindecreenciasfalsas.................................................................... 151
3.2. Habilidadesmentalistasanterioresalacomprensindecreenciasfalsas..... 155
4. Conclusiones............................................................................................................. 156
Lecturascomplementarias............................................................................................... 156
Actividades...................................................................................................................... 157
Solucionesalasactividades............................................................................................ 158
Captulo 6. El desarrollo del lenguaje oral................................................................. 161
Introduccin..................................................................................................................... 163
1. Eldesarrollodelaformadelenguajedurantelaprimerainfancia......................... 164
1.1. Desarrollofonolgico:cmosevacompletandolaadquisicindelsistema
defonemas....................................................................................................... 164
1.2. Desarrollodelvocabularioydesarrollogramatical........................................ 166
2. Eldesarrollopragmticoylashabilidadesparanarrar............................................ 169
3. Lasrelacionesentreelpensamientoyellenguajedesdelaperspectivaevolutiva. 173
4. Cmoseexplicalaadquisicindellenguaje:modeloslingsticosinnatistasyex-
plicacionesconstructivistas...................................................................................... 175
5. Aprenderellenguajeencontextosbilinges........................................................... 178
5.1. La importancia de los perodos crticos: por qu es mejor aprender las
lenguasdesdepequeos?................................................................................ 180
5.2. Ventajasdelbilingismo:enqucondicionestieneconsecuenciaspositivas
paraeldesarrollogeneral?.............................................................................. 181
Lecturascomplementarias............................................................................................... 184
Actividades...................................................................................................................... 185
Solucionesalasactividades............................................................................................ 186
Captulo 7. El mundo social de 3 a 6 aos.................................................................. 189
Introduccin..................................................................................................................... 191
1. Eldesarrollodelyo................................................................................................... 192
2. Elmundoemocionalyafectivo................................................................................ 195
3. Lasrelacionesconlosdems................................................................................... 198
3.1. Lafamilia........................................................................................................ 198
3.1.1. Losestiloseducativos......................................................................... 198
3.2. Losamigos...................................................................................................... 200
3.2.1. El ajuste en las relaciones sociales: nios queridos y nios recha-
zados................................................................................................... 203
4. Eljuego..................................................................................................................... 206
5. Laidentidaddegnero............................................................................................. 209
6. Elpensamientomoral............................................................................................... 212
6.1. Laintencionalidadylaresponsabilidadobjetiva........................................... 213
6.2. Lamentira....................................................................................................... 214
6.3. Lajusticiainmanenteyretributiva................................................................. 214
Lecturascomplementarias............................................................................................... 215
Actividades...................................................................................................................... 216
Solucionesalasactividades............................................................................................ 217
xii Contenido
Bloque III
El desarrollo durante la etapa escolar y la adolescencia
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta
los 11 aos.................................................................................................................... 223
Introduccin..................................................................................................................... 228
1. Desarrollocognitivo................................................................................................. 230
1.1. Eldesarrollodelrazonamiento:lallegadadelalgicaoperacional.............. 230
1.1.1. Eldesarrollodelanocindeconservacin....................................... 230
1.1.2. Eldesarrollodelaclasifcacin,laseriacinylanocindenmero 233
1.1.3. Eldesarrollodelasnocionesespacio-temporales............................. 236
1.1.4. Estudiosdereplicacinsobrelasoperacionesconcretas.................. 239
1.2. Eldesarrollodelaatencinydelamemoria................................................. 239
1.2.1. Eldesarrollodelaatencin................................................................ 242
1.2.2. Eldesarrollodelafuncinejecutivaydelamemoriaoperativa...... 242
2. Desarrolloemocionalysocial.................................................................................. 245
2.1. Adquisicindelacompetenciaemocional..................................................... 245
2.2. Elmundodelasrelaciones............................................................................. 249
2.2.1. Lainfuenciadelapegoeneldesarrollopsicolgicoposterior......... 249
2.2.2. Lasrelacionesconlosiguales............................................................ 253
2.3. Eldesarrollomoral.......................................................................................... 255
Lecturascomplementarias............................................................................................... 258
Actividades...................................................................................................................... 259
Solucionesalasactividades............................................................................................ 262
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera
juventud........................................................................................................................ 263
Introduccin..................................................................................................................... 265
1. Lallegadadelpensamientoformal.......................................................................... 265
2. CrticasalavisindePiaget.................................................................................... 270
3. Cambioscognitivosysensacionesadolescentes...................................................... 274
Lecturascomplementarias............................................................................................... 277
Actividades...................................................................................................................... 278
Solucionesalasactividades............................................................................................ 279
Captulo 10. El desarrollo socio-emocional del adolescente................................. 281
Introduccin..................................................................................................................... 283
1. Modelodecambioindividual:lateoradeErikson................................................. 284
1.1. Losestatusdeidentidad:J.Marcia................................................................. 285
2. Autoconceptoyautoestima...................................................................................... 286
2.1. Autoconcepto................................................................................................... 286
2.2. Laautoestima.................................................................................................. 287
3. Relacionesfamiliares................................................................................................ 288
3.1. Elmitodeloscontinuosconfictosfamiliares................................................ 288
3.2. Continuidad entre las relaciones familiares en la infancia y en la adoles-
cencia............................................................................................................... 290
4. Relacionesconlosiguales........................................................................................ 291
4.1. Laamistadntimaenlaadolescencia............................................................. 292
Contenido xiii
4.1.1. Laamistadyotrasrelacionescercanas.............................................. 293
4.2. Lainfuenciadelosamigos............................................................................ 295
4.3. Relacionesdeparejaysexuales...................................................................... 296
4.3.1. Lasrelacionesdepareja..................................................................... 296
4.3.2. Lasrelacionessexuales...................................................................... 298
Lecturascomplementarias............................................................................................... 301
Actividades...................................................................................................................... 301
Solucionesalasactividades............................................................................................ 301
Bloque IV
El desarrollo durante la edad adulta y la vejez
Captulo 11. El desarrollo psicolgico durante la vida adulta y la vejez........... 305
Introduccin..................................................................................................................... 308
1. Lastareasdelavidaadulta.................................................................................... 308
2. Losavancescognitivosdurantelavidaadultaylavejez..................................... 310
3. Losavancesenelcampodelavidapersonal....................................................... 311
4. Eldesarrolloepistemolgicodurantelavidaadulta............................................. 312
5. Loshechosylasteoras......................................................................................... 315
6. Elmbitodelafamilia.......................................................................................... 316
7. Varonesymujeresenlavidafamiliar................................................................... 317
8. Laviolenciaenlafamilia...................................................................................... 318
9. Matrimonio,confictoyseparacin....................................................................... 318
10. Eladultoenelmundoactual................................................................................. 320
Lecturascomplementarias............................................................................................... 322
Actividades...................................................................................................................... 322
Solucionesalasactividades............................................................................................ 323
Bloque V
Dicultades de desarrollo
Captulo 12. Dicultades del desarrollo a lo largo de todo el ciclo vital.......... 327
Introduccin..................................................................................................................... 330
1. Problemasdeldesarrolloprovocadosporcausassensoriales:cegueraysordera... 331
1.1. Laceguera....................................................................................................... 332
1.2. Lasordera........................................................................................................ 334
2. Trastornosdeldesarrolloprovocadosporcausasneurobiolgicas.......................... 335
2.1. Autismo........................................................................................................... 335
2.2. SndromedeDown(SD)................................................................................. 336
2.3. ElsndromedeWilliams................................................................................. 337
2.4. Trastornopordfcitdeatencinconhiperactividad(TDAH)...................... 338
3. Difcultadesdeldesarrolloenlainfancia................................................................. 338
3.1. Problemasasociadosadfcitsemocionalesdurantelainfancia:ladepresin
anacltica.......................................................................................................... 338
3.2. Problemasenlarelacinconlosiguales:rechazosocialymaltratoescolar.. 339
3.3. Problemasenlafamilia:maltratoinfantilydivorciodelospadres.............. 340
3.3.1. Elmaltratoinfantil.............................................................................. 340
3.3.2. Eldivorciodelospadres.................................................................... 342
xiv Contenido
4. Difcultadesdeldesarrolloenlaadolescencia......................................................... 345
4.1. Depresinysuicidiodurantelaadolescencia................................................. 345
4.2. Comportamientoantisocial............................................................................. 347
4.3. Consumodedrogas......................................................................................... 349
5. Difcultadesdeldesarrolloenlavidaadultayenlavejez...................................... 349
5.1. Laviolenciaenlafamilia............................................................................... 349
5.2. Lascrisisdelaedadadulta............................................................................. 352
5.2.1. Lascrisisdeidentidad........................................................................ 352
5.2.2. Separacinydivorcio......................................................................... 355
5.2.3. Menopausiayclimaterio.................................................................... 357
5.3. Trastornosneurobiolgicos:lasdemencias.................................................... 358
Lecturascomplementaria................................................................................................. 359
Actividades...................................................................................................................... 359
Solucionesalasactividades............................................................................................ 362
Glosario.................................................................................................................................. 365
Referencias............................................................................................................................ 389
Prefacio
xv
El desarrollo psicolgico a lo largo de la vida es una obra cuyo objetivo es ofrecer al
lector-alumnounpanoramaactual,peroalavezcomprensibleyasequible,sobrelaevo-
lucinpsicolgicadelserhumanodesdesunacimiento(oinclusoantes)hastaelfnalde
lavida.
LaPsicologaEvolutivaoPsicologadelDesarrolloesunadisciplinacomplejaque
pretendeabarcarlosprincipalesprocesosdedesarrolloquetienenlugardurantetodoel
ciclo vital, del nacimiento hasta la muerte. En los ltimos cincuenta aos, la evolucin
deestadisciplinahasidoespectacular,noslodesdeelpuntodevistadesusaportaciones
tericas,sinoporlamultituddeinformacinsobrelosprocesosdedesarrolloquehanido
proporcionandolosdistintosinvestigadoresenestarea.Unadelasconsecuenciasdeeste
crecimientotanimportantesehamaterializadoenelestudiodeldesarrolloescindidoo
divididoenlasreasquetradicionalmentelocomponen(p.ej.,desarrollosintelectualo
cognitivo,lingstico,afectivoysocial).Deestemodo,cadainvestigadortiendeaespe-
cializarse en una faceta del desarrollo o incluso en problemas concretos dentro de un
mismoprocesoevolutivo.Anteestepanorama,sehantenidoqueadoptardosdecisiones
importantes de cara a la seleccin de los contenidos a ofrecer a nuestros lectores. En
primer lugar, se ha optado por una organizacin evolutiva de los contenidos y no por
temas o reas de desarrollo. Es decir, no se presenta el desarrollo cognitivo-lingstico
porunladoyeldesarrolloemocionalyafectivoporotro,comoeshabitualenmuchos
delosmanualesdePsicologaEvolutiva.Ellectorencontrarelcontenidoorganizadoen
bloques relativos a las distintas etapas del desarrollo: el desarrollo temprano (del naci-
mientohastalos2aosaproximadamente),eldesarrollodurantelaprimerainfancia(de
los3alos6aos),eldesarrollodurantelaetapaescolarylaadolescenciay,fnalmente,
eldesrrollodurantelavidaadultaylavejez.Dentrodecadabloquessehandiferencia-
dolosdistintosprocesosdedesarrollo(cognitivo,lingstico,afectivoysocial).Elobje-
tivoesquetraslalecturayestudiodeloscaptulos,ellectorseacapazdeelaborarcmo
cursaeldesarrolloensusdistintasfacetasdentrodecadaetapay,sobretodo,seacapaz
deencontrarlasrelacionesentreunasyotras.Enestesentido,sehahechounesfuerzo
especialporconectarunosprocesosdedesarrolloconotrosmedianteelusodereferencias
cruzadasentrelosdistintoscaptulosylapresentacindeejemplosydatossobreelde-
sarrolloquerevelanesasinterconexiones.
Lasegundadecisinimportanterelativaaqucontenidospresentarserelacionacon
los modelos tericos sobre el desarrollo. Como apuntbamos ms arriba, el panorama
tericoenlaPsicologadelDesarrolloesmuyvariadoycomplejo.Dadoeltipodelector
xvi Prefacio
aquienvadirigidalaobra,noshaparecidomsconvenientepresentarenunprimerca-
ptulolasteorasclsicassobreeldesarrolloyprescindirdelasaportacionesmsrecien-
tes. Por eso, en dicho captulo (Captulo 1) se presentan los dos modelos tericos ms
elaborados y con mayor impacto en nuestra rea hasta la fecha: la teora de J. Piaget,
cuyospresupuestosfundamentalesanseencuentranplenamenteenvigor,apesardelas
crticasamuchosaspectosconcretosdelateora;ylapropuestadeL.Vygotskiysues-
cuela,quehadadolugaratodaunacorrientetericaposterioryadesarrollosmuchoms
profundosdelosesbozadosporsuiniciador.Posteriormente,ydentrodecadacaptulo
concreto,semencionandistintasexplicacionesyteorasmsrecientes,peromscircuns-
critasareasespecfcasdeldesarrollo(porejemplo,lateoradelamente,olasaproxi-
macionesinnatistassobreeldesarrollodellenguaje).Adems,lavisindeldesarrolloque
seofrecealolargodeloscaptulosdedicadosalasdistintasetapasdelmismo(Captu-
los2a11)secomplementaconunltimocaptulo(Captulo12)queofreceunamirada
alasdifcultadesotrastornosquepuedenpresentarsealolargodetodoelciclovital.
Enrelacinalapresentacinconcretadeloscontenidos,sehapretendidotenersiem-
pre presente la condicin del alumno de la UNED, que suele organizar su estudio de
forma individual y con el manual de la asignatura como referente bsico. No obstante,
cualquier lector puede benefciarse del estilo del texto y de las ayudas proporcionadas.
Lainclusindeejemplosycasosprcticos,decuadros,esquemasyfgurascomplemen-
tariossehaconsideradounaherramientafundamentalparahacermscomprensibleslos
contenidosymotivarallectorasuestudioydisfrute.Enespecial,loscuadrosquehemos
tituladoConlospiesenlatierraconstituyenaplicacionesoejemplosprcticosdelas
cuestionestericasreferidaseneltexto.Todosloscaptulosestnorganizadossegnun
mismoesquemaqueincluyelossiguientesapartados:ttulo,ndicedecontenidos,esque-
ma-resumen, objetivos, texto del captulo, bibliografa complementaria, actividades y
solucinalasmismas.Enlamedidaenqueellectorseacapazdeconstruirsuspropias
elaboracionesdelostemas,conectarunoscontenidosconotros,hacersepreguntasapar-
tirdeltexto,buscaralgunasrespuestasporsucuenta,etc.,elresultadodesuestudioser
mssignifcativo,profundoyduradero.
Laintencindelosautoresdeestevolumenhasidoladeproporcionaralalumnouna
visindeldesarrollohumanoquelesirvacomobaseparaentendercmosomos,cmo
nosconstituimosycmoesteconocimientoesunaclavebsicaparacualquierintentode
intervenir,educarofomentarundesarrolloajustado.
El estudio del desarrollo
humano: fundamentos
y principales enfoques
tericos 1
NURIA CARRIEDO
ANTONIO CORRAL
Los fundamentos
de la Psicologa
del desarrollo 1
ANTONIO CORRAL IGO
INTRODUCCIN
En este primer captulo se van a abordar cuestiones tericas sobre el estudio del desarrollo
humano. El objetivo es introducir nuestra disciplina a partir de los conceptos bsicos que la
ordenan, de las races loscas que la impregnan y de los grandes marcos tericos que se
suelen emplear para explicar el desarrollo humano. Hemos escogido las teoras de Piaget y
Vygotski porque consideramos que constituyen los dos grandes pilares de la psicologa del
desarrollo. Sus teoras se explican en el Captulo 1 y las referencias a sus formulaciones sern
constantes a lo largo de todo el libro.
El estudio del desarrollo
humano: fundamentos
y principales enfoques
tericos
3
1
NURIA CARRIEDO
ANTONIO CORRAL
Esquema-resumen
Objetivos
Introduccin
1. Introduccin a la Psicologa del Desarrollo
2. Presupuestos tericos y conceptos fundamentales en la Psicologa del Desarrollo
Racionalismo
Asociacionismo
Constructivismo
3. Los presupuestos se expresan en teoras
4. Las grandes teoras del desarrollo humano: Piaget y Vygotski
4.1. La teora piagetiana
El desarrollo como preocupacin epistemolgica
Los estadios de desarrollo
Los factores del desarrollo: el desarrollo como autorregulacin de
estructuras
Implicaciones educativas de la teora piagetiana
4.2. La gnesis social de la conciencia: la teora de Vygotski
La gnesis social de los procesos psicolgicos superiores
La internalizacin como gnesis de la representacin y de la conciencia
Mediacin semitica
La zona de desarrollo prximo (ZDP)
La explicacin del cambio
Implicaciones educativas de la teora vygotskiana
4.3. Comparacin entre las teoras de Piaget y Vygotski
5. A modo de conclusin: el desarrollo humano en su conjunto
Lecturas complementarias
Actividades
Soluciones a las actividades
4 Introduccin
Esquema-resumen
1. Introduccin a la Psicologa del Desarrollo
Su objeto de estudio es el desarrollo del ser humano a lo largo del ciclo vital.
La Psicologa Evolutiva actual est muy inuida por la revolucin cognitiva que tuvo
lugar en la psicologa general en los aos sesenta del siglo XX, sobre todo en lo relativo
a la consideracin de los factores internos como responsables de la conducta. Tambin
ha recibido inuencias de las neurociencias, de la biologa, la etologa, la ecologa, la
antropologa o la sociologa.
Nuestra disciplina todava no ha alcanzado la madurez requerida debido a la exis-
tencia de dualismos u oposiciones tericas que no alcanzan la sntesis y la integracin
necesarias. Entre ellos destacan: 1) la contribucin de la herencia frente al medio am-
biente; 2) desarrollo frente a aprendizaje; 3) inteligencia general frente a inteligencia
emocional; 4) lo individual frente a lo social.
Estos dualismos se producen porque se parte de presupuestos diferentes, esto es, de
ideas bsicas, muchas veces intuitivas, en torno al origen y a la posibilidad del conocimien-
to que han sufrido pocos cambios a lo largo de la historia de la Filosofa. De ah la nece-
sidad de analizar cmo se maniestan y se expresan en las distintas teoras del desarrollo.
2. Presupuestos tericos y conceptos fundamentales en la Psicologa del Desa-
rrollo
Hay tres grandes marcos generales de carcter losco que inspiran el estudio del de-
sarrollo humano: el racionalismo, de carcter innatista; el asociacionismo, de carcter
empirista y ambientalista; y, por ltimo, el constructivismo, que se centra en la interac-
cin dialctica entre los propios procesos del sujeto que evoluciona y el medio.
3. Los presupuestos se expresan en teoras
A partir de los marcos generales de carcter losco y sirvindose del mtodo cient-
co se construyen y se elaboran teoras que tratan, por una parte, de describir el desa-
rrollo humano y por otra, de explicar las causas y predecir los hechos principales del
desarrollo humano.
Hay que tener en cuenta que no hay hechos cientcamente neutrales o puros,
puesto que las presuposiciones nos sesgan en gran medida lo que vamos a observar.
La historia de la ciencia en general, y de la Psicologa en particular, reeja en gran
medida el peso de los distintos presupuestos, las tensiones originadas entre ellos y los
conictos o revoluciones que se han suscitado cuando en cierto modo se superan y
se adoptan otros nuevos.
4. Las grandes teoras del desarrollo humano: Piaget y Vygotski
4.1. La teora piagetiana
El desarrollo como preocupacin epistemolgica. El desarrollo de la inteligencia est li-
gado al desarrollo del conocimiento, es decir, a cmo el sujeto va tomando conciencia
de forma progresiva de los objetos fsicos y sociales que le rodean a partir de la accin
directa con ellos en las primeras etapas del desarrollo y de las operaciones menta-
les (acciones interiorizadas) en las etapas ms avanzadas.
Los estadios del desarrollo:
Piaget distingue tres grandes perodos en el desarrollo de la inteligencia: el pe-
rodo sensoriomotor, el perodo de la inteligencia representativa que conduce a
Captulo 1. El estudio del desarrollo humano 5
las operaciones concretas, y el perodo de las operaciones proposicionales o for-
males.
El orden de aparicin de los estadios es secuencial y jo, igual para todos los in-
dividuos y, por tanto, de carcter universal. Sin embargo, pueden existir ligeras
variaciones en cuanto a la edad en que se maniestan. Los estadios estn inte-
grados jerrquicamente; es decir, los nuevos estadios de pensamiento incluyen a
las estructuras precedentes.
Los factores del desarrollo:
Cada una de las estructuras o formas de pensamiento que caracterizan cada uno
de los estadios del desarrollo son producto de diversos factores: maduracin bio-
lgica, interaccin con el mundo fsico y social y, sobre todo, la equilibracin o
autorregulacin activa.
Mediante el proceso de autorregulacin o coordinacin interna de las estructuras
se produce un equilibrio entre los procesos de asimilacin y acomodacin que
conlleva la adaptacin del organismo al medio.
Implicaciones educativas de la teora piagetiana:
Lo que el nio puede aprender o comprender en un determinado momento del
desarrollo depende del estadio de desarrollo en el que se encuentre. Esto se con-
creta en tres tipos de prescripciones educativas: 1) no se debe tratar de ensear
a los alumnos contenidos que estn por encima de su nivel de desarrollo; 2) los
profesores deben tratar de promover pero no acelerar el nivel de desarrollo; por
tanto, deben centrarse en el dominio de tareas adecuadas al nivel de desarrollo
de los alumnos, y 3) la secuenciacin de la enseanza de conceptos nuevos de-
bera seguir el mismo orden de aparicin natural de los conceptos en el curso del
desarrollo.
Dado que desde la teora piagetiana se postula que las acciones con los objetos
directas o interiorizadas son la base del conocimiento, las actividades de
enseanza-aprendizaje deberan potenciar la accin y la experimentacin de los
nios, lo que se ha denominado aprendizaje por descubrimiento.
La interaccin con los iguales puede potenciar el aprendizaje al permitir que el
nio confronte sus propios puntos de vista con los de los dems. Esta confron-
tacin entre distintos puntos de vista se ha denominado conicto socio-cognitivo.
4.2. La gnesis social: la teora de Vygotski
La gnesis social de los procesos psicolgicos superiores. Vygotski diferencia dos
lneas de desarrollo: la lnea natural, asociada a las funciones psicolgicas elemen-
tales y la lnea cultural, vinculada a las funciones psicolgicas superiores, propias
de la especie humana. La lnea cultural se caracteriza por el uso de instrumentos
de mediacin.
Ley gentica general del desarrollo cultural o ley de la doble formacin. Toda
funcin psicolgica aparece dos veces: primero, a nivel social, y ms tarde, a nivel
individual. Las funciones psicolgicas no son una simple copia interna de los pro-
cesos sociales, sino que estos procesos han de recrearse, reconstruirse de nuevo
en el plano intrapsicolgico, a travs del proceso de internalizacin.
Mediacin semitica:
La interaccin social con los dems proporciona al individuo un conjunto de
herramientas o signos que actan como mediadores de su actividad. Entre ellas
6 Introduccin
destacan: el lenguaje, los sistemas numricos, las estrategias mnemotcnicas,
el dibujo, o las representaciones grcas.
Estas herramientas psicolgicas no son slo medios auxiliares para realizar cier-
tas funciones psicolgicas, sino que tienen la propiedad de modicar el funcio-
namiento mental al provocar en l cambios cualitativos.
El papel del lenguaje. El lenguaje comienza siendo el medio a travs del cual
se materializa la regulacin externa del comportamiento (a travs del lenguaje
de los otros); durante la transicin al plano intrapsicolgico se convierte en el
vehculo de mediacin por excelencia; y, nalmente, se acaba convirtiendo en
un instrumento de autorregulacin del pensamiento.
La zona de desarrollo prximo (ZDP). El estado del desarrollo mental de un nio
puede determinarse nicamente si se lleva a cabo una claricacin de sus dos
niveles: del nivel real de desarrollo y de la zona de desarrollo prximo.
El nivel evolutivo real es lo que permite al nio resolver determinados problemas
de forma independiente.
La zona de desarrollo prximo es la distancia entre el nivel real de desarrollo y el
nivel de desarrollo potencial, determinado a travs de la resolucin de un problema
bajo la gua de un adulto o en colaboracin con otro compaero ms capaz.
Intersubjetividad. Para poder actuar en la ZDP, adulto y nio deben partir de cier-
ta representacin compartida de determinados aspectos de la situacin. La inter-
subjetividad slo es posible cuando los participantes en la interaccin son capaces
de trascender sus propios mundos privados para crear mundos compartidos.
La explicacin del cambio. En el plano ontogentico, el cambio implica la interaccin
de ms de una fuerza de desarrollo: los factores biolgicos o naturales y los facto-
res culturales. Ambos tipos de factores son indisociables y actan como una unidad.
El cambio cognitivo est asociado a la aparicin de nuevas formas de mediacin.
Implicaciones educativas de la teora vygotskiana.
Aprendizaje y desarrollo son para Vygotski procesos interdependientes, en don-
de el aprendizaje es condicin indispensable para que el desarrollo se produzca.
La nica enseanza buena es la que se adelanta al nivel de desarrollo; es decir,
la que es capaz de promoverlo.
El concepto fundamental para entender las relaciones entre aprendizaje y de-
sarrollo es la ZDP. De esto se desprende lo que quiz sea la mayor implicacin
educativa de la teora vygotskiana: para establecer adecuadamente el nivel de
desarrollo, no basta con analizar el desarrollo actual, sino que hay que deter-
minar tambin su desarrollo potencial.
Un concepto relacionado con la ZDP que ha sido propuesto por los seguidores
de Vygotski es el de andamiaje, proceso en el que el adulto va escalonando las
ayudas que proporciona al nio ajustndolas a la habilidad creciente del nio.
Estudio de la inuencia de las instituciones culturales en el desarrollo. Desde esta
perspectiva se entiende la educacin como el conjunto de procesos de sociali-
zacin, as como el principal vehculo de adquisicin de las pautas culturales.
4.3. Comparacin entre las teoras de Piaget y Vygotski
Semejanzas: Ambas teoras comparten una orientacin evolutiva y pueden caracterizar-
se como interaccionistas, intelectualistas y constructivistas. Asimismo, ambas deenden
que la naturaleza del cambio que se produce como consecuencia del desarrollo es emi-
nentemente cualitativa.
Captulo 1. El estudio del desarrollo humano 7
Diferencias:
Conceptualizacin sobre las relaciones entre desarrollo y aprendizaje. Mientras
que para Piaget el desarrollo precede al aprendizaje, para Vygotski el aprendizaje
es una condicin necesaria para el desarrollo.
Determinantes del cambio. Para Piaget el progreso cognitivo se logra mediante la
autorregulacin de las estructuras cognitivas. Para Vygotski, sin embargo, los fac-
tores responsables del desarrollo residen en la compleja interaccin entre los fac-
tores madurativos y los aprendizajes social y culturalmente mediados.
La importancia concedida a la interaccin social. Mientras que para Vygotski es
la base fundacional de los procesos psicolgicos superiores, para Piaget es un
factor necesario pero no suciente del desarrollo.
El papel otorgado al lenguaje. Para Piaget el lenguaje surge y evoluciona como
una manifestacin de una capacidad de carcter ms general la funcin sim-
blica que aparece al nal del perodo sensoriomotor. Vygotski le atribuye un
papel fundamental en la regulacin de las interacciones sociales y como medio
de autorregulacin del pensamiento.
Objetivos
Comprender el objeto de estudio de la Psicologa del Desarrollo y las principales
inuencias que recibe.
Conocer los principales presupuestos epistemolgicos que estn en la base de las
principales teoras del desarrollo humano.
Identicar cmo los distintos presupuestos epistemolgicos se expresan en las
teoras cientcas.
Conocer las principales caractersticas de la teora piagetiana.
Identicar las principales caractersticas de la teora de Vygotski.
Analizar las semejanzas y las diferencias de la teora piagetiana y la teora vygots-
kiana.
1. Introduccin a la Psicologa del Desarrollo
DecaAgustn de Hipona: Qu es el tiempo? Si nadie me lo pregunta lo s, pero si
tratodeexplicrseloaquienmepreguntanolos.Algosemejantepodramosdecirdel
desarrollohumano.
LaPsicologadelDesarrollotienecomoobjetodeestudioloscambiosenelcompor-
tamientosocial,afectivoycognitivoalolargodetodoelciclovital.Paracomprenderla
naturaleza de estos cambios, cada captulo de este libro responde a preguntas distintas.
Aquvamosaintentartratarlasenconjunto.Enprimerlugar,hayquetenerencuentala
evolucindelapropiadisciplina.
Ennuestradisciplinalaedadesunavariableclave.Todoloqueharemossercom-
parar lo que se hace o no se hace sobre los ms distintos parmetros en funcin de la
edad.Perohayquetenerencuentaquelaedad,ensmisma,noexplicanada,puesuna
cosaesdescribir,queesimportante,perootramuchomsnecesariaesexplicarenqu
consistenyporquseproducenloscambioscomoconsecuenciadelpasodeltiempo.
8 Introduccin
En sus comienzos, la Psicologa del Desarrollo, slo se preocupaba del desarrollo
humanoenlainfanciayadolescencia.Parecacomosieldesarrollosedetuvieraah.Sin
embargo, con el paso del tiempo, hubo una conciencia creciente de que era necesario
considerareldesarrollohumanoalolargodetodalaexistencia,detodoelciclovital,de
todoelcursodelavida;desdeelnacimientohastalamuerte.Tambinnosimportamucho
saberquocurredespusdelaadolescencia:enlajuventud,durantelasprimerasfases
delavidaadulta,enlamadurezy,porsupuesto,enlavejez.Pero,incluso,hahabidoque
ampliarelarcomsacdelnacimiento:alavidaintrauterina.
LaPsicologaEvolutivaactualestmuyinfuidaporlarevolucincognitivaquetuvo
lugarenlapsicologageneralenlosaossesentadelsigloXX.Enesemomentosepro-
dujoungirocopernicanoenlaconsideracindelascaractersticasgeneralesdelaparato
cognitivohumano.Conelconductismosehabanprimadolosaspectosexternosyobje-
tivosdelaconductahumanaysehabaintentadoprescindirdelasvariablesinternas,de
lonoobservable.Enesemomentoestabaentodosuapogeolacibernticaylabsqueda
de la inteligencia artifcial (IA). Como consecuencia, irrumpe con toda su fuerza en el
seno de la psicologa la metfora del ordenador; es decir, la consideracin de la mente
humanacomounprocesadordeinformacinsimblicaquetrabajaapartirderepresen-
tacionesinternasdelarealidad.Surgennuevasanalogas:elcerebroeselhardwareyla
menteelsoftware.
A esa revolucin cognitiva centrada en el Procesamiento de la Informacin
hanvenidoasumarse,msrecientemente,lasneurociencias.Conlaaparicindenuevas
tcnicas y procedimientos para el estudio de la actividad cerebral emerge con nuevos
broslabsquedadelasmisteriosasrelacionesentrelamenteyelcuerpo.Labsqueda
de las propiedades emergentes del cerebro en accin.Ahora estamos en pleno asenta-
mientodeestenuevoparadigmatericoyexperimental.
Pero no todos los investigadores consideran que el mejor modo de conocer la con-
ductahumanaseaatravsdelavadelascienciasnaturales.Esms,piensanqueelser
humano,alsereminentementesocial,culturalehistrico,seleentiendemejoratravs
deunaaproximacinnonaturalista.Venlascaractersticasgeneralesdelamentehumana
comounproductodeunsistemasocial.Alaculturaylahistoriacomoforjadorasdelo
humano.Insistenenlaimportanciadelosotrosynoslodelosobjetosfsicososimb-
licos.Laclaveestenlaactividadmediadaporsmboloscreadosporlasdistintassocie-
dadeshumanasenelcursodelahistoria,enlaquelainteraccininterpersonalysocial
pasaporelfltrodelosotros.Aquellenguajejuegaunpapelprimordialenlaconstruc-
cindelasherramientasdepensamiento.Lapalabracomoherramientamaterial.Perono
unlenguajeenelqueloprioritarioeslafraydescarnadasintaxis,sinounlenguajedon-
de la sintaxis (estructura) no puede darse sin semntica (contenido) y sin pragmtica
(contexto).
Ennuestradisciplinaincidenotrasdisciplinascomolabiologa,laetologa,laecolo-
ga,laantropologa,lasociologa...Vemos,pues,queestadisciplinaesuncrucedeca-
minos,delneas,unpuntodeinterseccin,unasingularidad,quetodava,pordesgracia,
estlejosdealcanzarlamadurezrequerida.Cmosabemosquenohemosalcanzadola
madureztodava?Poralgoquedifcultaelprogresoentodadisciplinacientfca:loslla-
mados dualismos, es decir, los posicionamientos contrarios que se oponen entre s de
formairreductible,yqueportantoimposibilitanlasntesisylaintegracintericasne-
cesariasparaunaexplicacincomprehensiva.
Captulo 1. El estudio del desarrollo humano 9
Ennuestradisciplinalosdualismoshacenreferenciaalasposicionescontrariassobre
losfactoresqueintervieneneneldesarrolloylosmecanismosresponsablesdelmismo.
Helos ah: la herencia o el medio ambiente (qu infuye ms en el desarrollo, nuestros
genes o las condiciones materiales donde tiene lugar el desarrollo); el desarrollo o el
aprendizaje(quvaantes,eldesarrolloquepermiteelaprendizajeoelaprendizajeque
impulsa el desarrollo); la inteligencia general o la inteligencia emocional (qu es ms
importanteparalograrunavidaplena,sabermanejarlosafectos,oconducirsesegnlos
presupuestos de la racionalidad clsica); lo individual o lo social (debemos primar las
relacionesinterpersonales,grupales,socialesalahoradedescribireldesarrolloo,porel
contrario,dejarquellevenlainiciativaeneseprocesolosfactoresindividualeseidiosin-
crsicos);locualitativoolocuantitativo(loscambiosqueseproducencomoconsecuen-
ciadelpasodeltiemposoncualitativosyglobalessuponenlaemergenciaylareorga-
nizacinennuevasestructurasosoncuantitativosyslosuponenlaacumulacinde
conocimientos o experiencias); lo general o lo particular (los cambios que se producen
comoconsecuenciadeldesarrolloafectanatodaslasreascognitiva,afectiva,social,
etcteraosecircunscribenareasoaspectosespecfcos).
EnlaFigura1.1delapginasiguiente,puedenversealgunasdelaspreguntasmsfre-
cuentesalasquetratandedarrespuestalospsiclogosdeldesarrollo.Lasrespuestasapa-
recenendospolosopuestospararepresentarlosdualismosenlosqueenmuchasocasiones
sehaninstalado.Estosdualismosllevanamovimientospendularesyamodaspasajeraso
infructuososeclecticismos,quenosonverdaderassntesis.Lasdistintasteorasdeldesa-
rrolloseadscribenaunladouotrodecadaunodelosejessinsolucindecontinuidad.
Los dualismos se producen porque se parte de presupuestos diferentes, esto es, de
ideasbsicasmuchasvecesintuitivasentornoalorigenyalaposibilidaddelcono-
cimiento que han sufrido pocos cambios a lo largo de la historia de la Filosofa. Estos
presupuestos tratan de dar cuenta del problema del conocimiento. Esto es, de cmo un
serhumanopuedellegaraconoceralgodeunmundoextremadamentecomplejoycam-
biante,repletodeobjetosdiferentes,personasdistintasyacontecimientosvariablesque
se suceden a una gran velocidad; un mundo en el que raramente se est expuesto dos
vecesaidnticasestimulaciones.
Esteproblemadelaposibilidaddelconocimiento,quenoporobviodejadeserex-
tremadamentecomplejo,notieneunanicarespuesta.Desdecadaposicinepistemol-
gicasenosofrecenexplicacionesdistintasparadarcuentadelmismo.Sucomprensiny
suanlisissonimportantesporqueentornoaellassehanarticuladolasprincipalesteoras
cientfcasquetratandeexplicareldesarrollohumano.Portanto,comprenderestospre-
supuestosnospermitirdesarrollarelpensamientocrticopararefexionartantosobreel
potencialexplicativo,comosobrelaslimitacionesdelasprincipalesexplicacionesteri-
casqueseofrecendesdenuestradisciplina.
2. Presupuestos tericos y conceptos fundamentales
en la Psicologa del Desarrollo
Aligualqueelestudiopsicolgicodelserhumanoengeneral,elestudiodesudesarrollo
hagiradoentornoatresconjuntosdepresupuestos,atresmodosdistintosdeexplicarsu
10 Introduccin
evolucindesdeelnacimientoalolargodetodoelcursodelavidaociclovital:racio-
nalismo,asociacionismoyconstructivismo.
Racionalismo
EnpalabrasdeWilliamJames,elmundoesparaelbebconfuso,estrepitosoycambian-
te.Sinembargo,estaconfusininicialvadesapareciendoalolargodeldesarrolloapar-
tir del conocimiento, de la percepcin y de la accin (Richardson, 1988). El problema
bsicoqueseplanteadesdeelracionalismoesquenosepuedellegaraconocerunmun-
dotancomplejoycambianteapartirnicamentedelasimpresionesquellegananuestros
cualitativo
emergencia
de nuevas estructuras
y conductas a partir
de las previas
Cul es la naturaleza del cambio evolutivo?
cuantitativo
el cambio es producto
de la acumulacin
de conocimientos y
experiencias sin que haya
emergencia de nuevas
estructuras y conductas
herencia
dotacin gentica
ambiente
interacciones y
experiencias del
individuo con el entorno
natural y social
Qu factores determinan el desarrollo?
individual
cambios producto
de la maduracin
y/o el aprendizaje
individual
social
interacciones y
experiencias del individuo
con el entorno natural y
social
El desarrollo es un proceso individual o social?
globales
afectan de forma cojunta
y global a un conjunto
de estructuras que
determinan los
comportamientos en
determinados perodos
especficos
afectan de manera
independiente a
estructuras aisladas
o a mdulos
especficos
Cmo afecta el cambio?
del desarrollo
al aprendizaje
es necesario un nivel
de desarrollo previo
para que se puedan
realizar ciertos
aprendizajes
del aprendizaje
al desarrollo
las nuevas experiencias
de aprendizaje pueden
potenciar el desarrollo
Cul es la relacin entre desarrollo y aprendizaje?
Aplicando conocimientos:
Las teoras innatistas del desarrollo, por ejemplo, defienden que los cambios son cuantitativos, estn
determinados genticamente, se producen a nivel individual, son especficos es decir, no afectan por igual
a todas las reas y consideran que es el desarrollo quien determina el aprendizaje (vase Captulo 2).
Figura 1.1. Algunas de las preguntas ms importantes en Psicologa del Desarrollo y las res-
puestas ofrecidas desde posiciones dualistas.
Captulo 1. El estudio del desarrollo humano 11
sentidos.Senecesitaraalmenosciertotipodeconocimientoyadesdeelmomentodel
nacimientoquenospermitairorganizandoesasimpresionessensoriales.Portanto,enel
racionalismoprimaloinnato,elbagajeconelquevenimos,tantoelgeneralpropiode
la especie humana como el particular, que es la expresin de lo general en el caso
concretodecadaindividuo.Seconsideraqueelconocimientonosedesarrollanisecons-
truye,sinoqueyaestpresentedesdeelmomentodelnacimiento.
Sin embargo, afrmar que el conocimiento ya se tiene desde el momento del naci-
mientonoimplicaqueseseaconscientedelcontenidodelmismo.Estaraimplcito,en
potencia,yslosehaceexplcitoatravsdelaaplicacindelasreglasdeladeduccin
lgica o del discurso racional, de ah el trmino racionalismo. La aplicacin de estos
esquemasderazonamientodeductivosobreelmundoquenosrodeanospermitirapren-
der,esdecir,hacenposiblequeeseconocimientoinnatoeimplcitosedesvele.
Desdeestaperspectivanoseniegalainfuenciadelmedionaturalysocialenelque
se desarrolla el ser humano ni de la experiencia, pero slo se consideran como meros
desencadenantesdeloinnato.
Laposicinracionalistasemanifestaenelcampodelestudiodeldesarrollohumano
comoinnatismoomaduracionismo.Suformulacinmsusualeslaconsideracindel
desarrollocomounprogresivodesenvolvimientodeestructuras,tantofsicascomopsi-
colgicas,determinadasgenticamente(Richardson,1998;p.59delatrad.castellana).
Se considera, pues, que las capacidades innatas, potenciales, antes de ser actualizadas
deben madurar como consecuencia de la programacin gentica, proceso en el cual el
medionaturalysocialylaexperienciaslotienenunpapelpasivo.
Asociacionismo
El asociacionismo, al contrario que el racionalismo, afrma que todo el conocimiento
puede derivarse a partir de la experiencia sensorial. El conocimiento, por tanto, no es
innato, lo que es innata es la facultad de razonar inductivamente que permite abstraer
leyesgeneralesapartirdelaexperiencia.
Porejemplo,cuandosedetectaquehaycosasqueocurrensiemprejuntasoquevan
unadetrsdeotraenlanaturaleza,sepuedeinferirqueunapuedesercausadelaotra.
Estoesposiblegraciasalasleyesdelaasociacinquepermitencrearyasociarconcep-
tos en la mente (atribuir causalidad, caractersticas, coocurrencias o secuencialidad) a
partirdelaobservacindecmoocurrenlosacontecimientosenelmedionaturalysocial.
Elasociacionismoprimaloadquirido,elmedioambiente,tantonaturalcomosocial.
Estoes,elcontextoolascircunstanciasenelqueeldesarrollotienelugarylasinfuencias
que recibimos. Este enfoque dar lugar al empirismo que postula que todo el conoci-
mientoprocededelaexperiencia.
Constructivismo
Elconstructivismoesunintentodesntesisentreracionalismoyempirismoquetienesus
orgenesenlaflosofadeKant.
Elconocimientoseconstruyeapartirdelaexperienciasensorial(loemprico)ylas
categorassintticasapriorioconceptosinnatos(loracional).Sonlascategorasinnatas
lasquenospermiteninterpretarlainformacinqueentraatravsdenuestrossentidos.
12 Introduccin
Pero a diferencia del racionalismo, estas categoras no son conocimiento en s mismo,
sinoconceptosbsicosyabstractosdecantidad,cualidad,relacinymodalidadquenos
ayudanaempezaradarsentidoalaexperienciaquevienedefuera.Estascategorasson
leyesdepensamientouniversales,intersubjetivas(compartidasportodoslossereshuma-
nos)ynecesariasqueproporcionanunconocimientocoherenteapartirdelaexperiencia
posible(Richardson,1998).
Elresultadodelainteraccinentrelaexperienciasensorialydelasleyesdepensa-
mientouniversalesnosonasociacionesdeconceptoscomosepostuladesdeelasocia-
cionismosinoesquemas,oconstruccionesmentalesquerefejannuestroconocimiento
delmundo,peroquenosonunameracopiadelmismo.
3. Los presupuestos se expresan en teoras
Enlahistoriadelacienciahayunacontinuainteraccinentrepresuposiciones,teorasy
hechos.
Como ya hemos visto en el apartado anterior, las presuposiciones son ideas o con-
ceptosbsicosqueestnenlabasedelasdistintasteorasquetratandeexplicareldesa-
rrollohumano.Ylasteorasnosonmsquemodelosdecmofuncionaunapartedela
naturaleza,ennuestrocaso,decmoevolucionaelserhumanoalolargodetodosuciclo
vital.Unaadecuadateoradeldesarrollotendrquedeterminarlosfactoresqueinfuyen
enelmismoylosmecanismosdecambioodeevolucincondosfnalidadesprincipales:
describirypredecireldesarrollo.
Elprocesoidealpormediodelcualsellegaaconstruirunateoracientfcaesme-
diantelaconsecucindelasdistintasfasesdelmtodocientfcoohipottico-deductivo:
1. Observacindeloshechos.
2. Formulacindeunateoraquetratadeexplicarloshechos.
3. Derivacindeprediccionesenformadehiptesisquedebensercontrastables.
4. Realizacindeunexperimentoquepermitacontrastarlashiptesis.
5. Obtencindeunosresultados.
6. Interpretacindelosresultados.
7. Refnamientodelateora.
Veamosestasfasesconunejemplo(vasetambinFigura1.2).Anteunosdetermina-
doshechos(p.ej.,todoslosnioslogranadquirirsulenguamaternaenunperodocorto
detiempoyhacialos5aosdominantodoloesencialdeella)seproponeunateoraque
expliqueestehecho(p.ej.,unateorainnatista,quesostienequelalenguamaternaesla
expresindeunacapacidadlingsticaqueestinscritaennuestroADNocidodesoxi-
rribonucleico). Esta teora, a su vez, da lugar a ciertaspredicciones (los primates supe-
riores no sern nunca capaces de aprender un sistema de comunicacin semejante al
humano). Esa prediccin debe formularse como una hiptesis contrastable no como
unameraespeculacinquepuedasometerseaunapruebaobjetivayrepetible(experi-
mento),queayudeadecidirsilateorapuedeonopuedesostenerse(p.ej.,pormucho
quequeramosensearunalenguasimilaralalenguamaternahumanaaunprimatesu-
perior no humano no lo conseguiremos). Los resultados de los experimentos son inter-
Captulo 1. El estudio del desarrollo humano 13
pretablesy,casinunca,cierrandefnitivamenteelproblema.Enestecaso,parecequelos
chimpancspuedenaprenderunsistemadecomunicacindeciertacomplejidadeinclu-
soenserseloasuprole,peroconciertaslimitaciones.Porejemplo,parecequenunca
hansidocapacesdeemplearestesistemadesignosparahacerunapregunta,mientrasque
losniosencuantopuedennodejandehacerpreguntassobrelosmsvariadosasuntos.
Losresultadosobliganaperflaryaafnarlateora.Estosrefnamientosdarnlugar
aunanuevateora(enestecaso,todoslosprimatessuperiorescompartenunacapacidad
prelingsticacomnquesurgienelcursodelaevolucin,elllamadodesarrolloflo-
gentico). Esta teora deber someterse a nuevas contrastaciones experimentales para
ponerapruebasuvirtualidad.
Interpretacin de los resultados
refinamiento
hechos
experimento resultados
hiptesis
contrastables
predicciones teora
Figura 1.2. Fases del mtodo cientco o hipottico-deductivo.
Comohemosvisto,elprocesodelmtodocientfcosiemprecomienzaconlaobser-
vacindeunoshechos.Ahorabien,hayquetenerencuentaquenohayhechoscientf-
camente neutrales o puros, puesto que quien los observa parte de ciertas las presuposi-
cionesquesesganengranmedidaloquevaaobservar.
EnelcasodelaPsicologaenlaqueloscientfcos(personas)elaboranteorassobre
laspropiaspersonasellosmismoslospresupuestosseconstruyenapartirdeexpe-
rienciascotidianasymuchasvecessubjetivas,porloqueloshechosqueobservanyque
recogenestninfuidosporsuspropiaspresuposiciones.As,elracionalistaestarcon-
vencidodequeloshechosrefuerzansuenfoquedequehaycapacidadesinnatas.Elaso-
ciacionista, dir que todo, si se hace de la manera adecuada, puede ser enseado. El
constructivista,porsuparte,afrmarqueniloinnatoniloadquiridopuedenexplicarpor
separadoeldesarrollohumano,e,insistir,adems,enquenosetratameramentedesu-
marodemultiplicargenesporambiente,sinoquelaactividadconstructivadelapropia
personaesfundamentalydefnitivaparadarcuentadelosaspectosesencialesquesub-
yacenaldesarrollohumano.
Lahistoriadelacienciaengeneral,ydelaPsicologaenparticular,refejaengran
medida el peso de los distintos presupuestos, las tensiones originadas entre ellos y los
confictosorevolucionesquesehansuscitadocuandoenciertomodosesuperanyse
adoptannuevaspresuposiciones.
LaPsicologadelDesarrollo,comoestamosviendo,noesajenaaestoysusprinci-
palesteorasestnimpregnadasdelospresupuestosquehemosanalizadoenelapartado
anterior.As,podemosconstatarmanifestacionesdepresupuestosracionalistas,porejem-
plo,enlateoradelaadquisicindellenguajedeNoamChomsky.Enellaseafrmaque
14 Introduccin
lasleyesgramaticalessonuniversalesocomunesatodaslaslenguasyconsustancialesa
laespeciehumana(vaseCaptulo3)ydefendelanaturalezagenerativadellenguaje,
esdecir,lacapacidadparacomprenderyrealizarunainfnitavariedaddeproducciones
verbalesalgunasdelascualesnosehanodonuncaapartirdeunaexperiencialin-
gsticamuylimitada(pobrezadelestmulo)yenunperododetiempomuyreducido.
EnestemismocampotambinStephenPinkerdefendequenacemosconelinstintodel
lenguaje.
Igualmente,enelestudiodelapercepcinenbebs,losautoresinnatistassostienen
quehayrestriccionesinnatasvisualesyauditivasquenospermiten,porejemplo,recono-
cerelrostroylavozhumanacasidesdeelmomentodelnacimiento(vaseCaptulo2).
Tambin se acercan a posiciones racionalistas algunos estudiosos de la Teora de la
MentecomoTrevarthen(vanseCaptulos3y4)alconsiderarqueelnionaceconun
conjunto decapacidades sociales eintersubjetivasquelepermitenelestablecimiento
de vnculos con los dems miembros de su especie desde los primeros momentos del
desarrollo; o los estudios sobre el desarrollo del apego y de las primeras expresiones
emocionales (vase Captulo 4), muy infuidos por los modelos etolgicos y evolucio-
nistas que postulan mecanismos desencadenantes de origen biolgico, tanto propios de
laespeciehumanacomotal,cuantocomunesadistintasespecies.
Especialmenteancladosalasposicionesinnatistasseencuentranlosnumerososes-
tudiosqueenlosltimosaossehancentradoenelanlisisdelestadoinicial(cognitivo,
motor,etc.)buscandolapresenciadecapacidadesmuycomplejascasidesdeelmomen-
todelnacimiento(vaseCaptulo2).
Conceptos relacionados con posiciones racionalistas que aparecen en las distintas
teoras del desarrollo son, por ejemplo, instinto, universales, perodos crticos,
pobrezadelestmulo,ideasinnatasoesquemasprevios.Enelcampodelaedu-
cacinexpresionesquetambinsondeudorasdeposicionesinnatistaslaspodemosreco-
nocerenconceptoscomoaptitudesespeciales,capacidadgeneraldeinteligenciao
preparacinocapacidadparaalgunasformasdeaprendizaje.
Porotraparte,algunasmanifestacionesasociacionistasenlaPsicologadelDesarro-
llolaspodemosencontrarenelconductismosegnelcualelaprendizajesebasaenla
asociacindeestmulos,odeestmulosyrespuestas.Msrecientementetambinpueden
observarse en algunas teoras neoasociacionistas que, desde el Procesamiento de la
Informacin,postulan,porejemplo,queelconocimientoseorganizaenlamemoriaen
redesdeconceptosinterconectadosentres.Delmismomodo,unnuevoenfoquequese
denominaconexionismooprocesamientodistribuidoenparaleloasumeasociaciones
entreunidadesdondeserepresentaelconocimiento.Deacuerdoconestaperspectiva,el
conocimientonosesitaenunlugarconcretodelcerebro,nienasociacionesespecfcas
entreunidadesespecfcas(p.ej.,enasociacionesentreconceptos),sinoquesehalladis-
tribuidoendistintasunidades(neuronasoredesdeneuronas)yemergedelaactivacin
paraleladeredesdeneuronasinterconectadasentrescondiferentesfuerzasdeconexin,
mediantemecanismosdeexcitacineinhibicin(vaseFigura1.3).
Conceptosquedenotanposicionesasociacionistasdentrodelasteorasdeldesarrollo
son, por ejemplo, programas de reforzamiento, habituacin de estmulos, redes
semnticas,reglasdeaprendizaje,organizacindelconocimientoenlamemoria,
entre otros. En el campo de la educacin tambin podemos encontrar la infuencia del
asociacionismoenconceptoscomopotencialdeaprendizaje,estrategiasdeaprendi-
Captulo 1. El estudio del desarrollo humano 15
zajeasociativo,programasdemodifcacindeconducta,programacindeaprendi-
zajes,mapasconceptuales,etc.
Finalmente,lasposicionesconstructivistassehanrefejadoenlaPsicologaCogniti-
vamediantelautilizacindelconceptodeesquemaparaexplicarcmosecreanrepre-
sentacionesinternasdelarealidadapartirdelaexperiencia.
Este concepto se ha adoptado en campos tan aparentemente dispares como el de la
memoria,enelqueBarlett(1932)demostrquecuandolaspersonasrecuerdannarracio-
nes o relatos tienden a incorporar sus experiencias personales o sus creencias; o en la
percepcin,enelquelospsiclogosdelaGestaltnosdemostraronquelossereshumanos
imponemosciertaorganizacinalainformacinsensorial.
Sinembargo,losesquemasnosecircunscribensloambitoscomoelaprendizaje
perceptivooconceptual,sinoquetambinsehahabladodeesquemasmotores.Unejem-
ploeselesquemamotordelafrmapersonaldecadauno.Lapodemosejecutarenuna
hojadepapeloenunapizarraengrandescaracteres.Esunmismoesquema,aunquese
expreseconmovimientosmuscularesdistintos.Cuandofrmamosenunahojadepapel
pequealosmovimientosmuscularesnosonlosmismosquecuandolohacemosenuna
pizarragrandeconunatiza.Sinembargo,laestructuradelafrmaesinconfundible.Vie-
nedelmismoesquemainterno.
Elconstructivismohatenidounagraninfuenciaenlasdosteorasdeldesarrolloin-
fantillasteorasdePiagetyVygotskiquesonlosdosgrandespilaressobrelosque
sehaarticuladoelestudiodeldesarrollohumanoyqueporsuespecialimportanciaabor-
daremos de forma ms extensa en el siguiente epgrafe. De acuerdo con los principios
constructivistassobrelosquedescansan,desdeambosenfoquesseinsisteenquelasre-
presentacionesinternasdelmundonosonunregistropasivodelasasociacionesexisten-
tallo margarita ptalos
planta flor amapola
nenfar agua ptalos
Unidades de salida
Unidades
de entrada
0,25
0,60
es una
es una
tiene
tiene tiene
es una
es una
vive en
tiene
Enlasredessemnticaslosconceptosserepresentanenlamemoriacomonodosrelacionadosentre
ssemnticamente(p.ej.,esuna,tiene,etc.).Enlasredesneuronales,unconceptonosere-
presenta en una sola unidad, sino que se representa simultnea y distribuidamente a lo largo de
distintasunidadesqueserelacionanentresconunadeterminadafuerzadeasociacin(p.ej.,0,25)
Figura 1.3. Red semntica (a la derecha) y red neuronal (a la izquierda).
16 Introduccin
tes en el mundo externo, sino que se derivan de la accin que realiza el propio sujeto
sobreelmedioalinteractuarconl.
4. Las grandes teoras del desarrollo humano:
Piaget y Vygotski
4.1. La teora piagetiana
Lateorapiagetiana
1
quizsealamscompleta,comprehensivaydetalladadeldesarrollo
humano.Aunqueenlosltimosaosharecibidonumerosascrticas,desdedistintaspers-
pectivashasido,probablemente,elmarcoconceptualquemsinfuenciahatenidoenla
PsicologadelDesarrolloysiguesiendoenmuchosaspectoslateoradereferenciapor
excelenciaquesirvecomomarcodecomparacinalrestodeperspectivastericas.
TodalateorapiagetianasearticulaentornoalapreocupacinepistemolgicadePia-
getsobreelorigenynaturalezadelconocimientoycmosteseconstruyeyprogresaa
lolargodeldesarrolloontogentico,esdecir,alolargodeldesarrollodelosindividuos.
Suteorasecentraenexplicarcmosepuedeprogresardeunestadodemenorcom-
petenciaoconocimientoaotrosuperior.Cmodesdelosrefejosmssimplesconlosque
nacemos se puede llegar de forma gradual al pensamiento lgico-formal, el nivel ms
elevadodepensamientoparaPiagetqueescaractersticodelrazonamientocientfco.Por
tanto,lapreguntafundamentalalaquetrataderesponderPiagetescmolaspersonas,
desdeelmomentodesunacimiento,vanconstruyendosuconocimientoacercadelmun-
doquelesrodea,unconocimientoquelespermitiradaptarseaunarealidadcomplejay
cambiante.
Pararesponderaestapregunta,Piagetqueerabilogodeformacintomcomo
referenciaelmarcoconceptualdelaBiologa.Partedequeexisteunaconexinnatural
entrelaBiologadesarrollonaturaldelosseresvivos,laPsicologadesarrollode
lainteligenciaylaEpistemologaorigendelconocimiento.Porello,Piagetafrma
1
AunquealolargodelaexposicinnosreferiremosfundamentalmenteaPiagetyalateorapiage-
tiana conviene no olvidar que a la vasta empresa en que consisti su construccin terica contribuyeron
notablemente otros investigadores e investigadoras entre las que destacan Alina Szeminska y, sobre todo,
BrbelInhelder.
Figura 1.4. Jean Piaget.
Captulo 1. El estudio del desarrollo humano 17
que el desarrollo psicolgico, que se inicia al nacer y concluye en la adolescencia, es
comparablealcrecimientoorgnico.EstoquieredecirqueparaPiagetlasreglasquere-
gulanelpensamientonosondiferentesalasqueregulanelmundonaturalyqueelpen-
samientoadultonoesalgoquesurgedelanada,sinoqueseconstruyeapartirdelain-
tegracin del pensamiento infantil, al igual que en el mundo natural las formas ms
complejasseconstruyenapartirdelaintegracinycoordinacindeotrasformasoes-
tructurasmssimples.
Consecuentemente,elpropioPiaget(1970)caracterizasuobracomounateoradel
desarrollo cognitivo que no puede entenderse sin analizar los presupuestos biolgicos
sobrelosquedescansalateorabiolgicadelaadaptacinmedianteautorregulacin,
nisufnalidadepistemolgica:explicarelorigenydesarrollodelconocimiento.Porello,
paraexplicareldesarrolloPiagetproponelaepistemologagentica
2
,estoes,elestudio
delorigenognesisdelconocimientodesdeelnacimientohastalaadolescenciaapartir
delaaccinconlosobjetos.
Eldesarrollocomopreocupacinepistemolgica
EldesarrollodelainteligenciaestligadoparaPiagetaldesarrollodelconocimiento,es
decir,acmoelsujetodesdeelmomentodelnacimientoysloapartirdeunoscuan-
tosrefejosinnatosvatomandoconcienciadeformaprogresivadelosobjetos
3
fsicos
ysocialesquelerodeanhastallegaraformarestructuraslgicasdeconocimientoquele
permitenadaptarsealmundo.
Enelmomentodelnacimientonoexistediferenciacinentreelsujetoyelobjeto.El
bebnodistingueentreelyoyelmundo,puestoqueellmiteentreelmundoexternoy
elinternonoestestablecidodeantemano.Pocoapoco,elniotienequellegaradife-
renciar lo que conforma el mundo externo y sus relaciones, de su propia persona. Esto
supone ir construyendo lo que Piaget denomina invariantes cognitivos (cualidades o
propiedades esenciales de los objetos que hacen que se puedan reconocer como tales)
mediantelaaccinomanipulacindelsujetosobrelosobjetos.Alprincipiodeldesarro-
llolainteraccinentreelsujetoylosobjetosesdirecta(estestrechamenteligadaala
accin:losniosloschupan,lostocan,lostiran,etc.),peroamedidaqueseavanzaen
el desarrollo esta interaccin se hace mucho ms compleja.Ya no se basa en la accin
directa sobre los objetos, sino en la interaccin con ellos sin que estn necesariamente
presentes.Esdecir,apartirdelarepresentacinmentalqueelniohaconstruidodelos
objetosydesuspropiedades.
Estainteraccinentreelindividuo(elnio)yelmedio(losobjetos)sellevaacabo
mediantedosprocesoscomplementarios:asimilacinyacomodacin.Mediantelaasi-
milacin,elniointeractaconlosobjetosquelerodean,peroelresultadodeestaaccin
dependedeloqueelnioescapazdehacerconobjetossimilares,esdecir,dependede
losesquemaspreviosdelnio,deloqueyaconoce.Porejemplo,aplicandoelesquema
desuccinelniopuedetantosuccionarelbibern,elpechomaternoochuparseeldedo.
2
TngaseencuentaquecuandoPiagethabladeepistemologagenticaesenrelacinconlagnesisu
origendelconocimiento,noenrelacinconlosdeterminantesgenticosdelconocimiento.
3
Esimportantetenerpresentequecuandodesdelateorapiagetianasehabladeobjetos,sehacereferen-
cianosloalosobjetosfsicos,sinotambinalossociales,esdecir,alaspersonas.
18 Introduccin
Portanto,mediantelaasimilacinelniointeractaconelmediorepitiendolosesque-
masqueyaposeep.ej.,succinaunquelosgeneraliceaobjetosdiferentes(bibern,
pecho, chupete, dedo). Es, por tanto, una interaccin dirigida por el sujeto mediante la
queincorporaobjetosopropiedadesasuspropiosesquemas.
Recprocamente, el medio tambin acta sobre el organismo. El nio no se limita
pasivamenteaincorporarnuevosobjetosasusesquemasprevios,sinoquelaincorpora-
cin de estos nuevos objetos, con sus nuevas propiedades, provoca ligeros cambios o
reajustesenlosesquemasqueyatieneparapoderacomodarseaellos.Porejemplo,cuan-
docambianlostamaosytexturasdeobjetoschupados,ocuandoseleofrecennuevos
objetosalnioquepuedechupar,elbebtienequeirmodifcandoesteesquemaprevio
desuccinparaamoldarloalasnuevassituaciones.
Laasimilacinylaacomodacinsonprocesoscomplementariosquesonlasdosca-
rasdelmismofenmeno:laadaptacindelorganismoalmedioapartirdelaconstruccin
de estructuras o esquemas mentales progresivamente ms complejos. Esta adaptacin
consisteenelequilibrioentrelosintercambiosdelindividuoyelmedio,esdecir,entre
losprocesosdeasimilacinyacomodacin.
Portanto,eldesarrollodelainteligenciaesparaPiagetunprocesodeconstruccin
delconocimientodondesteestcontinuamentecrendoseytransformndose.Estacons-
truccinseharendosdireccionescomplementarias:haciaelexterioryhaciaelinterior.
Haciaelinterior(desdeelmediohaciaelsujeto),medianteelprocesodeasimilacin,es
deciratravsdelaincorporacindeinformacinnuevaelementosexternosdelmedio,
delosobjetosalosesquemasoestructuraspreviasdelsujeto.Yhaciaelexterior(des-
deelindividuohaciaelmedio),medianteelprocesodeacomodacin,omodifcacinde
los esquemas o estructuras internas del sujeto a las condiciones externas. La evolucin
humana en el plano psicolgico como en el biolgico est dirigida por las necesidades
internasdeequilibrioentrelosprocesosdeasimilacinyacomodacin.Enelplanopsi-
colgico,ellogrodeesteequilibriosuponeelpasoporestructurasdeconocimientosu-
cesivas,denominadasporPiagetestadiosdeldesarrollo.
Losestadiosdedesarrollo
ParaPiageteldesarrollodelainteligenciaesunprocesoenelqueelnioprogresades-
deunoscuantosesquemassimples(refejos)quelepermitenlasprimerasadaptaciones
simpleshaciaesquemasdeconocimientoformalesquelepermiteninteractuarconla
realidadyrazonardeformaabstractaparaadaptarsecompletamenteaella.
En este proceso, Piaget distingue tres grandes perodos: el perodo sensoriomotor
(desde el nacimiento hasta los 2 aos), el perodo de las operaciones concretas que
comprendeelperodopreoperatorio(desdelos2hastalos6-7aos)yeldelasoperacio-
nes concretas propiamente dichas (de los 6-7 hasta los 11 aos); y el perodo de las
operacionesproposicionalesoformales(apartirdelos11-12aos).
En la Figura 1.5, puede verse una breve caracterizacin de cada uno de estos pe-
rodos
4
.
Veamos el proceso de forma detallada. Cuando el nio nace, dispone solamente de
unos cuantos refejos simples (como el refejo de succin o palmar) producto de la he-
4
LosdistintosperodosdeldesarrolloseverndeformadetalladaenlosCaptulos2,5,8y9.
Captulo 1. El estudio del desarrollo humano 19
renciagentica.Peroestosrefejosnosonpasivos,sinoquemuestrandesdeelcomienzo
unaautnticaactividad,primeroatravsdelpropioejerciciodelosrefejos(p.ej.,elbeb
practicaelrefejodesuccinymedianteelprocesodeasimilacincomohemosvisto
enelepgrafeanteriorlogeneralizaaotrosobjetos).Posteriormente,partiendosiempre
de las acciones del nio, se van integrando los refejos en esquemas ms generales, en
esquemasdeaccin(p.ej.,elrefejopalmarseintegraenelesquemadeprensin)yse
coordinandiferentesesquemas(p.ej.,ojo-mano)quepermitencoordinarlasaccionesdel
bebsobrelosobjetos(p.ej.,extenderlamanoparacogerunobjetoqueestviendo).
Enestaprimeraetapa,lasaccionesdelsujetosobrelosobjetossonmanipulaciones
directas,basadasenlassensacionescorporales(p.ej.,losobjetossetocan,sechupan,se
tiran,semueven,etc.)enlasquetodavanointervienenniellenguajenilarepresenta-
cin.Sinembargo,apartirdelos2aos,aproximadamente,laaccindelniosobrelos
objetossemodifcadeformasustancialgracias,enunprincipio,alaaparicindelafun-
cinsimblicaquelecapacitapararepresentarseobjetosyacontecimientos.
Lafuncinsimblicapermite,entreotrascosas,laadquisicindellenguaje.Atravs
dellenguajelosniosyapuedenreconstruirsusaccionespasadascomounrelatoyanti-
ciparaccionesfuturasmediantelarepresentacinmental.Ellenguajetambinposibilita
lainteraccinsocial,elpensamiento(atravsdelainteriorizacindelapalabra)y,fun-
damentalmente,lainteriorizacindelaaccin(lareconstruccinenelplanodelpensa-
miento de las acciones y de los resultados de las mismas). Por ejemplo, los nios son
capacesderepresentarseenelplanodelpensamientoquecuandounobjetoseoculta,no
desaparece,sinnecesidaddecomprobardirectamentequesigueenelmismositio.
Sinembargo,elincipientepensamientoparaelquecapacitalafuncinsimblicaes
todavapreconceptual:estbasadoencasosindividuales.Aselniode2-3aosnopue-
de distinguir entre el gato particular y los gatos. Sin embargo, aunque los precon-
ceptosnotienentodavasufcientegradodegeneralidad,sonyarepresentacionesmenta-
les: estn ligados a un smbolo y no a la accin con los objetos. Por ejemplo, el nio
puede sealar un dibujo de un gato o pronunciar la palabra gato, para referirse a un
conceptomental(unanimal)ynosloalgato(real)queestviendo.Desdelos4hasta
los7aos,aproximadamente,elpensamientopreconceptualevolucionahaciaelrazona-
miento intuitivo que permitir ir construyendo leyes fsicas intuitivas de cmo son los
objetosdelmundoydesusrelaciones.Sinembargo,estetipoderazonamientoestcen-
tradotodavaenlosrasgosperceptivosmssalientesdelosobjetosyslopuedeteneren
cuentaunanicadimensindelosobjetos.
Porejemplo,apartirdeljuegoconunaboladeplastilina,unaniade5aospuede
descubrirqueamedidaquesealargaeltrozodeplastilina,sehacetambinmsestrecho,
yalainversa,perotodavanoescapazdedarsecuentadequelacantidaddeplastilina
permanececonstantepesealasdeformacionesperceptivasquesepuedanproducir.
Apartirdeexperienciascomosta,puedellegaratomarconcienciadequelongitudy
grosornosondimensionesindependientesdelosobjetossinoquevarandeformacoor-
dinada(amedidaquesealargalabolasehacemsestrecha,yviceversa)ydeducirque
lacantidaddeplastilinapermanececonstanteaunquecambiesuforma.Peroparatomar
concienciadeello,todavanecesitatenerlaplastilinapresenteparapodermanipularla.
Noserhastalos6-7aoscuandoestaniapuedarealizarmentalmenteestastrans-
formaciones y tome conciencia de las coordinaciones entre longitud y grosor que se
producencomoresultadodelasmismas.Aestasaccionesmentales,esdecir,alaca-
20 Introduccin
pacidadderealizartransformacionessobrelosobjetosdeformavirtual,alasacciones
interiorizadas, es a lo que Piaget denomina operaciones mentales. Desde los 6-7 aos
hasta los 11 aproximadamente, Piaget habla de operaciones concretas porque todava
Perodo Caracterizacin
Sensoriomotor
Los esquemas refejos con los que na-
cenlosbebslespermitenunarudimen-
taria interaccin con el mundo, pero
importantsimaparaquevayanconstru-
yendoesquemasdeaccinconlosobje-
tos mucho ms complejos que refejan
yaunaconductainteligente.Alfnalde
esteperodolosniosadquierenlafun-
cinsimblicaquelespermitelaadqui-
sicin del lenguaje, el juego simblico
oeldibujo.
Operaciones
concretas
Subperodo preopera-
torio:
Desdelos2hastalos6-7
aos.
Subperodo de las ope-
racionesconcretas:
Desdelos6-7aoshasta
los11.
Comienzaconlaadquisicindelafun-
cinsimblica.Lainteligenciapasade
sereminentementeprcticaaserrepre-
sentacional. Sin embargo, todava se
tiene un pensamiento mgico sobre la
realidad y el razonamiento an es pre-
conceptual.
Seinteriorizanlasaccionesconlosob-
jetos.
Aparecen las operaciones lgicas y la
reversibilidaddelpensamiento.Sinem-
bargo, la aplicacin de las operaciones
lgicas est limitada a contenidos con-
cretos.
Operaciones
formales:
Desdelos11-12aos.
Se caracteriza por ser un pensamiento
lgico, abstracto e hipottico que per-
miterazonarnoslosobreloreal,sino
tambinsobreloposible.
Figura 1.5. Perodos del desarrollo de la inteligencia.
Captulo 1. El estudio del desarrollo humano 21
estn ligadas a contenidos concretos. Las operaciones concretas permiten a los nios
clasifcar objetos en funcin de determinadas propiedades, ordenarlos, la comprensin
del sistema de los nmeros y la construccin de las nociones de tiempo y espacio. No
obstante,estetipodepensamientotienetodavalimitaciones.Losniosdeestasedades
son capaces de razonar aplicando las operaciones concretas siempre y cuando puedan
manipular los objetos. Sin embargo, cuando se les pide que razonen sobre los mismos
contenidos a partir de enunciados verbales, se muestran incapaces. Esto es as porque,
aunque ya lgicas, estas operaciones estn todava ligadas a la accin y a contenidos
concretos; no son abstractas y, por tanto, impiden la construccin de argumentaciones
lgicascuandolosniosnopuedenrealizarlasaccionesdirectamentesobrelosobjetos,
ocuandoselespidequerazonensobredistintoscontenidos.
Apartirdelos11-12aos,seproduceunatransformacindelpensamientoqueper-
mitealosadolescentesrazonardemodohipottico-deductivo,esdecir,deformaabstrac-
ta, sobre situaciones o enunciados verbales que no tienen una conexin directa con la
realidad.ParaPiaget,duranteesteperodosealcanzalaplenituddelpensamiento.
Losestadiosporlosquelosniospasansiempresiguenunordensecuencialyfjo,
igualparatodoslosindividuos,yportanto,decarcteruniversal.Sinembargo,pueden
existir ligeras variaciones en cuanto a la edad en que los estadios se manifestan. Los
estadios estn integrados jerrquicamente; es decir, la aparicin de nuevos estadios o
estructurasdepensamientoincluyenalasestructurasprecedentes.
Cadaestadioestcaracterizadoporunaestructuradeconjunto(oesquemasdepen-
samiento)quedeterminaloquelosniospuedenhaceronoenesaetapa.Latransicin
deunestadioaotroseproducecomoconsecuenciadelaaparicindeconfictosodes-
equilibriosenlasestructurascognitivas,productodelaactuacindediversosfactoresque
vamosaanalizarenelsiguienteepgrafe.
Losfactoresdeldesarrollo:eldesarrollocomoautorregulacindeestructuras
Lasestructurasoformasdepensamientoquecaracterizanacadaunodelosestadiosson
productodediversosfactores:maduracinbiolgica,interaccinconelmundofsicoy
socialy,sobretodo,delaequilibracinoautorregulacinactiva.
1. La maduracin biolgica se manifesta en la sucesin constante de los estadios
que,comoyahemosmencionado,sigueunordenfjoparatodoslosindividuos.
PeroparaPiagethablardelosfactoresmadurativosobiolgicosdeldesarrollono
essinnimodeaspectosinnatamentedeterminadosodeprogramacingentica;
porelcontrario,partedeunplanteamientoepigentico.Esdecir,consideraque
entre las posibilidades que ofrece la base gentica y su materializacin hay un
amplioespacioparalainfuenciadeotrosfactorescomolaprctica,laexperien-
ciaolainteraccinsocial.NisiquieralalgicaesinnataparaPiaget.Lalgica
proposicionalcaractersticadelasoperacionesformalesnoesunaconsecuencia
inmediatadelalgicadelasneuronas,sinoqueeselresultadodeunasecuen-
ciadeconstruccionessucesivasquenoestnpreformadasenlaestructuranervio-
sa hereditaria. La estructura gentica posibilita que se puedan llegar a construir
las operaciones lgicas, pero para ello es necesario, adems, la confuencia de
otrosfactorescomolaexperiencia.
22 Introduccin
2. Laexperienciacomoyaavanzbamosalanalizarlaimportanciadelaaccin
infuye en el desarrollo cognitivo a partir del contacto del sujeto con el mundo
externo.Estaexperienciapuedetomardiversasformasalolargodeldesarrollo:
prcticaoejercicio,experienciafsicayexperiencialgico-matemtica.Laprc-
ticaoejerciciosuponelaconsolidacindealgunosesquemasporejemplo,el
desuccinpormediodelarepeticin.Laexperienciafsicaconllevalamani-
pulacindeobjetosy,comoconsecuencia,laobtencindeinformacinatravs
deunprocesodeabstraccin.Finalmente,laexperiencialgico-matemticades-
empea un importante papel en aquellos niveles de desarrollo cognitivo en los
queelsujetoseenfrentaanteproblemasquerequierenrazonardeductivamente.
3. Elmediosocialtambintieneciertainfuenciaeneldesarrollo.Lasetapasporlas
que pasa el nio a lo largo de su evolucin pueden acelerarse o retardarse con
respecto a la edad media en las que aparecen, en funcin del medio cultural y
educativoenelqueelniosedesenvuelve.Sinembargo,elorden,lasecuencia
deaparicindelosestadios,permaneceinvariable.Porotraparte,elmediosocial,
aligualqueelmediofsico,sloinfuyeneneldesarrollocognitivodelsujetoen
lamedidaenquestelosasimile,yslopuedehacerlo,sidisponedelosadecua-
dosinstrumentosyestructurascognitivasparaello.
4. Laautorregulacinoequilibracineselfactorfundamentaldeldesarrollopara
Piaget. Mediante el proceso de autorregulacin de las estructuras se produce un
equilibrioentrelosprocesosdeasimilacinyacomodacinqueconllevalaadap-
tacindelorganismoalmedio.Portanto,laadaptacincognitivaaligualquela
adaptacinbiolgicaconsisteenelequilibrioentreasimilacinyacomodacin.
Laasimilacinesnecesariaencuantoquegarantizalacontinuidaddelases-
tructuras;sinembargo,noessufcienteparaqueseproduzcacambiocognitivo.
Sieneldesarrollosloseprodujeraasimilacin,nohabracambiodeestructuras
yportantotampocohabraprogresocognitivo.Paraquehayacambiocognitivo
esnecesariotambinquehayaacomodacin,esdecir,queseproduzcalanece-
sariareestructuracindelosesquemasdelindividuoalainformacindelmedio.
Latendenciainicialdecualquierorganismobiolgicoeshacialaestabilidad
ynohaciaelcambio;yportanto,aunqueelorganismoescapazderealizardife-
rentesacomodaciones,stasestnsujetasaciertoslmitesimpuestosporlanece-
sidaddepreservarlasestructurasexistentes.Sinembargo,inevitablementeenla
interaccin con el entorno se producen ciertos desequilibrios o confictos a los
queelorganismonopuededarrespuestaconsusesquemasprevios,paraloque
tendrquereajustarlosoreorganizarlos(acomodacin)afndehacerlosconsis-
tentesconlasnuevasexperiencias,loqueposibilitarnuevasasimilacionesyun
nuevo equilibrio hasta que se produzcan nuevas situaciones confictivas, y as
sucesivamente.
Eldesarrollosera,pues,elprogresohaciaformasdeequilibriomsestables.
Esdecir,esunasucesindeestadosno-estables(estadiosensoriomotor,preope-
ratorioydeoperacionesconcretas)hastallegaraunestadodeequilibriofnaly
establecaractersticodelperododelasoperacionesformales.steesunproceso
quepermitelaconstitucindeestructuras,yenestesentido,eldesarrolloseraun
continuoderegulacionesqueposibilitanlaformacindeestructurasdeconoci-
mientoprogresivamentemscomplejas,sujetasanuevasysucesivasautorregu-
Captulo 1. El estudio del desarrollo humano 23
laciones,deescalnenescaln,perosinquelasformassuperioresdepensamien-
toestncontenidasenlasanteriores(vaseFigura1.6).
Implicacioneseducativasdelateorapiagetiana
5
Las implicaciones educativas de la teora piagetiana pueden analizarse en tres niveles
diferentes(GutirrezyCarriedo,2002):1)enlorelativoalarelacinentreaprendizaje
y desarrollo; 2) en relacin con la importancia de la accin del nio sobre los objetos
(aprendizajepordescubrimiento),y3)enloconcernientealpapeldelainteraccinsocial
enelaprendizaje.
5
AunquePiagetestuvointeresadoportemaseducativos,lasaplicacionesdesuteoraalaeducacinfue-
ron desarrolladas, entre otros, por HansAebli en su obra Una didctica fundada en la Psicologa de Jean
Piaget,1958.
Reflejos
y acciones
Capacidad
simblica
Operaciones
Razonamiento
formal
Nacimiento
a 14/18 meses
1. infancia
2 a 6/7 aos
Aos escolares:
6/7 a 11/12 aos
Adolescencia a edad adulta:
11/12 a 15/16 en adelante
Operaciones formales
Operaciones concretas
P. preoperacional
P. sensoriomotor
P
e
r

o
d
o
Tiempo
Figura 1.6. El desarrollo de la inteligencia segn la teora de Jean Piaget: un esquema grco.
24 Introduccin
En lo relativo a la relacin entre aprendizaje y desarrollo, una asuncin fundamental
delateorapiagetianaesqueloqueelniopuedeaprenderocomprenderenundetermi-
nado momento del desarrollo depende del estadio de desarrollo cognitivo en el que se
encuentre. Esto implica aceptar que el aprendizaje va a remolque del desarrollo y por
tanto,queunabuenaprcticaeducativadeberadecuarsusactividadesdeenseanza-apren-
dizajealniveldeldesarrollodelosaprendices.Estoseconcreta,segnBrainerd(1978)en
trestiposdeprescripcioneseducativas:1)nosedebetratardeensearalosalumnoscon-
tenidosqueestnporencimadesuniveldedesarrollo;2)losprofesoresnodebentratarde
acelerarelniveldedesarrollo,sinocentrarseenlaconsecucindeldominiodeactividades
otareasadecuadasalniveldedesarrolloenelqueseencuentranlosalumnos,y3)lase-
cuenciacin de la enseanza de conceptos nuevos en la escuela debera seguir el mismo
ordenenquelosconceptosaparecendeformanaturalduranteelcursodeldesarrollo.
Enrelacinconlaimportanciadelaaccinenelaprendizaje,hayquetenerencuen-
ta que en las primeras etapas del desarrollo, los nios no pueden formar conceptos a
partirdelasexplicacionesverbales,sinoquenecesitanmanipulardirectamentelosobje-
tos para extraer sus propiedades. Slo cuando se llega a las operaciones formales los
niospuedenrazonarsobreformulacioneslingsticas.Consecuentemente,desdelateo-
ra piagetiana se postula que hay que potenciar la enseanza a partir de la accin y la
experimentacindelosnios,loquesehadenominadoaprendizajepordescubrimien-
to.EstoseconcretasegnBrainerdenque:a)losmaterialesqueseutilicenenlaense-
anzadebenserconcretosyfcilesdeusarb)losprofesoresdeberanpotenciaractivida-
desbasadasenpequeasexperimentacionesoendemostracionessimples,msqueenla
explicacinverbaldelosconceptos.
Finalmente,enrelacinconelpapeldelainteraccinsocial,stapuedepotenciarel
aprendizajealpermitirqueelnioconfrontesuspropiospuntosdevistaconlosdelos
dems.Estaconfrontacinentredistintospuntosdevistasehadenominadoconficto
socio-cognitivo. El conficto infuira en el aprendizaje creando contradicciones o des-
equilibriosque,alintentarintegrarlosenlosesquemasprevios,puededarlugaralare-
estructuracindelosmismosy,comoconsecuencia,alprogresocognitivo.Portanto,el
conficto cognitivo o sociocognitivo sera el mecanismo a partir del cual la interaccin
socialinfuyeeneldesarrollocognitivoycomoconsecuenciaenelaprendizaje.
4.2. La gnesis social de la conciencia: la teora de Vygotski
Vygotskifueunintelectualrusoquetuvounavidacortaconunalargaproyeccinyuna
enormeinfuencia.Durantesucortaperointensavidanollegadesarrollarenprofundidad
su teora, por lo que en realidad, no se puede hablar de una teora acabada ni articulada,
sinodepinceladasointuicionesgenialessobreeldesarrollocognitivoquedespusfueron
desarrolladasporsusmsdirectoscolaboradores.Enefecto,granpartedesuobratuvoque
serrecopiladatrassumuerteporsusseguidoresmscercanosysudifusinenoccidente
slotuvolugarmuchosaosdespusdesumuerte.Estoltimofuedebidoalainfuencia
defactoressocio-histricosdedistintanaturaleza,referidosenestecaso,tantoalasituacin
polticamundial(ydelapropiaURSS),comoalahistoriadelaPsicologacomodisciplina
6
.
6
Encualquiercaso,granpartedelconocimientodelaobradeVygotskienoccidentepuedeatribuirsea
JamesWertschquiensehaaproximadoyhaprofundizadoensuobratratandodehacerlamscomprensible,
Captulo 1. El estudio del desarrollo humano 25
Figura 1.7. Lev Semionovich Vygotski.
Vygotskipartedeunaorientacinprofundamentedialcticaensuconsideracindel
desarrollo.Talycomolmismoafrma:
Latareaqueseleplanteahoyendaalapsicologaesladecaptarlapeculia-
ridadrealdelaconductadelnioentodasuplenitudyriquezadeexpansiny
presentarelpositivodesupersonalidad.Sinembargo,elpositivo
7
puedehacerse
tansloenelcasodequesemodifquederazlaconcepcinsobreeldesarrollo
infantilysecomprendaquesetratadeuncomplejoprocesodialcticoquesedistinguepor
unacomplicadaperiodicidad,ladesproporcineneldesarrollodelasdiversasfunciones,la
metamorfosisotransformacincualitativadeunasformasenotras,unentrelazamientocom-
plejodeprocesosevolutivoseinvolutivos,elcomplejocrucedefactoresexternoseinternos,
uncomplejoprocesodesuperacindedifcultadesydeadaptacin(Vygotski,1996p.142).
Enlneasgenerales,sepuedeafrmarquelateoravygotskianasearticulaentornoa
lapreocupacinbsicasobreelorigensocialdelaconciencia,preocupacinenlaque
sepuedenobservartresdelostemasqueconstituyensuentramadotericobsico:
1. Perspectivagentica
8
oevolutiva.ParaVygotskielpsiclogoevolutivodebepre-
guntarse por el signifcado, por lo que representa una forma de conducta dada.
Responderaestapreguntasignifcadescubrirsuorigen,lahistoriadesudesarro-
llohastaelmomentopresente.
2. Intersporlosprocesospsicolgicossuperioresengeneralyporlaconcienciaen
particular.
por lo que en adelante, su obra Vygotski y la formacin social de la mente (1985/1988) nos servir como
fltroparaelanlisisdelasideasdeVygotski.Tambinhatenidounaimportantecontribucinparasucom-
prensinennuestropas,elmonogrfcodedicadoaesteautorporpartedelarevistaInfanciayaprendizaje
enelao1984ylapublicacindesusObrasescogidasen1996.
7
Vygotskidefendequealniohayqueestudiarlonoporloquenotieneencomparacinconeladulto
(caracterizacinnegativa)sinoporsuspeculiaridadespositivasquelodiferenciandeladulto.
8
Porperspectivagenticadebeentenderseaqulareferidaalapreocupacinporlagnesis(origen)de
lasfuncionespsicolgicassuperiores(atencin,formacindeconceptos,memoria,resolucindeproblemas,
etc.)ycmostasvanevolucionandoalolargodeldesarrollo,noacmolaherenciabiolgicaestransmitida
deunageneracinalasiguiente.
26 Introduccin
3. Origendeestosprocesosenlamediacinsocial,esdecir,suintersencmola
interaccinconlosdemsyelusodeinstrumentosdemediacinpuedeinfuir
enlagnesisdelaconcienciaindividual.
Veamosmsdetenidamentecadaunodeestostresaspectos.
Lagnesissocialdelosprocesospsicolgicossuperiores
Vygotskisostienequeelcrecimientointelectualdelosniosenelsenodeunaciviliza-
cinimplicaunafusindelosprocesossocialesydelosprocesosmadurativos.Ambos
planos social y natural coinciden y se confunden entre s a lo largo del desarrollo
formandounaunidadenunarelacindemutuainterdependencia.
Vygotskidiferenciadoslneasdedesarrollo:lalneanatural,asociadaalasfunciones
psicolgicaselementalesquecompartimosconlosanimales(ver,or,asociarestmulos,
etctera); y la lnea social o cultural, vinculada a las funciones psicolgicas superiores
(atendervoluntariamente,razonar,formarconceptos,resolverproblemascomplejos,etc.),
propias de la especie humana. En este sentido, el desarrollo ontogentico es visto por
Vygotskicomounconjuntodecambioscualitativosresponsablesdelatransicindefor-
maselementalesdepensamientohacialasfuncionespsicolgicassuperiores.
El curso natural del desarrollo est sujeto al control estimular del entorno, es muy
dependiente de los procesos madurativos tiene por tanto un origen individual y el
individuonotieneconcienciadelmismo.Estalneadedesarrollooperadeformainde-
pendientedurantelaprimerainfanciaparaprontointegrarseenlalneacultural.
Lalneaculturaldeldesarrollotienelugaratravsdelainteraccinsocial.Losseres
humanosevolucionanparaadaptarsealmundoatravsdelacooperacinsocial.Yades-
deelmomentodelnacimientolosbebsinteractanconotraspersonasatravsdeformas
culturalesdistintas,propiasdelentornosocialenelqueviven.Atravsdelainteraccin
social los nios adquieren herramientas culturales o signos (el lenguaje, el sistema
numrico,eldibujo,etc.)quelespermitenunamejoradaptacinalmundosocial,aligual
queelusodeherramientasfsicaspermiteunamejoradaptacinalmundonatural
9
.Por
tanto,lalneaculturaldeldesarrollotieneunorigensocial.Lautilizacindesignosper-
mitetransferirelcontroldesdeelambiente,alindividuoy,comoconsecuencia,latoma
de conciencia de los procesos psicolgicos y la emergencia de la regulacin voluntaria
delcomportamiento.
As, para Vygotski, los procesos psicolgicos superiores tienen primero un origen
interpsicolgico(social)oexterno,paraposteriormente,atravsdeunprocesodeinter-
nalizacin,convertirseenintrapsicolgicos(individuales)ointernos:
9
Sobreestetemavolveremosyprofundizaremosenelepgrafesobremediacinsemitica.Ellectordebe
relacionareintegrarlainformacinproporcionadaenambosepgrafes.
Eneldesarrolloculturaldelnio,todafuncinaparecedosveces:primero,a
nivelsocial,ymstarde,anivelindividual;primero,entrepersonas(interpsi-
colgica),ydespus,enelinteriordelpropionio(intrapsicolgica).Estopue-
de aplicarse igualmente a la atencin voluntaria, a la memoria lgica y a la
Captulo 1. El estudio del desarrollo humano 27
Estoesloquesedenominaley gentica general del desarrollo cultural o ley de la
doble formacinporquelosprocesospsicolgicosnosonunasimplecopiainternadelos
procesossociales,sinoqueestosprocesoshanderecrearse,reconstruirsedenuevoenel
planointrapsicolgico,atravsdelprocesodeinternalizacin.
Lainternalizacincomognesisdelarepresentacinydelaconciencia
Lainternalizacineselprocesopormediodelcualciertosaspectosdelaestructuradela
actividadexternapasanaserejecutadosenunplanointerno(psicolgico).Perocomoya
hemosdicho,nosetratadeunacopiaosimpletransferenciadelaactividadexterna,sino
queelprocesomismodeinternalizacintransformalapropianaturalezadelaactividad
cambiando su estructura y sus funciones. La internalizacin es, pues, la base del salto
cualitativodelapsicologaanimalalahumana.
Elnio,alolargodesudesarrollo,empiezaaaplicarasupropiapersonalasmismas
formasdecomportamientoquealprincipiootrosaplicabanconrespectoal.Asimilalas
formassocialesdeconductaylastrasfereasmismo.Veamoscmoexplicaelpropio
Vygotskiestaevolucinconrespectoalgestodesealar:
Al principio, el gesto indicativo no era ms que un movimiento de alcance
fracasadoorientadohaciaelobjeto.[...]Elniointentaasirunobjetoalejado
de l, tiende sus manos en direccin al objeto, pero no lo alcanza, sus brazos
cuelganenelaireylosdedoshacenmovimientosindicativos.[...]Elnio,con
sumovimientoslosealaobjetivamenteloquepretendeconseguir.
Cuandolamadreacudeenayudadelhijoeinterpretasumovimientocomounaindica-
cin,lasituacincambiaradicalmente.Elgestoindicativoseconvierteengestoparaotros.
Enrespuestaalfracasadointentodeasirelobjetoseproduceunareaccin,peronodelob-
jeto,sinoporpartedeotrapersona.Sonotraspersonaslasqueconferenunprimersentido
al fracasado movimiento del nio. Tan slo ms tarde, debido a que el nio relaciona su
fracasadomovimientocontodalasituacinobjetiva,lmismoempiezaaconsiderarsumo-
vimientocomounaindicacin.
Vemos,portanto,quesemodifcalafuncindelpropiomovimiento:deestardirigidoal
objetopasaaserdirigidoaotrapersona,seconvierteenunmedioderelacin;elalcance
setransformaenunaindicacin.Graciasaelloelpropiomovimiento[dealcance]sereduce,
seacortayasumelaformadegestoindicativoquepodemosdefnircomogestoparas.Sin
embargo,enelgestoparaselmovimientonocambia,siguesiendocomoalprincipio,indi-
cacinens,esdecir,poseeobjetivamentetodaslasfuncionesimprescindiblesparalaindi-
cacin y el gesto dirigido a los dems, es decir para ser comprendido y tomado en cuenta
comoindicacinporlagentequelerodea.
Elnio,portanto,eselltimoentomarconcienciadesugesto.Susignifcadoyfuncio-
nessedeterminanalprincipioporlasituacinobjetivaydespusporlagentequerodeaal
nio(Vygotski,1996,p.146).
formacindeconceptos.Todaslasfuncionesseoriginancomorelacionesentresereshuma-
nos(Vygotski,1960/1979,p.94delatraduc.cast.).
28 Introduccin
Enestasimgenespodemosverunailustracindelaevolucindelgestodesealar.Alprincipio(ima-
gendelaizquierda)elniopequeoloutilizacomounaprolongacindesumovimientodealcance,dirigi-
dofundamentalmentealobjetoynoalaspersonas.Enlasotrasdosimgenesobservamoscmoelgestode
sealaresutilizadotantoporlosadultoscomoporlospropiosnioscomomedioparadirigirlaatencinde
lasotraspersonashacialosobjetos.Elniohainteriorizado,atravsdelainteraccinconlosadultos,la
funcindelgesto,yloutilizayacomounmedioparadirigirlaatencindelosotros(imagendeladerecha).
Lainternalizacineselprocesoporelquepasamosasernosotrosmismosatravs
delosotros,locualseextiendetantoaldesarrollodelapersonalidadelnioempieza
aconsiderarse,averseatravsdeloquesignifcaparalosdems,comoaldelasfun-
cionespsicolgicassuperiores.Alprincipio,lasfuncionessuperioresdelpensamientose
manifestansocialmente,enformadediscusionesdurantelainteraccinsocialque,cuan-
doseinternalizan,seconviertenenrefexin.
Elprocesodeinternalizacinesdenaturalezadinmicaydialctica:cualquiercambio
queseproduceanivelinterpsicolgico(social)sereconstruyeenelplanointrapsicol-
gico (individual), y a la inversa. Es por ello, por lo queVygotski plantea una relacin
entreambosplanos:losprocesospsicolgicosinternossoncreadosmercedalaexposi-
cindelnioaformasculturalesmadurasdecomportamientoalasquesetieneacceso
atravsdelosinstrumentosdemediacin.
Mediacinsemitica
Alparecer,segncuentaA.R.Luria(1979),unodesusmejoresamigos,aVygotskile
gustabamuchounaforismodeRogerBacon:Necmanusnuda,necintellectussibiper-
missusmultumvalent,instrumentisetauxilibusresperfcitur...[Nilamanoporssola,
ni el intelecto por s mismo tiene mucho poder. Los resultados se obtienen con instru-
mentosyayuda,quesontannecesariosparaelentendimientocomoparalamano.]
EstacitaalaquealudeLuriarefejalaesenciadelpensamientodeVygotski.Para
esteautor,todaslasaccionesquerealizanlossereshumanosseandenaturalezaf-
sica(sobrelosobjetos),psicolgicas(enrelacinconunomismo)osociales(enrela-
cinconlosdems)estnmediatizadasporelusodeinstrumentosauxiliaresohe-
rramientas. Dependiendo de la naturaleza de las acciones, estas herramientas pueden
serdedostipos:
Captulo 1. El estudio del desarrollo humano 29
1. Herramientasmaterialesotcnicas.Sonlasqueseutilizanpararealizaracciones
sobreelmundofsico,esdecir,sobrelosobjetos.
2. Herramientaspsicolgicas.Sonsignosysmbolosqueseutilizancomomedios
parainfuirpsicolgicamentebienenlapropiaconducta,bienenladelosdems.
LoqueVygotskiafrmaesquealigualquelaactividadnaturalestmediadaporhe-
rramientas(p.ej.,elagricultorutilizaunaradopararoturarlatierra),laactividadsocial
tambinestmediadaporherramientasenestecasoculturalesquenosonmsque
convenciones sociales sobre las pautas de interaccin, o sobre el uso de determinados
objetos.
Estasherramientaspsicolgicasdemediacincaracterizadasporlautilizacinde
signospuedenutilizarsepararegularlapropiaconductayladelosdems,yesloque
caracterizalalneaculturaldeldesarrollo.
Entre las herramientas psicolgicasVygotski destaca el lenguaje, los sistemas para
contar,lasestrategiasmnemotcnicas,eldibujoolasrepresentacionesgrfcas.Perolo
realmenteoriginaldelaconceptualizacindelasherramientaspsicolgicasrealizadapor
esteautoresqueconsideraquenosonslomediosauxiliarespararealizarciertasfun-
cionespsicolgicas,sinoquetienenlapropiedaddemodifcarelfuncionamientomental
al provocar en l cambios cualitativos. De hecho, ste es el eje central de su marco de
anlisisdeldesarrollocognitivo,queesconsideradocomoelconjuntodetransformacio-
nescualitativasqueseproducencomoresultadodeloscambiosenlosinstrumentosde
mediacinutilizados.
Actividad mediadora
Uso de signos Uso de herramientas
Actuacin sobre el entorno.
Orientadas a modificar la naturaleza.
Medio de actividad interior
dirigida a dominar al ser humano.
Figura 1.8. Instrumentos de mediacin.
Todo desarrollo aritmtico del nio ha de tener como punto de partida ante todo la
etapa natural o primitiva. Puede un nio de 3 aos decidir a simple vista qu grupo de
objetos es mayor, el de 3 manzanas o el de 7? S, puede. Pero, podr decir en qu
CON LOS PIES
EN LA TIERRA
El desarrollo de la aritmtica
(adaptado de Vygotski,1996, p.165 )
30 Introduccin
Tambinesimportantesealarqueestasherramientaspsicolgicasnosonorgnicas
ni individuales, sino que son sociales en un doble sentido: son tanto el producto de la
evolucinsocio-cultural,cuantodefactoressocialesmsconcretoscomolainteraccin
socialenpequeosgrupos.Esdecir,lossignos(contarconlosdedos),antesdeconver-
tirseenmediosdeactividadinterna(elclculomental)sonmediacionesexternasoins-
trumentosbrindadosporlosagentesculturalesconlosqueelniointeracta.
EsenestesentidoenelqueVygotskianalizalasfuncionesdellenguajelaherramien-
tasemiticaporexcelencia,primerodesarrolladocomounafuncinsocial(comunica-
tiva) al servicio de la interaccin, para despus pasar a tener una funcin individual al
montn hay 16 manzanas y en qu montn hay 19? No podr. En el primer caso se
trata de una fase natural en la que el nio simplemente compara (sin contar) las canti-
dades presentadas. Sabemos, sin embargo, que el nio pasa muy pronto, y casi imper-
ceptiblemente, de esta etapa a la otra y cuando se le pide que determine dnde hay
ms objetos, la mayor parte de los nios de un medio culto, empiezan a contar. A veces
lo hacen incluso antes de comprender lo que es el clculo.
Para comprobar si eran muchos los nios que empezaban a contar antes de com-
prender lo que es el clculo, algunos investigadores (Stern, por ejemplo) preguntaban a
un nio Cuntos dedos tienes en la mano?, el nio segua la serie numrica y res-
ponda cinco. Pero cuando le decan cuenta los dedos que tengo yo, responda no
s contar. Esto signica que el nio sabe aplicar la serie numrica tan slo a sus dedos,
pero no a la mano ajena.
Por n, el nio pasa al verdadero clculo y empieza a comprender lo que signica
contar sus dedos; sin embargo, sigue hacindolo con ayuda de signos externos. En esta
etapa, el nio slo cuenta con los dedos y si le plantean el siguiente problema: aqu
tienes 7 manzanas, quita 2, cuntas manzanas te quedan?, el nio, para resolverlo,
recurre a los dedos. Pone 7 dedos, quita 2 y responde que 5. Es decir, resuelve el pro-
blema con ayuda de signos externos. Basta con prohibirle que mueva las manos para
que no pueda realizar la operacin correspondiente.
Como sabemos, el nio deja muy pronto de contar con los dedos para contar men-
talmente. El nio de mayor edad no necesita los dedos para restar 2 de 7, lo hace men-
talmente. Cuando procede a esa operacin, el nio ha interiorizado el clculo.
Aplicando conocimientos:
En el ejemplo del desarrollo de la aritmtica propuesto por Vygotski podemos identicar
algunos de los supuestos fundamentales de su teora:
El concepto de mediacin. Antes de llegar a contar mentalmente el nio utiliza
los dedos como herramienta externa que le ayuda al clculo. Los dedos se con-
vierten en herramienta de mediacin que ayuda a la internalizacin de los proce-
sos mentales. Ms tarde, la herramienta de mediacin por excelencia para llegar
a hacer clculos matemticos ser la utilizacin del sistema numrico.
El clculo, al igual que el resto de las funciones psicolgicas superiores, pasa por
las mismas etapas de desarrollo: se pasa de la fase natural a la fase cultural (me-
diada por signos sociales, en este caso el sistema de los nmeros) lo que permite
contar y no slo comparar cantidades.
Todas las funciones psicolgicas superiores se generan primero en el exterior
con ayuda de medios externos (p. ej., el nio cuenta con los dedos) para
despus llegar a internalizarse (clculo mental).
Captulo 1. El estudio del desarrollo humano 31
convertirseatravsdelpensamientoverbalenunmecanismodeautorregulacindel
pensamientoydelaaccin.
Elpapeldellenguaje
Lafuncinprimariadelaspalabras,tantoenlosnioscomoenlosadultos,
eslacomunicacin,elcontactosocial.Portanto,elprimerlenguajedelnioes
esencialmentesocial,primeroesglobalymultifuncional;msadelantesusfun-
cionescomienzanadiferenciarse(Vygotski,1934/1973,p.42).
As,duranteelprimeraodevida,elhablatieneunafuncindedescargaemocional,
perotambintieneunafuncindecontactosocial.Lasprimerasreaccionesalavozhu-
mana,lasonrisasocial,losgestos,elbalbuceoyemisindelosprimerosgestoscomu-
nicativossonformasdecomunicacinprelingsticaquetienencomoprincipalfnalidad
elcontactosocial(vaseCaptulo3).Coneldesarrollo,aparecennuevasfuncionesdel
habla:lafuncincomunicativaylafuncinintelectual.Laprimera,comohemosdicho,
constituyeelinstrumentobsicodelainteraccinsocialylasegunda,sirvecomomedio
deregulacindelpensamiento.Estasdistintasfuncionesdelhablapermitendiferenciara
Vygotskientreelhablaexternacuyoorigenestenlainteraccinsocialyelhabla
internaquepermitealossereshumanosplanifcaryregularsuactividad.Enlatransicin
delhablaexternaalainternaaparecehacialos3aosladenominadahablaegocn-
trica,omonlogosqueacompaanalarealizacindeunatareaporpartedelosnios.
Portanto,alrededordelostresaos,ellenguajesocialdelnioseencuentradividido
en habla egocntrica y comunicativa. Las dos formas, tanto la comunicativa como la
egocntricasonsociales,aunquesusfuncionesdiferen.Conelhablaegocntricaelnio
tiendeatransferirasusprocesosinterioreslospatronesdecomportamientoanteriormen-
tesociales:elpequeocomienzaaconversarconsigomismocomolohaestadohaciendo
con otros. El lenguaje egocntrico, extrado del lenguaje social general, conduce a su
debido tiempo al habla interiorizada, que sirve tanto al pensamiento privado como al
simblico.Portanto,ellenguajeegocntricoesuneslabnsumamenteimportanteenla
transicindesdeellenguajeexterno(quesirveparacomunicarseconlosotros)allengua-
jeinteriorizado(pensamientoverbal).Estepapeltransicionaldelhablaegocntricaesel
queleconferetangranintersterico.
AjuiciodeLuria,eldescubrimientodequeelsentidodelapalabrasufreciertaevolu-
cinyqueelprocesonoseexplicaporlasimpleadquisicindenuevasasociacionesentre
palabrasyobjetos,sinoquetieneuncarctercualitativoyconduceanuevasformaspsico-
lgicas de conducta humana, fue uno de los ms importantes descubrimientos realizados
porVygotski.Lapalabraes,desdeestaperspectiva,launidaddesignifcacindelacon-
ciencia,dondeseencuentralaunidadentrepensamientoylenguaje,elpensamientoverbal.
Lasrelacionesentrepensamientoylenguajerefejan,comoningunaotra,loscambios
queseproducenduranteeldesarrolloqueinteresantantoaVygotski.As,esteautorpos-
tulaqueambascapacidadesnoguardanlamismarelacinalolargodeldesarrollo.
ParaVygotski, el pensamiento del nio empieza a desarrollarse con anterioridad al
lenguaje.Duranteelprimeraodelavidadelnio,elpensamientosedesarrolladema-
32 Introduccin
neramsomenosindependienteyesloqueelpropioVygotskidenominaformanatural
delpensamientoquecompartimosconalgunosprimatesnohumanos.Unaclarademos-
tracindeestosonlosresultadosdelosexperimentoshechosporKhlerenlosquelos
chimpancserancapacesderesolverciertotipodeproblemasdeformainteligente(eran
capacesdeunirdoscaasparaalcanzarunpltanoqueestabasituadofueradelajaula).
Igualmente,losbebsalfnaldelprimeraotambinsoncapacesdeutilizarciertosme-
diosparaconseguirfnes,aunquesuscapacidadeslingsticasenestemomentoseanan
muylimitadas.
Sin embargo, en cierto momento del desarrollo alrededor de los dos aos el
pensamientoyellenguajequehastaelmomentosehabandesarrolladodeformainde-
pendiente,confuyen.Estoocurrecuandoelniosedacuentadequecadacosatienesu
nombreyempiezaahacerpreguntasyainteresarseporelnombredelascosas.Tambin
observqueenestemomento,losniosenfrentadosantelasolucindeunproblema
comoeldeloschimpancsempezabanaemitirpalabrasyfrasesdirigidashaciaellos
mismos(hablaegocntrica)quelesfacilitabanlaresolucindelproblema.Adems,com-
probqueestasemisionesegocntricaseranmsfrecuentesamedidaqueaumentabala
difcultaddelatarea.EstofueinterpretadoporVygotskicomounaevidenciaafavordel
cambiodefuncindellenguaje,quepasabaasatenerunafuncindeplanifcacinyde
regulacindelaaccin,esdecir,delpensamiento.Lafuncindellenguajecomoregula-
dordelpensamientoquecomienzahacialosdosaos,seconsolidahacialoscuatroaos
deedad.Esenestemomento,cuandoellenguajeyelpensamientoquesehabandesa-
rrolladodeformaindependientesefundenatravsdelainteriorizacindelhablaego-
cntricaydanlugaralpensamientoverbal.Portanto,lasrelacionesentrepensamiento
yhablanosonestticasalolargodeldesarrollo,sinodinmicasydialcticas.Ellengua-
je no actuara, pues, como mera comparsa del pensamiento, no es simplemente su ve-
hculo de externalizacin, sino que se convierte en su herramienta fundamental. En la
Tabla1.1,puedenverseresumidaslasdistintasfuncionesquetieneellenguajealolargo
deldesarrollo.
Tabla 1.1. Funciones del lenguaje a lo largo del desarrollo.
1. Comienzateniendounafuncincomunicativaysocialquepermitelainteraccinconlosdems.
2. Durante la transicin al plano intrapsicolgico a travs del habla egocntrica se desarrolla una
nueva funcin no comunicativa del lenguaje: una funcin relacionada con el pensamiento y con la
regulacindelaaccin.
3. Seacabaconfundiendoconelpensamientoyconvirtindoseenuninstrumentodeautorregulacina
travsdelhablainternayenunaformadedarsignifcadoalapropiaconciencia.
Ahora bien, para cerrar completamente el ncleo argumentativo de la teora de
Vygotskiquedarapordeterminarculessonlascaractersticasqueregulanelfunciona-
mientointerpsicolgico,ascomolosprocesosimplicadosenlainteraccinquepermiten
la mediacin semitica del lenguaje y la internalizacin. Para que esto tenga lugar han
dedarsealgunascondiciones,entreellas,querealmentesepuedaproducirunacomuni-
cacin efectiva entre los interlocutores que forman parte de la interaccin, lo que nos
lleva a considerar otros dos conceptos importantes: la zona de desarrollo prximo y la
intersubjetividad.
Captulo 1. El estudio del desarrollo humano 33
Lazonadedesarrolloprximo(ZDP)
Cuando hablamos de niveles evolutivos, tenemos que delimitar como mnimo dos. El
primerodeellospodradenominarsenivelevolutivoreal,esdecir,elniveldedesarrollo
delasfuncionesmentalesdeunnio,establecidocomoresultadodeciertosciclosevo-
lutivosllevadosacaboyquelepermitenresolverciertosproblemasdeformaindepen-
diente. Por ejemplo, cuando establecemos la edad mental de un nio utilizando tests,
tratamoscasisiempreconelnivelevolutivoreal.Elotronivelnoslomuestraelconcep-
to de la zona de desarrollo prximo (ZDP). No es otra cosa que la distancia entre el
nivelrealdedesarrollodeterminadoporlacapacidadderesolverindependientemente
unproblemayelniveldedesarrollopotencial,determinadoatravsdelaresolucin
de un problema bajo la gua de un adulto o en colaboracin con otro compaero ms
capaz.Entonces,quesloquedefnelazonadedesarrolloprximo,establecidaporlos
problemasquelosniosnopuedenresolverporssolos,sinonicamenteconlaayuda
dealguien?Dichazonadefneaquellasfuncionesquetodavanohanmadurado,peroque
sehallanenprocesodemaduracin,funcionesqueenunmaanaprximoalcanzarnsu
madurezyqueahoraseencuentranenestadoembrionario.Lazonadedesarrolloprxi-
monospermitetrazarelfuturoinmediatodelnio,ascomosuestadoevolutivodinmi-
co,sealandonosloloqueyahasidocompletadoevolutivamente(niveldedesarrollo
real),sinotambinaquelloqueestencursodemaduracin.
Elestadodeldesarrollomentaldeunniopuededeterminarsenicamentesiselleva
acabounaclarifcacindesusdosniveles:delnivelrealdedesarrolloydelazonade
desarrolloprximo.
El concepto de zona de desarrollo potencial refeja la concepcin del desarrollo de
Vygotskicomounprocesodeinternalizacindelosinstrumentosdemediacinsemi-
ticaque,comoellenguaje,estnactivosenlassituacionesdeinteraccinentrelasper-
sonas (Rivire, 1984/85). Estos instrumentos, transmitidos culturalmente, modifcan el
funcionamientomentalindividualalalterarporcompletoelfujoylaestructuracinde
lasfuncionespsicolgicas.Estosloesposiblecuandoseestablecenvnculosdecomu-
nicacinentrelosparticipantes,procesoenelcualintervienelaintersubjetividad.
Laintersubjetividad
Enunasituacindeinteraccinhayocasionesenquelosinterlocutorespuedendiferiren
sudefnicindelamisma,estoes,ensurepresentacindelosobjetosoacontecimientos
queformanpartedeella;discrepancia,queesprecisamenteunadelascaractersticasde
la interaccin adulto-nio en la zona de desarrollo prximo. Cuando un nio trata de
realizarunatareabajolatuteladeunadulto,ambosseencuentranantelamismasituacin
objetiva, pero parten de representaciones o defniciones diferentes de la tarea. En estas
circunstancias, la cuestin que se plantea, es cmo se puede establecer entre ellos una
comunicacinefectivaquepermitaaladultoactuarenlazonadedesarrolloprximodel
nio.Pararesolveresteproblemaesnecesariosuponerqueambosdebenpartirdecierta
representacin compartida (aunque sea en un grado mnimo) de determinados aspectos
delasituacin,aloquesehadenominadointersubjetividad.
Este constructo ha sido investigado y ampliado dentro de la propia perspectiva
vygotskianaporalgunosdesusseguidores.EntreestostrabajosdestacanlosdeRom-
34 Introduccin
menveit(1979)oWertsch(1979).Porejemplo,Rommentveit(1979)sealaquelainter-
subjetividad slo es posible cuando los participantes en la interaccin son capaces de
trascendersuspropiosmundosprivados(suspropiasrepresentaciones)paracrearmundos
(orepresentaciones)compartidos.Estopuedehacerseatravsdelosactosdecomunica-
cinenlosquesecreanrepresentacionescompartidassujetasaunaconstantemodifca-
cinporlospropiosactosdelhabla.
Laexplicacindelcambio
Enprimerlugar,convieneinsistirenquecomohemosvistoanteriormenteelgran
saltoqueseproduceeneldesarrolloesparaVygotskielquetienelugarcomoresultado
delaaparicindelosinstrumentossemiticosdemediacinquemotivanladesaparicin
delalneanaturaldeldesarrolloparadarlugaraldesarrollosocial.Sinembargo,estos
instrumentossemiticosnoconllevancambiosestructuraleselsurgimientodeestruc-
turasmorfolgicasnuevassinoreestructuracionesfuncionalesdelasyaexistentes.Por
tanto,loscambiosafectantantoalaorganizacinmismadelaconcienciayasusrelacio-
nesinterfuncionales,comoalaregulacindelcomportamientoquepasadeunaregula-
cin interpsicolgica, externa o social, a una regulacin intrapsicolgica, interna y por
tantoindividual.
Sinembargo,lateoradeVygostkynoselimitaalaexplicacindelcambioontoge-
ntico(eldesarrollodelindividuodesdeelnacimientohastalamuerte),sinoquelaex-
tiendetambinalplanoflogentico(eldesarrollodelaespeciehumana),socio-histri-
co (la historia de una determinada sociedad), y microgentico (el desarrollo que se
produceenuncortoperododetiempodeunprocesopsicolgicodeterminado).
Enlosdiferentesplanosdeldesarrollooperandistintasfuerzasdeldesarrolloydis-
tintosprincipiosexplicativos.As,eneldominioflogentico,elmecanismoresponsable
delcambioseralaseleccinnatural.Laevolucinesunacondicinnecesariaparaque
seproduzcanloscambiosorgnicosenelcerebroquedefnenanuestraespecie,perono
essufciente;enlaconformacindelserhumanocomotal,esnecesaria,adems,lacon-
fuenciadefenmenossocioculturalescomoeltrabajoylacomunicacin.
Los principios explicativos del dominio sociohistrico son los instrumentos de me-
diacin(herramientasysignos)atravsdeloscualessetransmitelacultura.Yespreci-
samenteladescontextualizacindeestosinstrumentosdemediacinestoes,laprogre-
siva independencia de los signos del contexto espacio-temporal en el que son
utilizados lo que permite la evolucin o cambio cultural, proceso al cual Vygotski
tambinvinculalaevolucincognitivadelosprocesospsicolgicossuperioresdesdelas
formasrudimentariasoelementaleshaciaformasavanzadas.
Alcontrarioqueenlosdosanteriores,eneldominioontogentico,elcambioimpli-
calaoperacinsimultneaointeraccindemsdeunafuerzadedesarrollo:losfactores
biolgicosonaturalesylosfactoresculturales.Ambostiposdefactoressonindisociables
y actan como una unidad. La explicacin de los cambios en el dominio ontogentico,
pues,nopuedereducirseaunconjuntodeprincipiosmsomenosgenerales.Porelcon-
trario, el reto es dar cuenta de las relaciones cambiantes entre las distintas fuerzas del
desarrolloysuscorrespondientesprincipiosexplicativos.Enestesentido,esteautorsos-
tienequelaaparicindeundeterminadoprocesopsicolgicollevaconsigolaentradaen
juegodenuevasfuerzasdedesarrolloynuevosprincipiosexplicativosquesonproducto
Captulo 1. El estudio del desarrollo humano 35
delareorganizacinqueseproduce.Estosnuevosfactoresnosustituyenalosanteriores,
sinoquedebenserincorporadosalaestructuraexplicativageneral.Enconsonanciacon
estalneaderazonamiento,Vygotskirechazalasteorasdeldesarrolloqueproponenun
nico conjunto de principios explicativos. As, el cambio cognitivo est asociado a la
aparicindenuevasformasdemediacinqueproporcionanalosniosuncrecientedo-
miniodelosmecanismosymediosdepensamiento(VygotskiyLuria,1930).
Implicacioneseducativasdelateoravygotskiana
Comoyahemosmencionadoanteriormente,lateoravygotskianadesdeelpuntodevis-
ta terico es menos consistente y articulada que la teora piagetiana; sin embargo, sus
aplicacionesalmbitoeducativohansidomuchomsimportantesysignifcativas.Yesto
esassindudaalgunaporqueparaVygotskieldesarrolloesaprendizajemediadosocial-
mente.PorelloVygotskisealejatantodeposicionesracionalistasquesuponenquelos
procesosdeldesarrollodelniosonindependientesdelaprendizaje,comodeposiciones
asociacionistasquesuponenqueelaprendizajeesdesarrollo;perotambindeposi-
ciones ms constructivistas como la piagetiana que trata de supeditar el aprendizaje al
niveldedesarrollodelosnios.
LaposicintericadeVygotskirespectoalarelacinentreaprendizajeydesarrollo
tratadeanularlosextremosdelasanterioresafrmacionescombinndolasentres.Apren-
dizajeydesarrollosonparaVygotskiprocesosinterdependientes,endondeelaprendiza-
je es condicin indispensable para que el desarrollo se produzca. Por eso el concepto
fundamentalparaentendersusrelacioneseseldelazonadedesarrolloprximo.
LaconceptualizacindelaZDPpermitetantobucearenelprocesomismodeforma-
cin o gnesis de las funciones psicolgicas superiores, como la profundizacin en las
relacionesentreaprendizajeydesarrollo.Lazonadedesarrolloprximodefneelmargen
en el que el aprendizaje puede actuar dentro de los lmites impuestos por el desarrollo
realyeldesarrollofuturo.Eldesarrolloyelaprendizajesondosprocesosquecoexisten
yseentrecruzanenunacomplejainterrelacindelaquenopuedenseraisladoscomple-
tamente,aligualquesucedeconlosplanosintraeinterpsicolgicoconlosquepueden
ser,respectivamente,identifcados.Lainstruccinenelplanointerpsicolgicopue-
de estructurarse de tal forma que se maximice el funcionamiento intrapsicolgico el
desarrollo,yesenestesentidoenelqueVygotski(1956/84)afrmaquelaverdadera
enseanzaeslaqueseadelantaalniveldedesarrollo.
Lo que crea la zona de desarrollo prximo es un rasgo esencial de aprendizaje; es
decir,elaprendizajedespiertaunaseriedeprocesosevolutivosinternoscapacesdeoperar
slocuandoelnioesteninteraccinconlosadultosdesuentornooencooperacin
conalgnsemejantemscompetente.Unavezquesehaninternalizadoestosprocesos,
seconviertenenpartedeloslogrosevolutivosindependientesdelnio.Aspues,elapren-
dizajeesunaspectouniversalynecesariodelprocesodedesarrolloculturalmenteorga-
nizadoyespecfcamentehumanodelasfuncionespsicolgicas.
ElrasgoesencialdelateoradeVygotskieslanocindequelosprocesosevolutivos
nocoincidenconlosprocesosdeaprendizaje.Porelcontrario,elprocesoevolutivovaa
remolque del proceso de aprendizaje. De esto se desprende lo que quiz sea la mayor
implicacin educativa de la teora vygotskiana: para establecer adecuadamente el nivel
dedesarrollodeunnio,nobastaconanalizareldesarrolloactualenunaspectoconcre-
36 Introduccin
to,sinoquehayquedeterminartambinsudesarrollopotencial.Esdecir,analizarloque
escapazdehacerporsmismoyloqueseracapazdehacerconelapoyodeunadulto
ouncompaeromscapaz.Porello,paraVygotskilanicaenseanzabuenaeslaque
seadelantaalniveldedesarrollodelosnios,esdecir,laqueescapazdepromoverlo.
Unconceptorelacionadoconlazonadedesarrolloprximoquehasidopropuestopor
losseguidoresdeVygotskieseldeandamiaje,procesoenelqueeladultovaescalonando
lasayudasqueproporcionaalnioajustndolasalahabilidadcrecientedelnio:eladulto
brindamuchasmsayudasalprincipiocuandoelnioesmenoshbilyvahacindo-
lasdesapareceramedidaqueelnioalcanzamscompetencia(vaseCaptulo3).
Otradelasaplicacionesdelateoravygotskianaalaeducacintienequeverconel
estudiodelainfuenciadelasinstitucionesculturaleseneldesarrollo.Enestalneades-
tacan los trabajos iniciales realizados por Luria en Uzbekistn y Kirguisia durante los
aostreintasobrelaincidenciadelosprocesosdealfabetizacineneldesarrollodelos
individuos(Luria,1980);olosdeScribneryCole(1973)ylosdelLaboratoriodeCog-
nicinHumanaComparada(LCHC,1983)sobrelainfuenciadelaescolarizacinenlos
cambios cognitivos. Esta perspectiva parte de cierto relativismo cultural, al considerar
que el desarrollo es un proceso que consiste en la apropiacin de los instrumentos de
pensamiento, sistemas de valores, costumbres, ideologas, medios simblicos de repre-
sentacin,etc.,queproporcionacadacultura.Desdeestaperspectivaseentiendelaedu-
cacincomoelconjuntodeprocesosdesocializacinyelprincipalvehculodeadquisi-
cindelaspautasculturales.
4.3. Comparacin entre las teoras de Piaget y Vygotski
Lateorapiagetianahasidocaracterizadacomointelectualista,enlamedidaenquepri-
malosaspectoscognitivossobrelosafectivosylosmotivacionalesyconstructivista,en
lamedidaenqueeldesarrolloescontempladocomoelproductodelainteraccindial-
cticaentrelasestructurascognitivasoesquemasmentalesdelindividuoyelmedio.En
este sentido constituye una superacin tanto de las posiciones asociacionistas clsicas
como de las eminentemente racionalistas. La teora piagetiana es, adems, estructural
porque propone que los cambios producidos como consecuencia del desarrollo pueden
caracterizarsecomocambiosenlasestructurasmentales,entantoqueimplicanunaau-
tntica reestructuracin de las mismas, dando lugar a la aparicin o emergencia de es-
tructurascualitativamentediferentes.
VygotskicomparteconPiagetsuorientacineminentementeevolutivayunavisin
constructivista,interaccionistaydialcticadeldesarrolloenlaqueseabogaporcambios
cualitativosdenaturalezacompleja.Aligualquelateorapiagetiana,lateoravygotskia-
napuedecaracterizarsedeintelectualistaenelsentidoqueenellaseprimalagnesisde
laconcienciaydelosprocesoscognitivossuperiores,peroadiferenciadePiaget,Vygots-
kilosabordadesdeunaperspectivaquepuededenominarsehistrico-culturalalconside-
rarqueelplanosocialesdonderesideelorigendelpensamiento.
Sin embargo, ambas teoras diferen en algunos aspectos fundamentales.Ya hemos
vistoalolargodelcaptulosudiferenteconceptualizacinsobrelasrelacionesentrede-
sarrollo y aprendizaje por lo que no nos vamos a detener ms en ello. Sus posiciones
tambindivergenenrelacinconlosdeterminantesdelcambio,laimportanciaotorgada
alainteraccinsocialyelpapeldellenguaje.
Captulo 1. El estudio del desarrollo humano 37
Con respecto a los determinantes del cambio, como ya se ha visto, para Piaget el
progreso cognitivo se logra mediante la autorregulacin de las estructuras cognitivas o
esquemas de conocimiento que tienden hacia un equilibrio cada vez ms estable. Para
Vygotski, sin embargo, los factores responsables del desarrollo residen en la compleja
interaccinentrelosfactoresmadurativosylosaprendizajessocialyculturalmenteme-
diados. Precisamente, tambin es en la importancia concedida a la interaccin social
donde ambos autores discrepan profundamente. Mientras que paraVygotski es la base
fundacional de los procesos psicolgicos superiores, para Piaget es un factor necesario
peronosufcientedeldesarrollo,enelsentidodequeprovocadesequilibriosqueactua-
ran como desencadenantes del pensamiento operatorio provocando nuevos niveles de
regulacin.Sinembargo,peseasudiferenteconceptualizacineimportanciaatribuidaa
lainteraccinsocial,ambosautorescoincidenenquelainternalizacindelospatrones
deinteraccinescrticaalsuponerlareconstruccin,enelplanointerno,delosprocesos
queocurrenenelexterior.
Finalmente,elpapelotorgadoallenguajeescompletamentediferenteenambaspers-
pectivas.MientrasqueparaPiagetellenguajesurgeyevolucionacomounamanifesta-
cindeunacapacidaddecarctermsgenerallafuncinsimblicaqueapareceal
fnaldelperodosensoriomotor,Vygotskileatribuyeunpapelfundamentalenlaregula-
cindelasinteraccionessocialesycomomediodeautorregulacindelpensamiento.
5. A modo de conclusin: el desarrollo humano
en su conjunto
AlaPsicologadelDesarrollonoleinteresaloqueunnio,unadolescente,unjoven,un
adultoounviejohaganenundeterminadomomento,sinoloquepotencialmentepueden
ser capaces de hacer. Piaget, por ejemplo, contribuy decisivamente a la consolidacin
denuestradisciplinaporquesuperlamerapsicologadelostestsdeinteligencia,donde
loqueprimaeslapuntuacinquealguienobtieneconrespectoaalguien,peronadanos
dicedelosverdaderosprocesosdelpensamientodeesealguien.Vygotskiacueltr-
minodezonadedesarrolloprximoparareferirseaesafranja,vitalparatodosnosotros,
enlaquenosjugamosnuestrodestino,elespacioquemediaentrenuestraspotencialida-
des, lo que seramos capaces de hacer si nos quitan los obstculos o si nos encauzan
debidamenteyloquehacemos,oqueactualizamos,dejadosanuestrapropiasuerte.En
estoPiagetyVygotskiestabantotalmentedeacuerdo,noquerancatalogar,puntuar,je-
rarquizar, numerar, sino entender. Deca Vygotski siempre bajo el infujo de Spinoza:
Procurarnoasombrarse,norerse,nollorar,sinocomprender.
La Psicologa del Desarrollo tiene dos vertientes: por un lado, el estudio de lo que
noshacesemejantes,locomnatodos,lomsabstractoogeneral,y,porotrolado,debe
abordarlasdiferenciasindividuales,lascaractersticaspropiasdecadapersona.
Enlosltimostiemposgozadeunaparticularatencinelestudiodelestadoinicial,
lapsicologadelrecinnacido.Porqu?Alosinnatistaslesinteresasabercmoveni-
mosalmundoparapoderdemostrarquecasitodoseencuentraenciernes,yaenelesta-
doinicial.Quierendemostrarexperimentalmentequelamentenaceyamuyenriquecida
y que todo lo que queda ser desarrollarla, pero que lo bsico ya est ah al nacer. La
cantidaddeestudiosquesehacenparavercmoelrecinnacidoylosbebsdepocos
38 Introduccin
das o meses se conducen son verdaderamente interesantes. Indudablemente haba ms
cosas de las que nunca hubiramos sospechado, pero de ah a afrmar que todo est ya
protoformadohayunsaltodemasiadolargo.Alosconstructivistastampocolesvienemal
conocerelestadoconelquevenimosequipadosparahacerfrenteaunlargoylentopro-
ceso de adaptacin.Adaptacin a un medio que nos ofrece mltiples oportunidades de
interaccin.Estosestudiosdelestadoinicialsonunafuentedeconocimientodelagne-
sisdelarelacinfundamentalpersona-medioatravsdelaaccin.
Unfenmenomuycuriosoquesedaenelcomplejoprocesodedesarrollodelasms
variadas capacidades es el de los desfases. Los desfases son de dos tipos: los desfases
horizontales y los desfases verticales. Con los desfases horizontales nos referimos al
hecho,reiteradamenteconstatadoenlasmsvariadasculturasyentodaslasgeneracio-
nes, de que una determinada capacidad caracterstica de un determinado nivel de desa-
rrollo no se despliega por igual cuando se aplica a distintos contenidos. En principio
podrapensarsequelaactualizacindeesacapacidadnodeberasufriresecomplejofe-
nmeno,peroelcasoesqueasesyqueesnecesarionoslodescribirlosinotambin
explicarlo.Lanocindedesfaseverticalesunpocomscompleja.Sereferealhechode
que siempre la accin precede a la conciencia.Actualizamos capacidades mucho antes
de que seamos capaces de explicar a otros cmo lo hemos hecho y a nosotros mismos
cmolohemoslogrado.Latomadeconcienciaeslacoronacindetodoprocesodead-
quisicin,deformacinodeconstruccindeundeterminadoesquema,nocin,concepto,
estrategia,procedimiento,competencia...estosconceptosentrandellenoeneldebatede
quesloquesedesarrolla:siundominiogeneralomltiplesdominiosespecfcos.Est
lamentemodularizada,encapsulada,blindadaenmltiplessistemasimpenetrables,o,por
el contrario, es un sistema general que se encarna en mltiples microsistemas? Sera
posibleunaarmonizacinentreambasposturas?
Anteestedebatequepormomentosparecetornarseinacabable,algunostericosdel
ciclovitalsehanvistoenlanecesidaddepostularentidadesintegradorascomolasabi-
dura.Algoquedsentidoalapropiaexistencia,msalldelascompetenciascognitivas,
afectivas,sociales...porseparado.Alfndecuentassomosseresnicos.
Una caracterizacin del desarrollo humano desde el punto de vista psicolgico no
estaracompletasinunareferenciaalostrastornosdeldesarrollo.Desgraciadamenteno
todas las personas logran un desarrollo pleno.Y los problemas de esas personas ponen
msderelieve,sianfueranecesario,lacomplejidadinauditadelprocesomedianteel
cuallapersonanace,sedesarrollaymuere.
Alolargodeestelibroveremosdistintasaproximacionesalciclovitalconsiderado
entodasuamplitud.Loimportanteescaptarquelapersonanodejadeevolucionaralo
largodetodasuvida.Elserhumanoesunsistemadinmicoincluidoenotrossistemas
dinmicos.Lomismoquelassociedadescambianalolargodeltiempotambinlohacen
losindividuos.Losindividuospromuevencambiossocialesylassociedadespromueven
cambiosindividuales.
Lecturas complementarias
Delval,J.(1994).Eldesarrollohumano.Madrid:SigloXXI.
Enesco,I.(2003).Eldesarrollodelbeb.Cognicin,emocinyafectividad.Madrid:AlianzaEdi-
torial.
Captulo 1. El estudio del desarrollo humano 39
Garca,R.(2006).Sistemascomplejos.Conceptos,mtodoyfundamentacinepistemolgicadela
investigacininterdisciplinaria.Barcelona:Gedisa.
Piaget,J.(1967).LaPsicologadelaInteligencia.Barcelona:Crtica,1983.
Richardson,K.(2001).Modelosdedesarrollocognitivo.Madrid:AlianzaEditorial.
Wertsch,J.V.(1985).Vygotskiylaformacinsocialdelamente.BuenosAires:Paids,1988.
Actividades
1. Lea con atencin un extracto de la entrevista que E. Surez realiz a Jay
Belsky, un famoso psiclogo, en el diario El Mundo:
P. Qu inuye ms en el desarrollo de un nio, la gentica o el entorno en el que se
educa?
R. Durante mucho tiempo hemos minusvalorado la importancia de la gentica y quiz
ahora nos estamos yendo al extremo contrario. Digan lo que digan los genetistas,
la educacin importa. Aunque no importa lo mismo para todos los nios.
P. Ah, no?
R. No. Para algunos nios el ambiente es muy importante y para otros en cambio es
irrelevante. Hay nios que son brillantes, atlticos o inteligentes porque est escrito
en sus genes y hay otros sin embargo que son brillantes, atlticos o inteligentes por
la educacin que reciben. Lo que quiero decir es que hay personas que son malea-
bles a la inuencia del entorno y otras que no lo son o lo son menos.
P. Pero esa ductilidad tambin est determinada por la gentica.
R. S, claro. Cuando nacemos, estamos de alguna manera sentenciados. Por decirlo lla-
namente, algunos estamos ms moldeados por la gentica y otros ms moldeados
por nuestro entorno, pero sa es una disyuntiva que depende de la gentica.
Podra sealar alguna contradiccin en la respuesta de Belsky?
2. Diga si las armaciones siguientes son verdaderas o falsas:
1. La Psicologa es independiente de la Filosofa y no est inuida por sta.
2. A diferencia de la Filosofa, que es una disciplina terica, la Psicologa es un
saber prctico.
3. Segn Piaget, un nio es un adulto en pequeo.
4. Todo debe ser enseado. Nada puede ser aprendido por uno mismo.
5. Segn Vygotski, para conocer cmo es el desarrollo de los nios, la mejor he-
rramienta son los tests psicolgicos.
6. Piaget y Vygotski coinciden en que lo que una persona va a ser a lo largo de
su vida se decide al nacer.
7. Para Piaget los errores en el razonamiento de los nios son arbitrarios porque
no muestran una pauta sistemtica. Cada uno dice lo que se le ocurre.
8. Segn Vygotski, si no tuviramos una lengua no podramos pensar. La lengua
es el vehculo del pensamiento.
9. Piaget y Vygotski creen que durante el primer ao de la vida de los nios no
hay desarrollo intelectual. Tan slo se dedican a dormir, comer, descansar, au-
mentar de peso y de estatura.
10. Para Vygotski las personas a lo largo de su desarrollo se apropian poco a
poco de las conquistas, avances y logros que se producen socialmente a lo
largo de la historia, en el seno de la cultura.
40 Introduccin
11. Tanto Piaget como Vygotski deenden que en el proceso de desarrollo indivi-
dual y personal se recapitula el proceso de desarrollo de la humanidad en su
conjunto.
12. Un psiclogo innatista es aqul que sostiene que lo importante para explicar
el desarrollo del lenguaje es la educacin recibida por los nios.
13. La mejor manera de estudiar la conducta humana es observarla tal cual, sin
considerar ninguna hiptesis o teora previas.
Soluciones a las actividades
Actividad 1:
Lo que arma Belsky es que todo depende de la gentica, incluso lo que no depende
de la gentica. No sabemos si es el entrevistador el que ha conducido a Belsky a esta
pintoresca armacin, a todas luces contradictoria. O es el propio Belsky quien no tiene
las cosas tan claras. Algunos estamos ms moldeados por la gentica y otros ms mol-
deados por nuestro entorno, pero sa es una disyuntiva que depende de la gentica.
O sea que habra dotaciones genticas que determinaran genticamente que lo
que va a resultar determinante en la conducta y en el desarrollo son las inuencias de
carcter ambiental, o sea, no genticas. Y cmo la gentica va a limitar a la propia
gentica?
Actividad 2:
1. Falsa. La Psicologa est inuida por presupuestos epistemolgicos que se ma-
niestan en sus distintas teoras.
2. Falsa. La Psicologa es tambin un saber terico. Son las teoras las que promue-
ven el progreso cientco y no los saberes prcticos.
3. Falsa. Si el nio fuera un adulto en pequeo, no habra desarrollo. Precisamen-
te una de las grandes aportaciones de Piaget fue el estudio de la inteligencia
desde una perspectiva evolutiva, en desarrollo.
4. Falsa. Para Piaget porque de acuerdo con su teora el nio puede aprender por
s mismo sin necesidad de los otros a partir de la accin. Sin embargo, sera
verdadera desde la perspectiva vygotskiana desde la que se postula que todo
se aprende en el seno de la cultura.
5. Falsa. Tanto la perspectiva vygotskiana como la piagetiana suponen una supe-
racin de la perspectiva psicomtrica basada en los test de inteligencia. Su pre-
ocupacin no es clasicar a los nios, ni obtener una puntuacin en diferentes
capacidades que les permitan analizar las diferencias individuales. Por el contra-
rio, lo que pretenden es la comprensin del proceso de desarrollo.
6. Falsa. Ni Piaget ni Vygotski son innatistas, sino constructivistas. Por tanto, lo que
llega a ser una persona depende no slo de su dotacin gentica sino tambin
de la cantidad, calidad y cualidad de la interaccin que mantenga con el medio.
7. Falsa. Para Piaget los errores en el razonamiento de los nios no son arbitrarios
sino sistemticos. Estn determinados por el estadio de desarrollo en el que se
encuentren.
8. Verdadera. Para Vygotski el lenguaje, al interiorizarse, se convierte en habla
interna es decir, en pensamiento.
Captulo 1. El estudio del desarrollo humano 41
9. Falsa. Precisamente, la gran aportacin de estos autores es considerar preci-
samente lo contrario, que desde el momento del nacimiento los bebs estn
construyendo su conocimiento.
10. Verdadera. Esto es lo que se denomina desde la perspectiva socio-cultural
apropiacin de los instrumentos culturales.
11. Verdadera. Vygotski al proponer que el desarrollo individual consiste en la
internalizacin de la cultura y Piaget al suponer que existe una continuidad
funcional entre la ontognesis y el desarrollo del pensamiento cientco.
12. Falsa. Los psiclogos innatistas piensan que para explicar el desarrollo huma-
no basta con acudir a la dotacin gentica.
13. Falsa. La observacin slo nos permite describir el comportamiento humano,
por lo que su estudio quedara incompleto. Para entenderlo, es necesario,
adems, lograr predecirlo y explicarlo. Por tanto, la observacin nos puede
proporcionar datos e intuiciones sobre el comportamiento humano para fun-
damentar nuestras hiptesis que despus habr que contrastar mediante la
utilizacin del mtodo cientco.
EL DESARROLLO
TEMPRANO I
BLOQUE
En este bloque vamos a tratar los inicios del desarrollo en el ser humano, perodo que se
extiende desde la concepcin hasta los 2 aos. Comenzaremos tratando algunos aspectos
bsicos del desarrollo prenatal y exponiendo una caracterizacin general del estado y las
capacidades del recin nacido. A partir de ah, comenzaremos a estudiar cmo progresan las
habilidades cognitivas, comunicativas y afectivas a lo largo de los dos primeros aos de vida.
A travs de estos captulos, el lector ver cmo los bebs empiezan a experimentar el mun-
do y las personas que tienen a su alrededor y cmo esta interaccin, guiada siempre por los
adultos, le dota de los primeros instrumentos para pensar y relacionarse. El captulo sobre la
comunicacin y el lenguaje constituye un puente de unin entre los aspectos cognitivos y
afectivos aunque, como ya hemos mencionado, no se debe olvidar que el beb es un ser
integrado, en el que lo cognitivo y lo emocional se funden.
SUMARIO
CAPTULO 2. El desarrollo cognitivo del bebe
1. El recin nacido
2. Las capacidades perceptivas del beb
3. La explicacin piagetiana del perodo sensoriomotor
CAPTULO 3. Los inicios de la comunicacin y el lenguaje
1. Comunicacin y lenguaje
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre la
polmica
44 Bloque I. El desarrollo temprano
CAPITULO 4. Desarrollo afectivo, emocional y social
1. Aproximacin histrica al estudio del apego
2. Formacin del apego
3. Desarrollo del apego
4. Tipos de apego
5. Factores que afectan a la formacin del vnculo de apego
6. Los elementos del vnculo de apego
7. Estabilidad del vnculo de apego
El desarrollo cognitivo
del beb
45
2
MARTA GIMNEZ-DAS
SONIA MARISCAL ALTARES
Esquema-resumen
Objetivos
Introduccin
1. El recin nacido
1.1. Estados y ritmos
1.2. Sistemas para recibir informacin: los sentidos
1.3. Sistemas para actuar en el mundo: los reejos
1.4. Sistemas para transmitir informacin: el llanto y la sonrisa
1.5. El cerebro del recin nacido
2. Las capacidades perceptivas del beb
2.1. La percepcin visual
2.2. La percepcin auditiva
2.3. El olfato, el gusto y el tacto
2.4. La percepcin intermodal
3. La explicacin piagetiana del perodo sensoriomotor
Lecturas complementarias
Actividades
Soluciones a las actividades
46 Bloque I. El desarrollo temprano
Objetivos
Entender cmo llega el recin nacido al mundo y los sistemas de los que dispone
desde el primer momento para comunicar sus estados y recibir informacin.
Conocer algunos aspectos bsicos sobre cmo es y cmo se desarrolla el cerebro
del recin nacido.
Comprender cmo estn organizados los sistemas perceptivos en el recin nacido,
de qu capacidades dispone desde el nacimiento y cmo evolucionan a lo largo
de los primeros meses de vida.
Entender la explicacin que proporcion Piaget sobre cmo conoce el mundo el
beb.
Diferenciar los seis subestadios del perodo sensoriomotor y comprender sus ca-
ractersticas.
Comprender y diferenciar los conceptos de reaccin circular, conducta intencional
y esquema sensoriomotor.
Esquema-resumen
1. El recin nacido
El recin nacido es un ser organizado con ritmos y estados determinados y que posee
sistemas para actuar, recibir y transmitir informacin. A travs de estos sistemas y de la
interaccin con el medio ir desarrollando estructuras cada vez ms complejas.
2. Las capacidades perceptivas del beb
A pesar de que durante mucho tiempo se pens que el mundo perceptivo del recin
nacido era un caos, gracias a las nuevas tcnicas de investigacin hoy sabemos que los
bebs perciben el mundo con un cierto orden. Algunos sentidos como el odo, el olfato
y el gusto funcionan prcticamente de forma similar a los del adulto, mientras que la
vista, dada la complejidad del propio sistema, necesita unos meses para equipararse.
3. La explicacin piagetiana del perodo sensoriomotor
Piaget propuso dentro del marco de su teora, una primera etapa en el desarrollo hu-
mano basada en la accin. Dentro de este perodo describi 6 estadios caracterizados
por:
Estadio 1: Ejercicio de los reejos.
Estadio 2: Primeras adaptaciones; reacciones circulares primarias.
Estadio 3: Reacciones circulares secundarias.
Estadio 4: Coordinacin de esquemas secundarios; conducta intencional.
Estadio 5: Reacciones circulares terciarias.
Estadio 6: Inicio de la capacidad simblica.
Captulo 2. El desarrollo cognitivo del beb 47
Introduccin
Alolargodeestecaptulovamosaofrecerunavisingeneralsobrecmollegaalmun-
do el recin nacido y cmo va desarrollando sus capacidades perceptivas y cognitivas.
Comenzaremosdandounavisinbsicayresumidasobreelestadodelrecinnacidoy
suscapacidadesperceptivas.Estascapacidadessuponenlabaseapartirdelacualelbeb
irconociendosumundo.Lossentidosconstituyenlafuenteprimeradelconocimiento.
Suestadoalnacerysuajusteenlosprimerosmesesdevidavanacondicionarlaforma
dever,escuchar,acariciar,saborearyolfatearlosobjetosylaspersonasqueconforman
sumundo.Unavezquesepamoscmovienepreparadoelrecinnacidoyculessonsus
capacidadesperceptivas,pasaremosaexponerlateoramscompletayminuciosaquese
haformuladosobrelosavancesdelpensamientodurantelosdosprimerosaosdevida.
La teora desarrollada por Piaget sobre el perodo sensoriomotor constituye uno de los
pilaresbsicosdentrodelapsicologaevolutiva.
Por cuestiones de espacio y de organizacin hemos, as, reunido en el mismo tema
doscuestionesquesesuelentratardeformaseparada:porunaparte,lapercepcinenel
recinnacidoy,porotra,laexplicacinpiagetianadelperodosensoriomotor.Evidente-
mente,tantounaspectocomootromerecenmayorextensin.Lacantidaddedatosque
hageneradolainvestigacin,lasposturastericasalrespectoylasdiscusiones,endef-
nitiva, sobre la naturaleza del conocimiento humano, son muy importantes en nuestra
disciplina.Noobstante,ellectorinteresadoencontrarrecomendadasalfnaldelcaptu-
lodiferenteslecturascomplementariasquepodrncompletarlainformacinaqupresen-
tada.Comencemos,pues,viendocmollegaalmundoelrecinnacido.
1. El recin nacido
Entrelasemana38y40degestacinseproduceelnacimientollamadoatrmino.Este
eselperodoqueseconsideranormalparaqueunbebnazca,puestoquehaalcanzado
elgradodemadureznecesarioparasobrevivirfueradeltero.Parecequeelpropiobeb
es quien provoca su nacimiento liberando una hormona en la sangre de la madre que
desencadenaelprocesodelparto.Amenudoesteprocesohasidodescritocomotraum-
tico para el beb y, en realidad, el nacimiento es ms intenso para el beb que para la
madrepuestoquesoportaaltsimosnivelesdeadrenalina.Adems,duranteelprocesodel
parto,elbebsevesometidoaimportantesvariacionesfsicasenelentorno.Enprimer
lugar,pasadeunmediooscuro,lquido,atemperaturaconstanteyconsonidosamorti-
guados, a otro luminoso, con aire, ms fro y ruidoso. Por otra parte, a partir del naci-
mientoelbebdeberdemandaralimentosyrespirarporssolo,unatareaparalaque
durantenuevemesesharecibidounimportanteapoyo.
Ladesaparicindeelementoscomolaplacenta,elcordnumbilicalyellquidoam-
niticoponenenmarchaporprimeravezalgunosdelosrganosfundamentalesparala
vida.Elbebexpulsarenelcanaldelpartoellquidoamniticoqueinundasuspulmo-
nes.Elprimerllantoserunademostracindequeelairehaentradohastalospulmones
ysehaexpulsadoporlanarizylaboca.Alcortarelcordnumbilicalelsistemacircu-
latorioempezarafuncionarporssolo.Estoprovocaunaumentodelapresinsangu-
neaqueseestabilizarslovariosdasmstarde.Alavezlatemperaturaexteriordismi-
48 Bloque I. El desarrollo temprano
nuye respecto de la del tero en ms de diez grados y el beb tendr que controlar y
mantener su temperatura corporal de manera autnoma. La poca grasa subcutnea del
recinnacidohacequeestatareasupongaundesgastedeenergaadicional.Paraalimen-
tarsecuentaconunmovimientofundamentalparasusupervivencia:elrefejodesuccin.
Msadelanteveremoslosrefejosconlosqueelrecinnacidollegaalmundoyquele
sirven como garanta de supervivencia en los primeros momentos de vida. Siguiendo a
Delval(1994),acontinuacinvamosadescribiralrecinnacidoenfatizandosuscapaci-
dades,esdecir,lossistemasconlosquecuentadesdeeliniciodelavidapararelacionar-
seconelmedioexterior.
El 10% de los bebs que nacen en Espaa son prematuros. Segn los criterios de la
OMS, un beb se considera prematuro cuando nace antes de la semana 37 de gesta-
cin. No obstante, dentro de esta etiqueta se agrupan casos muy dispares que presen-
tan rasgos especcos que los hacen incomparables. As por ejemplo, no tiene nada que
ver un beb prematuro nacido en la semana 26 de gestacin con un peso de 600 gra-
mos con otro nacido en la semana 36 con un peso de 2 kilos.
Algunos trabajos se han dedicado a establecer las consecuencias que tiene el naci-
miento prematuro en diversos mbitos del desarrollo. En lo que respecta al desarrollo
cognitivo, parece que la consecuencia ms importante tiene que ver con la integracin
de informacin compleja, el razonamiento lgico y la capacidad para orientarse en el
espacio. El problema de la integracin de informacin suele ir unido a un problema de
dcit de atencin aunque no parece que los nios prematuros sean hiperactivos.
Desde el punto de vista de la personalidad, los nios prematuros parecen tener un
temperamento ms frgil, sobre todo durante el primer ao de vida. Esto signica que
tienen ms dicultades para adaptarse a los cambios, tienen peor humor, son ms agi-
tados y menos regulares en sus ciclos de actividad y reposo. Estos rasgos de personalidad
pueden dicultar el establecimiento de una relacin satisfactoria con los padres. Por otra
parte, hay que sealar que los nacimientos prematuros suelen generar estrs y angustia
en ambos padres y, especialmente, un sentimiento de culpa en la madre. Estos factores
originan en muchas ocasiones una depresin postparto en la madre, lo que, a su vez,
puede dicultar el establecimiento del vnculo afectivo. Algunos estudios sealan que
durante las primeras interacciones con sus bebs, estas madres detectan peor las sea-
les emitidas por el beb provocando menos vocalizaciones, miradas y sonrisas que las
madres de bebs nacidos a trmino. No obstante, estas diferencias en las primeras in-
teracciones van disminuyendo con el tiempo, de forma que a los 9 meses ya no se
encuentran discrepancias entre las madres de bebs prematuros y las de bebs nacidos
a trmino.
Desde el punto de vista del contexto social, los nios prematuros parecen ser ms
sensibles a los cambios que se producen en su entorno por ejemplo, divorcios, cam-
bios de cuidadores, nacimiento de hermanos o cambios de residencia. Tambin parecen
tener ms dicultades para establecer relaciones con los dems y, sobre todo, para
construir una visin positiva sobre s mismos. A pesar de todos estos problemas, hemos
de terminar esta breve visin de los nios prematuros de forma positiva. Por una parte,
estos problemas de relaciones sociales y autoestima ya no se detectan en la edad adul-
CON LOS PIES
EN LA TIERRA
Bebs prematuros: consecuencias a corto,
medio y largo plazo
Captulo 2. El desarrollo cognitivo del beb 49
1.1. Estados y ritmos
Alobservarunrecinnacidopodramospensarquesetratadeunserpocoorganizado,
querealizamovimientosdescontroladosyquenorespondeacasiningnestmuloexter-
no.Estaideaes,sinembargo,falsa.Elrecinnacidosuelellegaralmundomuydespier-
to.Lasdosotreshorasquesiguenalpartoconstituyenunperodoenelqueelbebest
muyatentoaloqueocurreasualrededor.Desdeestemomento,sesucedernenelbeb
diferentesestadossujetosaritmosnaturalesqueirnvariandoconeltiempoygenerarn
pautasdesueo,vigilia,actividadyalimentacin.Sehandescritoenelrecinnacidoseis
posiblesestados:sueotranquilooprofundo,sueoligerooactivo,somnolencia,alerta
inactiva,alertaactivayllanto.
Aunquelosritmosdelbebenunprincipionocoincidenconlosdeladulto,pocoa
pocosevansincronizando.Enelinicio,elciclodesueotranquiloyactivoserepitecada
50o60minutosylosciclosdevigiliasedancada3o4horas.Entrelos3y4mesesla
pautadesueonocturnoyvigiliadiurnasueleestarestablecidaconclaridadyaunqueel
bebduermelasmismashoras,lohacedeformaseguidadurantelanoche.
La naturaleza de los estados de sueo tambin van cambiando con el tiempo. Las
ondascerebralesqueproduceunfetoalas29semanasdegestacin,alcompararlospe-
rodosdesueotranquiloyactivo,sonmuysimilares.Sinembargo,alostresmesesde
edad,losbebsmuestranpautasdeondascerebralesmuydiferenciadasparacadatipode
sueo.ElsueoactivoeseldenominadosueoREM,enelqueseproducenmovimientos
corporalesirregularesymovimientosdelosojos,larespiracinesirregularylosadultos
soamos. El sueo tranquilo es el llamado sueo no REM, que representa el 80% del
sueototaleneladultoyenelquelaactividadesmsbajasinproducirsemovimientos
oculares.Eltiempodeunouotrotipodesueotambinsemodifcaconlaedad(vase
Figura2.1).Mientrasqueunfetode25semanascasislotienefasesdesueoactivo,el
recinnacidodistribuyelamitaddeltiempodesueoenactivoylaotramitadentran-
quilo.A los tres meses el tiempo de sueo tranquilo dobla al de sueo activo y, como
acabamosdemencionar,eneladultoelsueotranquilorepresentael80%delsueototal.
Aspues,alolargodeldesarrolloseproduceunadisminucinprogresivadelsueoac-
tivo.
Elpredominiodelsueoactivoenlasfasestempranashallevadoapensarquecum-
plealgunafuncineneldesarrollocerebral.Aunquenopodemossabersilosbebssue-
an, s parece que durante el sueo activo se realizan conexiones neuronales.Adems,
estaactividadpodrasuplirlaescasaestimulacinexternaqueelbebrecibeenlospri-
merosmomentosdevidamanteniendoelsistemanerviosoenactivo.Deacuerdoconeste
planteamiento,parecequelosbebsquetienenperodosdevigiliamslargos,yportan-
ta. Por otra, algunos de los adultos que fueron bebs prematuros se perciben como
personas excepcionalmente fuertes puesto que, a pesar de las desventajas con las que
nacieron, han conseguido superar las dicultades y llevar una vida completamente nor-
malizada en una sociedad que pone a su disposicin una gran cantidad de recursos para
su cuidado y educacin. Quiz habra que plantearse qu consecuencias tiene el naci-
miento prematuro en sociedades que no disponen de tantos recursos para compensar
todas estas desventajas.
50 Bloque I. El desarrollo temprano
to reciben mayor estimulacin externa, tambin tienen perodos de sueo activo ms
cortos(Vasta,HaithyMiller,1996).
1.2. Sistemas para recibir informacin: los sentidos
Algunos sentidos estn ya en funcionamiento durante la vida intrauterina. El odo, el
tacto,elolfatoyelgustoempiezanarecibirestmulosmuchoantesdelnacimientodel
bebyconstituyenunmododeinteractuarconelmedio.Elodoestcasitandesarro-
lladoenelmomentodenacercomoeldeladultoyelrecinnacidosercapazdereco-
nocer sonidos como la voz de la madre o tranquilizarse con sonidos rtmicos que le
recuerdenellatidodelcoraznqueescuchdurantelosmesesdevidaintrauterina.Ade-
ms,enmuypocotiempolosbebspodrndiferenciarsulenguamaternafrenteaotros
idiomasaunque,evidentemente,noentiendanellenguaje.Estadiferenciacinponede
manifesto una temprana capacidad para registrar el ritmo, la entonacin y el fujo de
palabras.
Elsentidoqueseencuentramenosdesarrolladoenelmomentodenacereslavista.
Esposiblequeelmediolquidoyelpocoespaciodequedisponeelfetoenelvientrede
lamadrenolepermitapracticarconestesentido.Lavisindelrecinnacidoesmuy
borrosa.Nopuedesuperponerlasimgenesdelasdosretinasyverdobledurantealgn
tiempo.Adems,nopuedeenfocarlosobjetosqueseencuentranamsde20centmetros
dedistancia.
0
2
4
6
8
10
12
14
16
18
1
-
1
5

a
s
3
-
5

m
e
s
e
s
6
-
2
3

m
e
s
e
s
2
-
3

o
s
3
-
5

o
s
5
-
9

o
s
1
0
-
1
3

o
s
1
4
-
1
8

o
s
1
9
-
3
0

o
s
3
3
-
4
5

o
s
5
0

o
s
9
0

o
s
Edad
H
o
r
a
s

d
e

s
u
e

a
l

a
HorassueoREM
HorassueonoREM
Figura 2.1. Las horas de sueo activo (REM) representan la mitad de las horas de sueo de
un recin nacido y van sufriendo un continuo descenso a lo largo del ciclo vital
(adaptado de Roffwarg, Muzio y Dement, 1966).
Captulo 2. El desarrollo cognitivo del beb 51
Parallegaratenerunavisinadecuada,losmsculosdelosojosnecesitantrabajar
deformaaceleraday,dehecho,alastressemanasdevidasonlosmsactivos.Aunque
la visin del beb es de momento poco clara, sin embargo, tambin presenta algunas
ventajasadaptativas.Lacapacidaddeenfocaradistanciastancortaslepermiteobservar
elrostrohumano,principalmenteelrostrodelamadremientraslealimenta.Comovere-
mos ms adelante, los recin nacidos parecen preferir las caras humanas frente a cual-
quierotrotipodeestmulovisualylossonidosdevoceshumanasfrenteacualquierotro
tipodesonido.Estapredisposicinhacialohumanopuedeconstituirunsegurodevida
queayudealasupervivencia,yenelcasodelavista,estaraadecuadamenteajustadoal
tipodeestmuloquesedebepercibir.Porotraparte,elrecinnacidoaprecialoscontras-
tesmsmarcadosysienteatraccinporlosobjetosquesemueven.Deigualforma,esta
preferenciaporelmovimientopudoconstituirunelementodeseguridadfrenteaalgunos
peligroscomolospredadoresyayudaadesarrollarlasreasvisualesdelcerebro.
Endefnitiva,aunqueelprincipalsistemasensorialporelqueelserhumanorecibe
informacinsobreelmundotardaruntiempoenajustarse,elrecinnacidocuentacon
unaseriedesistemasquelepermitenrecibirinformacindelmundoenelquevive.Esta
recogidadeinformacinesbsicaparaeldesarrollodelcerebro,paraempezaraestable-
cerrelacionessocialesyparaconocerelcontextoenelqueelbebaprenderavivir.
1.3. Sistemas para actuar en el mundo: los reejos
Ademsdelossentidospararecibirinformacin,elrecinnacidocuentaconunaserie
derespuestasinvoluntariasprogramadasparaactivarseanteciertosestmulos.Estasres-
puestasdenominadasrefejasconstituyenlaformadeactuarsobreelentornoconlaque
elbebvienealmundo.Losrefejosdaninformacinsobreelestadogeneraldelsistema
nerviosodelrecinnacido.Laspruebasqueselesrealizanenlosminutosquesiguenal
nacimientotienencomoobjetivocomprobarsidisponendetodoelrepertorioderefejos.
Algunos de los refejos son fundamentales para la supervivencia el de succin y el
respiratorio,porejemplomientrasqueotrosindicanunbuenestadoalnacercomo
elrefejodenatacinoeldelamarcha.EnlaTabla2.1puedeverseunadescripcinde
losprincipalesrefejosdelrecinnacido,losestmulosqueelicitanlosrefejos,ascomo
larespuestaesperableencadaunodeloscasos.
Los refejos que posee el beb se pueden clasifcar en tres grupos. Unos, como el
respiratoriooelparpadeo,permanecenalolargodetodalavida.Otros,losquemshan
interesadoalospsiclogosevolutivos,sepierdenunosmesesdespusdelnacimientoy
sevuelvenaaprendermstardedeformavoluntaria.Porejemplo,elrefejodelamarcha
desaparecealostresocuatromesesyelnioaprenderaandardeformavoluntariaha-
ciaelaodevida.Igualmente,elrefejodenatacinqueelbebposeeenelmomento
denacer,sepierdealosseismesesyelniotambinaprenderanadaraosmstarde.
Lafuncindeestosrefejosnoestnadaclara,perosesuponequesonrestosdenuestro
pasado animal que han sobrevivido a lo largo de millones de aos. El tercer grupo de
refejossonaqullosquesemanifestanenelnacimientoydesaparecenalospocosme-
sessinvolveraaparecernuncams.ElrefejodeBabinsky,elrefejodelMorooelde
prensinplantarformanpartedeestegrupo.
Lasuccinesunodelosrefejosmsimportantesqueposeeelrecinnacido.Gracias
aestaconductaautomtica,elbebpodralimentarsesuccionandoelpezndelamadre
52 Bloque I. El desarrollo temprano
olatetinadelbibern.Noobstante,alcabodeunosmesessehabrnconvertidoenex-
pertossuccionadoresyserncapacesdeadaptarelmovimientoalosdiferentestiposde
objetosquequierenchupar.Lasuccinseconvierteasenunmecanismoatravsdelcual
explorarlosobjetosysuspropiedades.Comoveremosenelepgrafe3,Piagetprestuna
granatencinalasuccinvoluntariapuestoquesetratadelaprimeraaccincompleja
Tabla 2.1. Algunos reejos del recin nacido.
REFLEJO ESTIMULACIN RESPUESTA
Succin Introducirunobjetoenlaboca Movimientos de succin rtmicos. Ac-
cinvoluntariaalos4-6meses.
Bsqueda Contactoconlamejilla Movimientodecabezaparasituarenla
bocaelobjetoestmuloeiniciodemo-
vimientosdesuccin.Desaparecehacia
los3-4meses.
Prensin Contactoconlapalmadelamano Cierralamanoconprensindelobjeto,
si es posible. Desaparece hacia los 3-4
meses.
Prensin
plantar
Contacto en la base de los dedos del
pie
Flexin de los dedos con prensin del
objeto, si es posible. Desaparece entre
los8-12meses.
Marcha Sostenido verticalmente con los pies
sobreunasuperfciedura
Iniciamovimientosdemarcha.Desapa-
recehacialos2-3meses.
Ascensin Sostenido verticalmente frente a un
obstculo,comounescaln
Levanta el pie, con fexin de rodilla,
comoparasalvarunobstculo.Desapa-
recehacialos2-3meses.
Reptacin Apoyado sobre el vientre y con una
resistenciaenelpie
Iniciamovimientoscoordinadosdebra-
zosypiernasparareptarsobreelsuelo.
Desaparecehacialos4meses.
Natacin Sostenido horizontalmente sobre el
estmagoenelagua
Movimientossincronizadosdebrazosy
pies.Desaparecehacialos6meses.
Babinski Presinsuavesobrelaplantadelpie,
deltalnhacialosdedos
Extensindelosdedosdelpieenforma
de abanico, seguida de fexin de los
dedos.Desaparecehacialos12meses.
Parpadeo Luzfjasobrelosojos Cierre de los ojos. Permanece toda la
vida.
Patelar Golpedebajodelarodilla Extensin de la pierna hacia delante.
Permanecetodalavida.
Cervical Tendidobocaarribasegiralacabeza
haciaunlado
Extensindelbrazoypiernadeeselado
y fexin de los otros dos. Los ojos si-
guen la direccin del brazo extendido.
Apareceyaeneltero;desaparecealos
3-4meses.
Moro Sonido intenso, prdida de sustenta-
cin,golpesobrelasuperfciedeapo-
yodelnio
Apertura y luego cierre de brazos y
piernas, con cierre de manos sobre la
lneamediadelcuerpo.Desapareceha-
cialos6meses.
Captulo 2. El desarrollo cognitivo del beb 53
queelbebpuedeadaptaralasvariacionesquepresentanlosobjetos.Laprensin,que
enunprincipiotambinsemanifestacomounarespuestarefejacuandounobjetopre-
sionalapalmadelamanodelbeb,seconvierteenunaconductavoluntariayadaptada
alascaractersticasdelobjetoquesequiereagarrar.Comoveremosmsadelante,eles-
quema de prensin del beb vara cuando coge un sonajero o cuando coge una pelota.
Estosrefejostransformadosenaccionesvoluntarias,controladasyadaptadassonlasque
permiten comenzar a explorar el mundo y a partir de las cuales, segn algunas teoras
comolapiagetiana,seconstruyentodoslosesquemasdepensamientoquedarnlugara
lasmodalidadesderazonamientomscomplejasquemuestraelserhumano.Aspues,
venirdotadodeestasconductasinvoluntariasesesencialparapoderllevaracabolagran
empresaqueconstituyeeldesarrollodelpensamiento.
1.4. Sistemas para transmitir informacin: el llanto y la sonrisa
Elllantoesunapotentearmaconlaqueelbebllegaalmundo.Paraunadultoesmuy
difcilquedarseindiferenteanteelllantodeunbeby,normalmente,despliegaunaserie
de conductas encaminadas a calmarlo.Adems, el llanto provoca incluso respuestas f-
siolgicasenlamadrecomounaumentodelritmocardiacoyunaumentodelasegrega-
cindeleche.Dadoqueeladultosueleresponderdeformacasiinmediataalllantodel
beb, ste aprende pronto que dispone de un instrumento que le permite controlar su
medio. Por otra parte, el llanto constituye un mecanismo de aprendizaje.A travs del
llanto, el beb consigue que el adulto le acerque el mundo cuando l todava no puede
desplazarseporsmismoparaexplorarlo.
Enunprincipioelllantoqueemitenlosrecinnacidosesmuybsicoypresentaca-
ractersticastpicasderitmoygrado.Cuandoexistenalteracioneslosbebspuedenemi-
tirtiposdellantodiferentes.Porejemplo,losbebsconproblemascerebrales,desnutri-
dosyprematurospuedenproducirllantosdefrecuenciamsaltayconritmosanormales;
tambin los recin nacidos con sndrome de Down suelen emitir llantos atpicos y los
bebsconelsndromedelcriduchatogritodelgatosecaracterizan,entreotrascosas,
porque su llanto recuerda al de los gatos (Vasta et al., 1996).As pues, el llanto es un
indicadordelfuncionamientodelsistemanerviosocentral.
Muyprontolosbebsseespecializaneneltipodellantoqueemitenysusignifcado
vara.Engeneral,sedistinguentresocuatrotiposdellanto:elllantodehambre,elllan-
todedolor,elllantoquereclamaelcontactohumanoyeldemiedooenfado.Estosllan-
tosvaranenintensidad,ritmoentrelossollozosymaneradecomenzarylosadultosson
capacesdereconocerlosbasndoseenestasdiferencias.
Lasonrisaesotroinstrumentoquelosbebsaprendenamanejarmuypronto(vase
Figura2.2).Enunprincipio,lasonrisadelosrecinnacidosesungestoinvoluntarioque
slorefejabienestar,perohacialosdosmesesapareceladenominadasonrisasocialante
lapresenciadeotraspersonasqueconstituyeyaunapautaaprendida.Estenuevogesto
se aprende al asociarse con una respuesta externa positiva, es decir, con la reaccin de
admiracinyalegraqueexpresanlosadultoscuandovenaunbebsonrer.Apartirde
ah,elbebaprenderquecuantomssonremsrefuerzorecibe.Apartirdelostreso
cuatromeseslassonrisassehacenmsampliasylosbebsempiezanarer,sobretodo
en situaciones de interaccin social. Estas pautas, que parecen ser universales, son el
iniciodelavidaemocionalquelosbebsdesplieganprcticamentedesdeelnacimiento.
54 Bloque I. El desarrollo temprano
Figura 2.2. Los recin nacidos sonren de forma reeja, mientras que al cabo de dos o tres
meses sonren de forma voluntaria para establecer contacto y relacionarse con los
dems.
1.5. El cerebro del recin nacido
Elcerebrohumanoestalprincipiomsdesorganizadoqueeldecualquierotraespecie.
Estosignifcaqueaunquealnaceryadispongadeloscienmilmillonesdeclulasner-
viosas,todavafaltanporestablecerselamayorpartedelasconexionesquesernvitales
paraeldesarrollo.Estadesorganizacininicialpodrapareceruninconveniente,puesto
quenecesitadeunperododedesarrollopostnatalmuchomslargo.Sinembargo,cons-
tituye una ventaja porque permite un desarrollo mucho ms fexible, es decir, mucho
menossujetoaladeterminacingenticaymuchomsabiertoalaexperiencia.Lasex-
perienciasquelosbebsvanregistrandoapartirdelnacimientosonlasqueconformarn
granpartedesusconexionesneuronalesylaenormevariedadyespecifcidaddeviven-
ciasexplicaquelaconfguracindecadacerebrohumanoseanica.
A pesar de la plasticidad y fexibilidad que acabamos de mencionar, el cerebro hu-
manonoposeeestructurasopartesdiferentesdelasencontradasenotrasespecies,espe-
cialmente en los primates.As, las principales diferencias entre nuestro cerebro y el de
losprimatessonsumayorvolumensobretodoenelcortex,sulentodesarrolloyel
largoperododeplasticidadpostnatal.
El cerebro comienza a formarse durante la vida intrauterina. La mayor parte de las
neuronasseproducenentrelassemanas12y28degestacin(vaseFigura2.3).Lapro-
duccin de neuronas es en un principio excesiva, pero ms tarde el propio cerebro se
encargardeajustarsunmero.Todaslasneuronasseproducencercadelcentrodelce-
rebroyluegodebenemigrarhaciaelexteriordelencfalo.Aunquesedesconoceelme-
canismoporelqueseproduceestefenmenomigratorio,ssesabequefnalizahacialos
sietemesesdegestacin.Unavezquelasneuronashancompletadolamigracinempie-
zanaformarconexionesconotrasneuronas.Elprocesodeestablecimientodeconexiones
con otras neuronas denominadas sinapsis que comienza en las fases de desarrollo
prenatal,seprolongaalolargodemuchosaosyseproducenmuchasmsconexiones
delasqueluegosemantienenenlavidaadulta.Lassinapsisqueseestablecendurante
laetapaprenatalsedebenaunaactividadcerebralgeneradadeformaintrnsecayespon-
tnea,mientrasqueeneliniciodelavidapostnatal,laactividadcerebralserealizagracias
alainformacinrecibidamediantelossentidosylaactividadmotora.
Captulo 2. El desarrollo cognitivo del beb 55
Nervios
craneales
Cerebro medio
Cerebelo
Cerebelo
Cerebelo
Cerebelo
Cerebro anterior
Cerebro
anterior
Mdula espinal
Cerebro
medio
Cerebro
anterior
Cerebro
anterior
Cerebro medio
(escondido)
Mdula
11 semanas Nacimiento
7 semanas 3 semanas
Figura 2.3. Evolucin del cerebro en distintos momentos del embarazo.
Sibien,comoestamosviendo,laactividadcerebralyaexistedurantelagestacin,
eseneltranscursolosdosprimerosmesesdevidacuandoelcerebroalcanzasumayor
nivel de actividad. Durante los doce primeros meses el cerebro crece ms rpido que
cualquierotrorganoyllegaaalcanzarlostrescuartosdeltamaodeuncerebroadul-
to.Entreelnacimientoylavidaadulta,eltamaodelcerebrosehabrcuadruplicado.
Eldesarrollodelcerebronoseproducedeformauniformealolargodeltiempo,sino
queexistenperodosdeunaactividadespecialysecorrespondenconlosdenominados
aceleronesdeldesarrollo.Estosaceleronesdeldesarrollotienenqueverconmomen-
tosenlosqueseobservancambiosconductualesycognitivosquemarcanetapascuali-
tativamentediferentes.Porejemplo,sehanobservadoaceleronesdeldesarrolloentrelos
3ylos10meses,haciaelaoymedio,entrelos2ylos4aos,entrelos6ylos8,en-
trelos10ylos12yentrelos14ylos16aos(Corral,2001).Muchosdeestosmomen-
toscoincidenconloscambiosdeperodoodeestadioqueobservPiaget(vaseCap-
tulo1),locualponedemanifestolarelacinqueexisteentremaduracinneurolgica
ycambioconductual.
Otroacontecimientoligadoalamaduracindelcerebrotienequeverconelproceso
de mielinizacin. La mielina es una sustancia que recubre una parte de las neuronas y
facilitalaconduccindelimpulsoelctrico.Adems,lamielinizacinesunodelosfac-
tores que contribuyen al aumento del volumen del cerebro que se observa durante el
desarrollo.Mientraselcerebrosiguemadurando,tambinsigueproduciendomielina,de
formaqueestaproduccinvaraenfuncindelasreascerebrales.Porejemplo,lasreas
que controlan la adecuacin de los movimientos motores siguen produciendo mielina
56 Bloque I. El desarrollo temprano
hastalos4aos,mientrasquelasqueregulanlaatencinylaconciencialosiguenha-
ciendohastalapubertad.
Comohemosmencionadoantes,elcerebrohumanorealizamuchasmssinapsisde
lasqueluegoconserva,observndoseperodosdeestablecimientosdesinapsisyotros
deprdidasdesinapsis.Estasprdidassetraducenenunadisminucindeladensidad
sinpticayseproducen,sobretodo,hacialapubertad.Elprocesodeprdidadesinap-
siscomienzaenlasreassensoriales.Elcortexvisualseigualaaldeladultohacialos
11aosmientrasqueelcortexfrontal,queseocupadelaplanifcacindelasacciones,
lashabilidadesintelectualesmscomplejasylainhibicindeconductasinapropiadas,
lohacehacialos16.Laexperienciaesloquedeterminaqueciertassinapsisseconser-
venyotrassepierdan.As,lassinapsisquenoseutilizansonlasquesepierdenylas
queresultantilesparanuestravidasemantienen.Unejemplorelacionadoconellen-
guajepuedeilustrarbienestemecanismo.Hastalosseismeseslosniospuedendiscri-
minarcualquiersonidopertenecienteadiferenteslenguas.Losbebsnacidosennuestro
pas y que escuchan espaol discriminan sonidos como el de la ese sonora que no
existenennuestralengua.Igualmentelosbebsjaponesessoncapacesdediscriminar
laerresimpledenuestralenguaquenoexisteenjapons.Apartirdelosseismeses,
los nios que slo escuchen y aprendan espaol empiezan a perder la capacidad para
discriminar la ese sonora y los nios japoneses que no aprendan espaol tampoco
podrn ya discriminar la erre. Es decir, el cerebro viene en un principio preparado
paraqueaprendamoscualquierlenguaynospermitediscriminarcualquiersonido.Una
vezquenuestralenguamaternaempiezaainstaurarse,elrestodesonidosquepodra-
mos discriminar resultan en realidad intiles y, por tanto, se pierde la capacidad para
diferenciarlos.
2. Las capacidades perceptivas del beb
A fnales del siglo XIX los estudiosos del desarrollo humano crean que el entorno era
percibidoporelrecinnacidocomounautnticocaos.Segnestasconcepciones,elbeb
noeracapazdeimponerunaestructuraalosestmulosypercibafragmentosvisuales,
sonoros, olfativos, gustativos o tctiles desordenados.A partir de la dcada de 1960 y
graciasalasnuevastcnicasempleadasparaestudiaralosbebs,estaconcepcincambi
radicalmente.Hoyendasabemosquelosbebsposeendiversosrecursosquelespermi-
ten estructurar el medio y que vienen al mundo con potentes capacidades perceptivas
fundamentalesparallevaracabodichaestructuracin.
Lainvestigacinsobrelascapacidadesdelosbebssehaconvertidoenuntemaim-
portantsimoennuestradisciplinaynumerososautoressededicanaestudiarlas.Noobs-
tante,lasinterpretacionesquesepuedenhacerapartirdelasconductasquerealizanlos
bebsnosonunvocasyhancreadomuchapolmica.As,algunosautorespiensanque
losbebsvienendotadosderepresentacionesmentales,mientrasqueotrosmantienenuna
visin ms conservadora y siguen defendiendo que esas capacidades iniciales son slo
predisposiciones y que es a travs de la interaccin con el entorno como fundamental-
mente se adquiere el conocimiento sobre el mundo. El debate sobre el innatismo sigue
siendo el teln de fondo de estas discusiones que se remontan a los inicios del pensa-
miento.
Captulo 2. El desarrollo cognitivo del beb 57
2.1. La percepcin visual
Los datos que se poseen en la actualidad acerca de la percepcin visual en bebs son
innumerables. No obstante, antes de pasar a exponer cmo ven los recin nacidos, es
necesario explicar brevemente las tcnicas ms utilizadas en la investigacin que han
permitidoaclararalgoestascuestiones.Enelsiguientecuadropresentamosunresumen
dedichastcnicas.
1
Eltrminopreferenciadebeentendersecomounamuestradeintersodeatencinprestadaaunes-
tmulo,yaquelosinvestigadoresnoutilizaneltrminoatribuyendogustosalbeb.Enestesentido,sielbeb
miramsunestmuloqueotrohemosdeinterpretarqueunodeellosatraemssuatencinoleinteresams.
Dado que los bebs slo expresan de forma rudimentaria aspectos bsicos sobre s mis-
mos como malestar o bienestar, resulta muy complicado saber con detalle cmo se
sienten, cmo perciben el mundo o qu cosas conocen. Los investigadores que se de-
dican a explorar el mundo del beb han inventado algunas tcnicas que, aunque en su
mayora requieren inferencias e interpretacin del resultado o de la conducta que reali-
za el beb, nos acercan su experiencia.
Podemos dividir estas tcnicas en dos grandes grupos. Por una parte, las medidas
psicosiolgicas y, por otra, las medidas conductuales. Las medidas psicosiolgicas
tienen en cuenta aspectos del sistema nervioso central y autnomo. Por ejemplo, miden
cmo van madurando los sistemas sensoriales, cmo es la actividad elctrica del cerebro
o qu seales emiten algunos rganos cuando se presentan ciertos estmulos (p. ej., la
dilatacin o contraccin de la pupila y la aceleracin o desaceleracin del ritmo carda-
co). Aunque hay muchas investigaciones que emplean estas medidas, no nos vamos a
detener en su explicacin. Las medidas conductuales han proporcionado interesantes
resultados y han suscitado grandes debates sobre las capacidades de los bebs y, por
tanto, vamos a dedicarles ms atencin. Existen tres tcnicas principales dentro de las
medidas conductuales: la de preferencia, la de habituacin y el condicionamiento. La
tcnica de preferencia es la ms sencilla. Consiste en presentar dos estmulos diferen-
tes de forma simultnea al beb y registrar el tiempo de jacin visual ante cada uno
de ellos. Si el beb mira durante ms tiempo uno de los estmulos, se supone que per-
cibe las diferencias entre ambos y preere uno de ellos
1
. Pero, qu ocurre si no hay
diferencias entre los dos estmulos? Podemos concluir que el beb no los discrimina o
no le interesan? Evidentemente, no. Cuando el beb mira por igual los dos estmulos
puede que o bien no discrimine, o bien discrimine, pero ambos le gustan o le aburren
por igual. En este caso no podremos saber cul de las dos opciones es la correcta.
La tcnica de habituacin se ha empleado en muchas ocasiones. Consiste en pre-
sentar un estmulo hasta que el beb se acostumbra a l y a continuacin presentar otro
distinto para ver si recupera la atencin y, por tanto, lo diferencia del anterior. Veamos
un ejemplo: imaginemos que queremos saber si los bebs perciben los colores y vamos
a empezar nuestro estudio viendo si son capaces de distinguir el color rojo del color
naranja utilizando la tcnica de la habituacin. Para ello, presentaremos a los bebs en
primer lugar una pantalla de color rojo. Generalmente, los bebs miran un tiempo los
estmulos nuevos y cuando ya los han explorado, dejan de mirarlos. Es decir, exploran
lo novedoso hasta que deviene conocido y por aburrimiento o desinters buscan otra
nueva fuente de atencin. As, una vez que el beb deja de mirar la pantalla roja porque
CON LOS PIES
EN LA TIERRA
Cmo se estudian las competencias
de los bebs?
58 Bloque I. El desarrollo temprano
Acontinuacinvamosaofrecerunasntesisdelosdatosmsrelevantessobrelaper-
cepcinvisual,comenzandoporlosdenominadosprocesosvisualesbsicos.Dentrode
estosprocesosseencuentranlaacomodacinvisual,laagudezavisualylasensibilidad
alcontraste.Laacomodacinvisualtienequeverconlacapacidaddeenfocar.Cuando
seutilizanestmulosadecuadosentamaoycontraste,losbebssoncapacesdeenfocar
desdelosprimerosdasdevida.Esteenfoqueserealizaalprincipiosloadeterminadas
distancias.Losrecinnacidosenfocanlosobjetossituadosamenosde20centmetros,
peroaloscuatromeseselojodelbebseacomodayaigualqueeldeladulto.
Laagudezavisualeslacapacidadquetieneelojoparapercibirdetalles.Losresul-
tadosdelostrabajosqueevalanlaagudezamediantemedidascerebralesindicanquelos
recin nacidos perciben muy pocos detalles, pero hay un rpido incremento a las seis
semanasdevidaysealcanzaunnivelsimilaraladultoalosseismeses.
Porltimo,lasmedidasdesensibilidadalcontrastesehanestablecidomediantela
presentacindeunapantallaenlaquevanapareciendobarrasnegras,alprincipiomuy
fnasyprogresivamentecadavezmsgruesas,quelosbebsmirancuandoelcontraste
lespermitevisualizarlas.Cuandolasbarrassonmsbienlneasfnaslosbebsdeunmes
se ha habituado a ella, presentaremos la pantalla de color naranja. Si el beb recupe-
ra la atencin y mira atentamente la nueva pantalla, podemos suponer que discrimina
entre el rojo y el naranja. Si, por el contrario, no mira la pantalla naranja podemos pen-
sar que no se da cuenta de la diferencia de color y trata el naranja como si fuera rojo.
Por ltimo, la tcnica de condicionamiento refuerza algunos movimientos volunta-
rios del beb (como mirar, chupar o girar la cabeza) para ver si discrimina entre estmulos
diferentes. Por ejemplo, mediante un dispositivo inventado para tal efecto, el beb pue-
de aprender que si gira la cabeza al escuchar un sonido determinado (por ejemplo, la
slaba /pa/), aparece una bonita imagen. Una vez que el beb ha comprendido la relacin
entre el sonido, su movimiento y la aparicin de la imagen, el investigador puede mani-
pular el sonido para ver si el beb lo discrimina. As, podra presentar la slaba /ba/ y
observar si el beb gira o no la cabeza. Si girara la cabeza, podramos pensar que no
percibe diferencia entre los sonidos /pa/ y /ba/, es decir, trata el sonido /ba/ como si fue-
ra /pa/ y espera que su movimiento produzca el mismo resultado (la imagen).
A pesar de que la utilizacin de estas tcnicas ha arrojado interesantes datos sobre
las capacidades y la percepcin del beb, no podemos dejar de mencionar brevemente
los problemas a los que se enfrentan. En primer lugar, la utilizacin de diversas tcnicas
para evaluar la misma capacidad ha dado lugar a resultados diferentes. Por ejemplo,
como veremos ms adelante, los resultados sobre la permanencia del objeto varan en
funcin de la tcnica empleada. En otras ocasiones se ha utilizado la misma tcnica pero
no se ha logrado replicar resultados anteriores. Est claro que en estos casos factores
como los propios sesgos de los investigadores o las variaciones introducidas en el m-
todo, desempean un papel fundamental. Por ltimo, dado que las conductas y las
medidas tomadas necesitan ser interpretadas, el mismo resultado puede tomarse como
evidencia de diferentes procesos o mecanismos. As, por ejemplo, para algunos autores,
cuando los bebs miran ms tiempo un estmulo nuevo, lo interpretan como un signo
de inteligencia los bebs ms inteligentes miraran ms los estmulos nuevos, mien-
tras que para otros signica todo lo contrario los bebs ms inteligentes son ms
ecaces en el procesamiento de la informacin y, por tanto, necesitan menos tiempo
para extraer la informacin novedosa. El que miren ms tiempo un estmulo novedoso
se interpreta, pues, como un ndice de menor inteligencia.
Captulo 2. El desarrollo cognitivo del beb 59
nolasperciben.Duranteesteprimermeslavisindelosbebsseparecealavisinnoc-
turnaquetenemoslosadultosyslovenlosobjetosgrandesyconmuchocontraste.Esta
sensibilidadalcontrastemejorarpidamenteyalosseismesesalcanzanivelescompara-
blesalosdeladultoaunquetodavaalgoinferiores(vaseFigura2.4).
Unodeloselementosdelapercepcinvisualquehadadolugaraoriginalesestudios
tienequeverconlapercepcindelaprofundidad.Elsistemavisualhumanodispone
deciertosindiciosparapercibirlaprofundidad.Hayindiciosquesepuedencaptarcon
unsoloojomonoculares,indiciosquesecaptanconlosdosojosbinocularesy
otrosquedependendelmovimientocinticos.Sinentrarenlosdetallesdelostrabajos
quesehanllevadoacabo,parecequelasensibilidadalosindiciosmonocularesybino-
cularesapareceentrelos5ylos7meses.Dentrodeloreferidoalasclavescinticas,uno
delosestudiosmsimportantesrealizadoshasidoeldelabismovisual(GibsonyWalk,
1960).Enestetrabajo,losautoresdisearonunamesadecristalcuyamitadestabacu-
biertaporunasuperfciedecuadrosblancosynegrossimilarauntablerodeajedrez.La
otramitaddelamesadejabaelcristalaldescubierto,locualpermitaverenelsuelola
misma superfcie de cuadros blancos y negros creando un efecto de abismo (vase
Figura2.5).
Figura 2.4. Simulacin de la visin de un recin nacido entre el nacimiento y los seis meses
(tomado de Vasta et al., 1992).
Figura 2.5.
Reconstruccin del abismo
visual utilizado por Gibson
y Walk para estudiar la
percepcin de la profundidad
en bebs (tomado de Vasta
et al., 1992).
60 Bloque I. El desarrollo temprano
Elobjetivodelestudioeradeterminarsilosbebspercibenlaprofundidadyreaccio-
nandealgunaformaanteelabismovisualcreado.Paraello,dejabanalbebenlaparte
conlasuperfciedecuadrosyobservabansiseasomabaalabismo,seatrevaacruzar-
lo,etc.Lamadredelosbebsestabasituadaenelotroextremoyllamabaalbebconun
jugueteenlamano,detalformaqueelbebdebaatravesarlapartedecristalelabis-
mosiquerareunirseconellayalcanzareljuguete.Losinvestigadorespensabanque
losbebsquepercibieranlaprofundidadnocruzaranelabismo,yaquesentiranmiedo
antelaposiblecada.Alcontrario,losbebsqueatravesaranlasuperfcieloharanporque
notendranencuentaelabismo,esdecir,nopercibiranlaprofundidad.Delos36bebs
de 6 meses en adelante que fueron evaluados, slo 3 atravesaron el abismo gateando.
Parece,pues,quelamayorpartedelosbebsqueyagateanpercibenlaprofundidady
ademsreaccionanconmiedoanteellaevitandocruzarelabismo.
Estudiosposterioresevaluaronlareaccindebebsentre2y5meses,quetodavano
gatean,mediantelamedidadelritmocardaco(comondicedemiedo).Cuandolosbebs
estaban sobre el lado profundo de la mesa su ritmo cardaco disminua, lo cual indica
intersyatencin.Lamismamedidaconbebsqueyagateanmuestraunaaceleracin
del ritmo cardaco, lo cual indica miedo o estrs. Estos resultados pueden interpretarse
comoquelosbebspercibenlaprofundidaddesdelosprimerosmeses,peronosienten
miedohastaquesoncapacesdemoverseporsmismosalrededordelos6mesesy,por
tanto,elabismoseconvierteenunasituacinpotencialmentepeligrosa.
Otro de los aspectos ms estudiados en percepcin con bebs tiene que ver con la
percepcindelaforma.Parecequelosbebstienenpreferenciasalahorademirarob-
jetosoestmulos.As,porejemplo,preferenobjetosmoderadamentecomplejoscomo
eldibujodeunacaraaotrosmssimplescomounalminadecolorlisa.Adems
inspeccionan las formas de una forma particular: durante el primer mes de vida miran
casiexclusivamenteloscontornosdelasfgurasyalosdosytresmesesvaninspeccio-
nandomselinterior.
Unodeloselementosquemsinvestigacinhagenerado,dentrodelapercepcinde
laforma,tienequeverconlapercepcindelrostrohumano.Comoyahemosmenciona-
do,elbebpreferemirarelrostrohumanofrenteaotrotipodeobjetosdesdeprctica-
mente el comienzo de la vida. Fantz (1961) present diferentes estmulos a bebs de 4
mesesy,utilizandounatcnicadepreferencia,observquemirabanmstiempoeldibu-
jodelacarahumanaqueningnotroestmulo(vaseFigura2.6).Enalgunoscasosse
haobservadoestapreferenciayaalos2meses.
Enlamismalnea,JohnsonyMorton(1991)presentaronalosbebsdibujosdecaras
normalesfrenteacarasdescolocadasconojos,narizybocafueradelugarydi-
bujosgeomtricosorganizadosdemodosimilaracomoseorganizanloscomponentesde
lascaras.Losbebspreferanlosdibujosdelosrostrosordenados,seguidosdelosdibu-
josgeomtricossimilaresalascarasy,enltimolugar,lascarasdescolocadas.
Algunos autores han interpretado estas preferencias como una prueba a favor de la
existencia de un esquema innato sobre el rostro humano en los bebs. Es decir, si los
bebspreferenlacarafrenteaotrotipodeestmuloses,segnestalgica,porquedis-
ponen de un dispositivo innato que les permite atender y orientarse hacia ese estmulo
frenteaotros.Enestesentido,elbebnotendraqueaprendercmosonlascarashuma-
nas. Estudios posteriores han encontrado resultados que matizan notablemente estas
ideas.Porunaparte,noesttanclaroquelapreferenciaseainnatayanmenosquese
Captulo 2. El desarrollo cognitivo del beb 61
debaalaexistenciadeunarepresentacinprevia.Alosdosmeseslosbebshanmirado
ya muchos estmulos y han podido aprender a preferir el rostro humano. Por otra, las
caractersticas de los rasgos propios de la cara humana pueden estar en el origen de la
preferenciamostradaporlosbebs.As,elmovimientodelosojosylabocayelbrillo
de la boca son caractersticas muy llamativas que pueden explicar esa preferencia. En
todo caso, la especial atencin que los bebs prestan a las caras humanas, sea innata o
debidaasusrasgosespeciales,podraconsiderarsecomounapreadaptacinquefacilita-
ralasprimerasrelacionessociales(vaseCaptulo3).
Losadultospercibimoslosobjetoscomounidadescompletas,separadasdelrestoy
ocupandounlugarenelespacio,algoquenospermitecomprendermejorelmundoen
elquenosmovemos.Pero,percibenlosbebslosobjetosigualquenosotros?Entien-
denquesetratadeobjetosseparadosaunqueestn,porejemplo,parcialmenteocultos?
Lapercepcindelosobjetosenbebsconstituyeuninteresantetemadeinvestigacin
quehageneradomuchosestudios.KellmanySpelke(1983)idearonuningeniosodispo-
sitivo para aclarar algunas de estas cuestiones. Habituaron a bebs de 4 meses a mirar
unabarrainclinada,parcialmenteocultaporunbloque(vaseFigura2.7).Unavezque
losbebssehabituaronalestmulopresentado,selesmostrarondosestmulosdiferen-
tes:unabarrapartidayunabarracompletaparaverculdelasdosprefera.Esteexpe-
rimento incluy adems una variable relacionada con el movimiento de la barra y el
bloque.Enunoscasos,nosemovaningunodeloselementos,enotrossemovaslola
barra,enotrossloelbloqueyenotroslabarrayelbloque.Sinentrarenlosdetallesde
cadacondicinexperimentalpodemosdecirque,deformageneral,losbebsde4meses
miraronmstiempolabarrapartida,algoquelosautoresinterpretancomounindiciode
quelosbebspercibenlosobjetoscomounidades.Esdecir,miranmslabarrapartida
porque, igual que los adultos, han comprendido que sus dos partes estn, en realidad,
unidasysetratadeunsoloobjeto.Alinferirestaunidad,losbebstratanlavisindela
36
32
28
24
20
16
12
8
4
0
T
i
e
m
p
o

d
e

f
i
j
a
c
i

n

v
i
s
u
a
l

(
e
n

%
)
Cara Crculos Letras Blanco Amarillo Rojo
ms su atencin
, este resultado
ujo cuando el n
o en movimiento
. Cuando se mo
e o el bloque y la
Figura 2.6. Tiempo de jacin visual ante distintos estmulos en bebs. Como se observa en
la longitud de las barras, el estmulo que ms miran es el de la cara humana y el
que menos un color liso.
62 Bloque I. El desarrollo temprano
barra partida como un estmulo inesperado y novedoso que atrae ms su atencin. No
obstante,esteresultadosloseprodujocuandoelnicoelementoenmovimientoerala
barra.Cuandosemovasloelbloqueoelbloqueylabarraalavez,ocuandoninguno
deloselementossemova,losbebsmirabanporiguallabarrapartidaylabarracom-
pleta.Porlotantodebemosdecir,pues,queeselmovimientodelobjetoloquefavorece
lapercepcindelosobjetoscomounidades.Elmismoestudiorealizadoconbebsde7
mesesmostrqueentodaslascondiciones,esdecir,hayaonomovimientodelosele-
mentos,losbebsmiranmslabarrapartida.Aestaedadyaparecequelosbebs,igual
que los adultos, perciben los objetos como unidades independientemente de su movi-
mientoyapesardequeestnparcialmenteocultos.
Manteniendolacondicinexperimentalenlaqueslolabarrasemueve,otrosauto-
reshanencontradoquealaumentareltamaodelabarralosbebsdeincluso2meses
miranmslabarrapartida.Noobstante,reconocenquepercibirlosobjetoscomounida-
desdependedemuchosotroselementosvisuales,talescomolatexturadelfondo,elta-
maodelobjeto,elmovimientodelaspartes,etc.(JohnsonyAslin,1995,1996,citados
porCorralyPardo,2002).
Encualquiercaso,eindependientementedeaquedadexactalosbebscomienzan
apercibirlosobjetoscomounidades,parecequelohacenmuypronto.Estosresultados,
juntoconotrosderivadosdediferentesestudiosquenopodemosdetallaraquporcues-
tionesdeespacio,hanllevadoaalgunosautoresaplantearlaposibilidaddequeexistan
unosprincipiosinnatosquedirijanelanlisisperceptivodelosbebs.Siestofueracierto,
los bebs sabran desde muy temprano que, por ejemplo, un objeto se mueve en una
solatrayectoriaenelespacioyeltiempo,quelosplanospertenecenalmismoobjetoy
Figura 2.7. Estmulos utilizados por Kellman y Spelke para estudiar la percepcin de los ob-
jetos. La barra y el bloque forman el estmulo de habituacin, es decir, el que se
presenta hasta que el beb se acostumbra. Las barras, partida o continua, son los
estmulos de deshabituacin.
Captulo 2. El desarrollo cognitivo del beb 63
lascosassemuevenjuntasslosiestnconectadasyqueunobjetopuedemoversesiotro
leempuja,peronoantesdequeseponganencontacto.Estosprincipiosactuarandefor-
maautomticacadavezqueelbebobservay,mstarde,aprenderaautilizarotrosin-
dicioscomoelcolorolatexturaparajuzgardndecomienzanoacabanlosobjetos.
En realidad, la existencia de estos principios se ha postulado porque los bebs han
miradodurantemstiempoendiferentesexperimentosciertassituacionesimposibles,
esdecir,presentacionesvisualesquenoconcuerdanconlasleyesqueguanlapercepcin
delosobjetosenlosadultos.Comohemosvistoconlasbarras,estostiemposdemirada
mslargossehaninterpretadocomosituacionesinesperadasparaelbebquerompenlas
expectativas derivadas de la aplicacin de las leyes ordinarias.As pues, si el beb se
sorprendeantedeterminadaspresentacionesvisualesdebeserporqueyatieneintegrados
unaseriedeprincipiosqueguansupercepcin.Loquetodavanoestclaroessiesos
principiossoninnatos.Todosestosestudiosypropuestastericashansuscitadomuch-
simodebateacercadelascapacidadesdelrecinnacidoyelbeb.Numerososautoresse
hanmostradoendesacuerdoconlaconcepcindeunsuperbebllenodeideas,principios
yteorasinnatassobreelmundo.Desdeestaotraperspectivaseargumentaquelaexpe-
rienciadelosbebsconlosobjetosylaspersonasesmuyintensadesdeelnacimiento.
Los estados y ritmos del recin nacido muestran que desde el principio los bebs son
seresmuyactivosquebuscaninformacinsobreelcontexto.Desdeaproximadamentelos
tresmeses,losbebspasanlamayorpartedeltiempodevigiliaobservandoymanipu-
landotodoloquecaeensusmanos,esdecir,aprendiendocmosonlascosasquetienen
asualrededor.Aunqueparecerazonablepensarqueelserhumanonaceconciertaspre-
disposicionesquelehacenatenderdeunaformaespecialciertosestmulosfrenteaotros
porejemplo,elrostroolavozhumanafrenteaotrosestmulosvisualesoauditivos,
postularlaexistenciadeprincipiosquefacilitanoguanelconocimientosuponecreeren
principiosinnatoscuyaexistencianohasido,demomento,claramentedemostrada.
Antesdefnalizaresteapartado,vamosareferirnosbrevementealapercepcindel
color.Veelrecinnacidoelmundoencoloroenblancoynegro?Losestudiosquese
hanllevadoacaboponendemanifestoquedesdeelprimeroelsegundomeslosbebs
percibenydiscriminanloscolores.Susconductashacenpensarquelosbebsyadisponen
de las clulas encargadas de la percepcin del color y las vas de transmisin neuronal
propias del ojo humano adulto (Lcuyer, Pcheux y Streri, 1994).Adems, aunque la
preferenciaporloscoloresesunacuestinsubjetivaeinclusocultural,sehaobservado
quedesdelasprimerassemanasdevidalosbebspreferenmirarlosdenominadoscolo-
resbsicosoprimarioscomoelverde,elazuloelrojofrenteaotroscomoelnegro
yelamarillo(Lcuyeretal.,1994).
2.2. La percepcin auditiva
Comoyahemosvistoalhablardelrecinnacido,diferentestrabajoshanpuestodema-
nifesto que el sistema auditivo comienza a funcionar durante el perodo de gestacin.
Cuandoelfetoestdentrodelteropercibeyreaccionaalosruidosinternosdelamadre,
comoellatidodelcorazn,ytambinsuvoz,aunqueelmediolquidoenelqueseen-
cuentraatenamucholossonidos.Peroanmsqueelmerohechodepercibirsonidos,
elrecinnacidoparecereconocerypreferirdeterminadossonidos.As,lasvoceshuma-
nasolamsicaparecenestmulosprivilegiadosfrenteaotrotipodesonidos.
64 Bloque I. El desarrollo temprano
Cmo se ha investigado? Mediante el estudio del ritmo cardiaco en fetos. Se ha com-
probado que ante un acontecimiento o estmulo nuevo los fetos y recin nacidos expe-
rimentan una deceleracin inicial del ritmo cardiaco que luego vuelve a la normalidad.
Procedimiento: La madre est tumbada tranquila; se registra el ritmo cardiaco del
feto. En cierto momento la madre comienza a dirigirse al feto en lenguaje maternal. Le
dice por ejemplo: hola beb! Cmo ests hoy? Durante la emisin de la madre se
realiza un segundo registro del ritmo cardiaco del beb.
Qu se observa? Deceleracin del ritmo cardiaco al comienzo de la emisin verbal
de la madre. El ritmo cardiaco no se altera cuando la madre permanece en silencio o
susurra. Este tipo de medidas tambin se han tomado ante estmulos musicales obser-
vndose las mismas respuestas.
Conclusin: Los resultados muestran que los fetos atienden a los sonidos de la voz
de la madre y a estmulos musicales.
Cmo sabemos si los bebs preeren la voz de sus madres?
Se han realizado experimentos con bebs de 72 horas de vida a los que se presentan
muestras de habla emitidas por sus madres y por otras mujeres.
Cmo se ha investigado? Mediante la tcnica de preferencia, el beb es expuesto
a los estmulos de inters y a la vez succiona un chupete conectado a un ordenador que
registra la tasa de succin.
Procedimiento: El beb escucha una serie de slabas (pat-pat-pat) previamente
grabadas por un investigador y succiona. Despus se presenta una grabacin con la voz
de su madre. Posteriormente, se le presenta otra serie de slabas diferente (pst-pst-pst)
mientras succiona y a continuacin una grabacin con la voz de otra mujer que no es
su madre.
Qu se observa? En la fase experimental se presenta de nuevo al beb otra serie
de slabas. La comparacin crtica es la siguiente: succionar ms el beb cuando oiga
la serie de slabas que preceda a la voz de la madre o a la voz de la otra mujer?
Resultados: Los bebs succionan ms ante la serie de slabas que se asoci con la
voz de la madre.
Conclusin: Por una parte, el beb es capaz de aprender la asociacin entre estmu-
los (la serie de slabas precede la voz de la madre) y, adems, preere claramente la voz
de la madre.
CON LOS PIES
EN LA TIERRA Cmo sabemos si los bebs oyen?
Estapreferenciaporlavozmaternanosehaencontradocuandosecomparanlavoz
delpadreconlavozdeotroshombres,locualindicaraquelapreferenciasedebeala
experienciaintrauterina.
Ademsdelreconocimientoypreferenciaporlavozdelamadre,losrecinnacidos
parecequeyadistinguenentrediferentessonidosdelhabla.Sinentrarenlosdetalles
procedimentalesdelosexperimentos,losestudiosyaclsicosdeEimasycolaboradores
(1971)pusierondemanifestoquelosbebsdetanslounmesyadiferenciabanentre
elsonido/p/yelsonido/b/.Estosdossonidossonmuyparecidos,perosediferencian
eneltiempoquetardaenexpulsarseelairequehacevibrarlascuerdasvocales.Esta
mnimadiferenciadetiempoespercibidaporlosadultos,deformaqueambossonidos
Captulo 2. El desarrollo cognitivo del beb 65
se procesan como diferentes y no se confunden palabras como por ejemplo par y
bar.
Otrosestudioshanencontradoqueenmuchoscasosbebspertenecientesacomuni-
dadeslingsticasdiferentesdistinguenlosmismossonidosaunquenoestnpresentesen
sulengua,algoquelosadultosnosomoscapacesdehacer.Comoyavimosanteriormen-
teestacapacidaddediscriminacinfonolgicasemantieneduranteunosmesesyluego
sepierde(vaseCaptulo3).Laprincipalhiptesisparaexplicarestosresultadosesque
llegaunmomentoenqueloquenoresultatilsepierde.Setrata,portanto,deecono-
mizarespacioenelcerebroyguardarloparaloquesresultarelevante.
Todos estos resultados han sido interpretados desde algunas perspectivas tericas,
comoevidenciasdequelosbebsvienenalmundodotadosdemecanismosespecfcos
para procesar y aprender el lenguaje. Dichos mecanismos permitiran que el beb se
oriente de forma preferente hacia la voz humana, que discrimine los sonidos del habla
desdemuytemprano,quepuedadiscriminarinclusolossonidosquenopertenecenasu
lenguamaternayque,fnalmente,pasadountiempopierdaestaltimacapacidadcuando
ya no resulta til ni necesaria.A pesar de la aparente armona entre todos estos datos,
otrosestudioshanvenidoacuestionarlos.Porunaparte,algunostrabajosnohanencon-
tradolosmismosresultadosrespectoaladiscriminacindesonidosy,porotra,esaca-
pacidadsehaobservadoenotrosmamferos,comolaschinchillasylosmacacos,queno
desarrollanlenguaje(citadoenEnescoyGuerrero,2003).Elqueotrosmamferostam-
binpercibandeformacategricalossonidosdelhablaapoyalaideadequeestacapa-
cidadconstituyemsbienunlegadoflogentico,apartirdelacualelhombrehapodido
elaborardespusuncdigofontico.Enelcaptulosiguienteseretomarnestosaspectos
sobrelapercepcindellenguajeyseprofundizarenotrosaspectosmscomplejos.
Vamosaterminaresteapartadoconunabrevereferenciaacercadecmopercibenlos
bebslascomposicionesmusicales.Dadoquelamsicaconstituyeunaproduccinex-
clusivamente humana y que ha sido un tema investigado en los ltimos aos, vamos a
ofrecerunpequeoresumendelosdatosmsrelevantes.Desdeeltercertrimestredevida
intrauterina, los bebs discriminan entre tonos agudos y graves, discriminando mejor
stosltimos.Apartirdelosseismesesdegestacinestapautaseinvierteyprefereny
discriminanmejorlossonidosagudos.Igualmente,desdetempranoparecensersensibles
alasmelodasyreconocenlevesmodifcacionesdetonosenmelodasconocidas.Estos
dosaspectos,latonalidadylameloda,parecenserimportantestambinparalaadquisi-
cindellenguaje.
Losestudiosrealizadossobrelapercepcindelasescalasylosestilosmusicalesin-
dicanqueladiscriminacinesmsfnacuandolamsicaqueseescuchaeslapropiadel
ambiente,esdecir,alaqueseestacostumbrado.As,cuandobebsoccidentalesescu-
chenmsicahindpercibirnmenosdetallescomocambiosdeescalaotonosdesaf-
nadosquecuandoescuchenmsicaoccidental(Ilari,2002).Tambinsehaestudiado
si los bebs pueden almacenar composiciones musicales en la memoria a largo plazo.
Cuandolosbebssehabitanapiezasmusicalesparecenreconocerlasinclusohastatres
semanasmstarde.Noobstante,alosseismesesnoreconocenlapiezacuandoseinter-
pretaconotrotimbreoconotrotempo(Ilari,2002).
Lamaneraenquelospadresymadrescantanasusbebsesotraformadeconocer
la msica. Esta forma de cantar tiene elementos particulares que la distinguen de cual-
quier otra interaccin: un tono alto, un tempo lento y una expresividad a la vez que se
66 Bloque I. El desarrollo temprano
canta.Algunosautoreshanencontradoquelosmodosdecantardepadresymadresson
diferentes. Las madres parecen cantar ms a menudo, pero interpretan melodas ms
simplesyestereotipadas;lospadrescantanmelodasmscomplejas,nonecesariamente
orientadashaciaelbebyamenudoinventadas(Ilari,2002).Noobstante,ambostienen
encomnquecuandocantanenpresenciadelbebaumentansuexpresividad,algoque
norealizancuandoelbebnoestpresente.Escuriosocmoestetipoderasgospropios
delcantodelospadresseencuentrantambincuandolospropiosnioscantanacompa-
erosoamigos.Comosealamosantes,lamelodaylatonalidadparecenserelementos
importantesenlaadquisicindellenguaje,perotambinenlacomunicacinafectivay
enelestablecimientodelapego.
2.3. El olfato, el gusto y el tacto
Estos otros sentidos han recibido mucha menos atencin que la vista y el odo, quiz
porquelascapacidadesdelrecinnacidoyelbebenestosmbitosestnmsclarasy
suscitan menos debate. Los estudios que se han realizado con bebs dentro del tero
muestranquedesdemuytempranoenelperododegestacinlosfetospuedendetectar
olores y sabores a travs del lquido amnitico (Kisilevsky y Low, 1998).Adems, las
expresionesfacialesylaorientacinhaciadeterminadosoloresysaborespermitensupo-
nerqueambossistemastransmiteninformacinyfuncionanyadeformasimilaracomo
lohaceneneladulto.
Enloreferentealolfato,enlosrecinnacidosseobservangirosdecabezaymuecas
deascocuandoselespresentanoloresdesagradables.Tambinparecenapreciarlosolo-
resagradablesconexpresionesfacialespositivasyausenciademovimientosderechazo.
Algunostrabajossehanpreguntadosiademsdedetectarolores,losrecinnacidoseran
capacesdereconoceroloresconocidos.Porejemplo,algunosinvestigadoreshancoloca-
do dos algodones, uno impregnado del olor de la madre y otro del olor de otra mujer,
cercadelasmejillasderecinnacidosdeunasemana.Apartirdelsextodaobservaron
quelosbebssegirabanconmayorfrecuenciahaciaelalgodnconelolordesumadre.
Este reconocimiento pone de manifesto que el sistema olfativo de los bebs funciona
desde muy temprano y, adems, que los procesos de memoria y reconocimiento de es-
tmulosseaplicanadiferentesmodalidadessensoriales.
Para saber si los bebs distinguen los sabores se ha procedido de manera similar a
comosehatrabajadoconelolfato.Esdecir,seleshahechoprobarsolucionesconsabor
dulce,salado,amargoycido.Alaspocashorasdenacerlosbebsrealizanmuecasfa-
cialesdiferentesalprobarlossaboresdulce,amargoycido.Cuandopruebansoluciones
dulceschupanconmayorintensidad,consumenmsysecalmanantescuandolloran.La
Figura2.8muestralasmuecasdeunbebalprobarunasolucincidayotraamarga.A
travs de estas imgenes podemos deducir que el beb detecta el sabor y lo encuentra
desagradable. Los datos acerca del sabor salado no estn muy claros.Algunos trabajos
encuentranqueelrecinnacidonodetectaelsaladohastalos4meses,mientrasqueotros
encuentran un rechazo de este sabor desde el nacimiento hasta los 4 meses (citado en
EnescoyGuerrero,2003).
Paraterminarconesteapartado,simplementeharemosexplcitoquelosrecinnacidos
yapercibensensacionestctilesydolor.Asporejemplo,lasreaccionesantelospinchazos
ponendemanifestoelfuncionamientodeestesentidodesdeeliniciodelavida.
Captulo 2. El desarrollo cognitivo del beb 67
2.4. La percepcin intermodal
Ademsdelestudiodelosdiferentessentidosquehemosidoviendo,algunosinvestiga-
dores se han preguntado si los bebs pueden conectar los estmulos que provienen de
diferentesmodalidadessensoriales.Losadultosasociamosunacaraconunavozyreco-
nocemosalgunosobjetosmedianteeltacto.Estosprocesossonposiblesporqueconecta-
mos las entradas que provienen de dos o ms modalidades sensoriales diferentes para
representarnosoconocerlamismapersonauobjeto.Lacuestintieneunagranimpor-
tanciaysehaplanteadodesdelosorgenesdelestudiodelconocimiento.Lacapacidad
pararelacionarmodalidadessensorialespermitedotaralentornodeestabilidadyunidad,
independientementedelasdistintasfacetasdelosestmulosquenospresentanlasdiver-
sasmodalidadessensoriales.As,alintegrarlatextura,laimagenyelsonidoqueprodu-
ceunobjeto,entendemosquesetratadeunosloyelmismoynodetresobjetosdife-
rentes. Pero, pueden los bebs tambin realizar estas asociaciones o se trata de
mecanismosqueseactivanmstardealolargodeldesarrollo?Silosrecinnacidosya
disponendeestemecanismo,podemospensarquepercibenelmundoconciertaunidad
yquenonecesitanaprenderquelosobjetostienenpropiedadesvisuales,auditivas,tcti-
Figura 2.8.
Muecas realizadas por un recin
nacido al probar una solucin cida
(arriba) y otra amarga (abajo)
(tomado de Vasta et al., 1992).
68 Bloque I. El desarrollo temprano
les,etc.,queseintegran.Alcontrario,siestacapacidadseadquieremediantelaexperien-
ciaconlospropiosobjetos,entonceselbebdeberaprenderquelasentradassensoriales
procedentesdeunmismoobjetopertenecenenrealidadalmismo.
Losestudiosllevadosacabohaninspeccionadolaconexinentrealgunasmodalida-
dessensorialescomolavistayeltacto,lavistayelodoolavistaylapropiocepcin.
Enloquesereferealacoordinacinentrelavistayeltacto,MeltzoffyBorton(1979)
idearonunexperimentoenelquebebsdeunmeschupabanunchupetequenohaban
vistoantes.Unodelosgruposchupabaunchupetelisoyelotrounchupeteconprotu-
berancias (vase Figura 2.9). Una vez que los bebs lo haban explorado mediante el
tacto,presentabanlasimgenescorrespondientesaamboschupetes.Aspues,cadabeb
veaunaimagenquecoincidaconelchupetequehabaexploradoconlabocayotrade
unchupetediferente.Losbebsmiraronmstiempolaimagendelchupetequecoincida
conelquehabanexplorado,mostrandocapacidadparaemparejarambosplanosdeles-
tmulo.
Lahabilidadpararelacionarunacontecimientovisualconunosonorotambinhasido
estudiadaconbebs.Desdeelnacimientolosbebslocalizanlossonidosgirandolaca-
bezaylosojosenladireccinenqueseproducen.Aunqueestacapacidadestpresente
desdeelnacimiento,parecequeapartirdeloscuatromesessevuelvemsefcazycon-
trolada. Igualmente, otros aspectos de la coordinacin entre la vista y el odo aparecen
deformaclaraaloscuatromeses.KuhlyMeltzoff(1982)presentarondosvdeossimul-
tneosenlosqueseveaunapersonapronunciandouna/a/enunadelasimgenesyuna
/i/enlaotra.Elsonidoqueescuchabanlosbebscorrespondaaunodelosdosfonemas.
Desdeloscuatromeseslosbebsmiraronmslaimagenquesecorrespondaconelso-
nidoqueescuchaban.Estemayortiempodemiradaseinterpretcomolapruebadeque
existaunacapacidadparaestablecercorrespondenciaentreunestmuloauditivoyuno
visual.Enestemismosentido,haytrabajosquemuestranqueapartirdeloscuatromeses
losbebstambinpreferenmirarlaimagendeunapersonacuyosmovimientoslabiales
coincidenconelsonido,frentealadeunapersonacuyosmovimientosestndesajustados
con el sonido.A los adultos nos resulta muy desagradable observar desajustes entre el
Figura 2.9. Chupetes liso y con protuberancias empleados por Meltzoff y Borton para estudiar
la percepcin intermodal.
Captulo 2. El desarrollo cognitivo del beb 69
sonidoylosmovimientoslabialescuando,porejemplo,unapelculaestmaldoblada.
Tomandoestaintegracinqueseproduceeneladulto,losestudiosconbebsmuestran
quedesdemuytempranolosbebstambinsonsensiblesaestosdesajustes.
Unaltimamodalidaddeconexinentrediferentessentidosalaquevamosareferir-
noseslaimitacindegestos.Laimitacindegestosobservadosenunmodelonecesita
delacoordinacinentrelavisinylapropiocepcin.Asporejemplo,siunbebobser-
va a un adulto sacar la lengua y consigue imitar el gesto, est poniendo en relacin lo
percibidomediantelavistaconlaejecucinensupropiocuerpodelmovimientoaimi-
tar
2
.LostrabajosdeMeltzoffyMoore(1983),quemostraronquerecinnacidosdedos
semanasdeedadeinclusodeunosminutosdevidaerancapacesdeimitargestosfaciales,
produjeronungranimpactoenlosdebatessobrelascapacidadesdelrecinnacidoyla
aparicindelarepresentacin.Paraestosautores,elquelosrecinnacidospudieranre-
producirelgestodeabrirycerrarlabocaosacarymeterlalengua,constituaunaprue-
badelaexistenciadeunacapacidadrepresentacionalinnataquepermitalaintegracin
deestasmodalidadessensoriales.As,elbebpodarepresentarselainformacinvisual
ylapropioceptiva,compararlasyejecutarunaaccin.Estasconclusionesibanencontra
delateoraformuladaporPiagetsobreelperodosensoriomotorquien,comoveremos
enseguida, pensaba que la capacidad para manejar y producir representaciones aparece
bastantemstardeeneldesarrolloapartirdelaoymedio.Lasinterpretacionesac-
tuales acerca de la imitacin siguen sin estar claras y, en general, cada autor infere en
funcindelmarcotericoexplicativoalqueseadscribe.
Antes de fnalizar este apartado queremos sealar que aunque los datos que hemos
ofrecidohastaelmomentoparecenindicarquelosbebspuedendesdemuyprontorela-
cionar informacin sensorial de diversas modalidades, una cosa es relacionar eventos
porejemplo,visualesyauditivosyotraintegrarinformacinrecibidamediantedi-
ferentessentidosparaidentifcarobjetos.Existendoslimitacionesqueimponenunritmo
aestaintegracindeinformacin:lamaduracindelossistemasperifricoycentralyel
ejerciciodeambossistemasmediantelainteraccinconelentorno.Estasdoslimitacio-
nessehanreveladoalobservarsequelatransferenciadeinformacinentremodalidades
sensorialesnoesbidireccionalduranteelprimerao.Porejemplo,bebsdedosmeses
puedenreconocermediantelavistaunobjetoquehanmanipulado,peronopuedenreco-
nocermedianteeltactounobjetoantesvisto.Locontrarioocurrealoscincomeses:el
beb reconoce mediante el tacto un objeto que ha visto antes, pero no logra reconocer
mediante la vista un objeto inspeccionado previamente mediante el tacto (Streri, 1987;
StreriyPecheux,1986,citadosenLcuyeretal.,1994).Podemos,aspues,concluirque
launidaddelossentidosnoesinnataniaprendida.Porunaparte,elbebestablecerela-
cionesentreeventosprocedentesdediversasmodalidadessensorialesdesdemuytempra-
nopero,porotra,necesitadelamaduracindelsistemaylainteraccinconelentorno
paraqueesaintegracinseacompletayefcazparatodaslasmodalidadesyentodaslas
direcciones.
2
Laimitacintempranahasuscitadomuchodebateysetratadeuntemaimportanteeneldesarrollodel
beb.Enestecaptulonodisponemosdelespacionecesarioparatratarloenprofundidad,peroellectorinte-
resadopuedeconsultarGopnik,A.,Meltzoff,A.yKuhl,P.(1999).TheScientistintheCrib.Minds,Brainsand
HowChildrenLearn.NuevaYork:WilliamMorrowandCompany.
70 Bloque I. El desarrollo temprano
3. La explicacin piagetiana del perodo
sensoriomotor
Comoanunciamosenlaintroduccin,unavezresumidaslascapacidadesperceptivasdel
recin nacido nos vamos a adentrar en la teora que formul Piaget sobre el desarrollo
cognitivodurantelosdosprimerosaosdevida.Estafase,quePiagetdenominperodo
sensoriomotor, constituye un viaje evolutivo que conduce al beb humano desde la
actividadrefeja,conlaquevieneequipadotrassunacimiento,hastalaconductainten-
cional ms temprana y la capacidad simblica. Veamos a qu nos referimos ms en
detalle.
Comoacabamosdeexplicar,elbebrecinnacidoposeeunaseriedeconductasfjas
que no dependen de la experiencia, son los denominados refejos del recin nacido.
Entrelosrefejosmsconocidosestnelrefejodeprensin,eldelamarchay,porsu-
puesto,eldesuccin.Recordemoscmoestasconductasrefejassevanmodifcandoy
adaptandoalolargodelosprimerosmesesdevida.Porejemplo,elrefejodesuccines
bsicoparalasupervivenciadelbeb,poresotodoslosbebssuccionannadamsnacer.
Sinembargo,elpezndecadamadretieneunaestructuraparticular,igualquelosdiver-
sostiposdebiberonesconlosquesealimentaalosbebs.Poresolosniosrealmente
aprenden a mamar, o dicho en trminos piagetianos, se acomodan a sus fuentes de
alimentacin,alavezqueasimilanelpecho/bibernasuesquemainnatodesuccin.En
estebaileasimilacin-acomodacinlogranperfeccionarelrefejodesuccinconelque
vienenequipadosalnaceryseconviertenensuccionadoresexpertos;esdecir,elrefe-
jo de succin, que constituye en principio una habilidad interna al nio, se modifca
adaptndosealascondicionesexternas,seadaptaalmundoexterior.
Igualquesucedeconelrefejodesuccinocurretambinconeldeprensin.Eneste
casodelaconductarefejadeagarreevolucionahastalaconductaintencionaldecoger
unobjeto.Paraelloelniohadeasimilarlosobjetosasualcance,peroalavezadaptar
suconductarefejaalascaractersticasdecadaunodeellos(vaseCaptulo1).
Piagetdiferenci6estadiosdentrodelperodosensoriomotor.Comodecamosantes,
a travs de estos estadios o fases, el beb humano realiza el viaje desde el ejercicio de
losrefejoshastaeliniciodelaconductaprimerointencional,yluegosimblica.Antes
depasaracaracterizarlosendetalle,vamosadetenernosenexplicarculeselncleode
cadaunodeellos.Paraestoesnecesariodefnirlossiguientesconceptospiagetianos,que
marcanlatransicindeunosestadiosaotros,dentrodelperodosensoriomotor.
Lasreaccionescircularesprimarias(RC1.)consistenenlarepeticindeacciones
sobreelpropiocuerpoqueconducenaunresultadointeresante.Porejemplo,cuandoel
bebmuypequeoencuentraporazarsudedopulgarjuntoasubocaycomienzaachu-
parlounayotravez.
Las reacciones circulares secundarias son acciones orientadas hacia el exterior,
hacialosobjetosexternos,yqueproducen,aligualquelasRC1.,resultadosinteresantes
oatractivosparaelbeb.Porejemplo,unbebde4mesesquetieneunmvilcolgando
desucunalogolpeaunayotravezproduciendoelmovimientodeste.
Elconceptodeintencionalidadoconductaintencionalsereferealabsquedade-
liberadadeunameta,pormediodeunaseriedecomportamientossubordinadosaella.
La intencionalidad es una caracterstica bsica de la conducta inteligente. Por ejemplo,
un beb de 9 meses, que an no gatea, ve un juguete interesante sobre su alfombra de
Captulo 2. El desarrollo cognitivo del beb 71
juegos, pero no puede alcanzarlo desde donde se encuentra. Entonces se le ocurre tirar
delaalfombrahaciasparacogerelobjeto.
Elconceptodereaccincircularterciariasuponelabsquedadeunefectointere-
sante o resultado atractivo para el sujeto, mediante la variacin y experimentacin de
distintasaccionesqueconduzcanatalefecto.Porejemplo,pensemosenunbebde15
mesesfascinadopordejarcaerunayotravezunjuguetedesdedistintasposicionespara
vercmosuena,dndecae,etc.
Enelestadio6elbebpasadeutilizaresquemasdeaccinexternaautilizarnuevos
medios,internos,paraconseguirelfnqueseproponga.Esdecir,elbebpuedecomenzar
ausarrepresentacionesmentalesosmbolos.Vamosadetenernosenesteconcepto,el
conceptodesmbolo,yaquelacapacidadsimblicaconstituyeunlogrofundamentalen
eldesarrollodelainteligencia.
Los smbolos son cualquier tipo de estmulo o cdigo que representa otra cosa (objeto,
persona...). El ejemplo prototpico de smbolo son las palabras; por ejemplo, la palabra
pelota no es ms que un conjunto de sonidos (fonemas) que en lengua espaola li-
gamos inmediatamente con el objeto redondo que sirve para jugar en distintas moda-
lidades (ftbol, baloncesto, etc.). Los smbolos tienen por tanto dos planos distintos: el
llamado plano del signicante o forma (en el caso de la palabra, sera el conjunto de
fonemas que la forman: /p-e-l-o-t-a/ en espaol, /b-o-l/ en ingls, etc.), y el plano del
signicado o realidad a la que representan. Pero las palabras, el lenguaje, no agotan
toda la realidad simblica. Tambin encontramos en otros mbitos o actividades la pues-
ta en funcionamiento de la capacidad simblica; en concreto, en el llamado juego sim-
blico, en el dibujo y en la imitacin diferida.
CON LOS PIES
EN LA TIERRA Qu es un smbolo?
Lacapacidadsimblicasuponeunlogrocrucialeneldesarrollointelectual[vasela
obra original de Piaget, La formacin del smbolo en el nio (1946/1961)]. Permite al
niopoderanticiparlasconsecuenciasdesusacciones,planifcarlasmismasyllegara
pensarorepresentarsenoslolarealidadpresentesinotambinlapasada,lafutura,la
imaginableolaposible.Suponeuncambiocualitativoporejemplo,discontinuidad
importantequemarcalatransicindeunmododerelacinconlarealidadsensoriomotor
basadoensensacionesyaccionesexternasaunmodosimblicoorepresentacional,
caractersticoyadeunnuevotipodeinteligencia,lainteligenciaoperacional(vaseCa-
ptulo 8). Veamos a continuacin, de forma ms detallada, la caracterizacin de los 6
estadiosdelperodosensoriomotor,planteadosporPiaget.
ESTADIO1:Elejerciciodelosrefejos(0-1mesaproximadamente)
Desdeelcomienzodelavida,elbebhumanoponeenprcticaelconjuntoderefejos
conelquevieneequipado.ComoplanteaelpropioPiagetenElnacimientodelainteli-
genciaenelnio(1936/1985),respectodecadaconductarefejaorefejo:
72 Bloque I. El desarrollo temprano
...pormuyimplantadoqueestencuantomecanismofsiolgicohereditarioy
por muy fjado que parezca en su automatismo inmutable, no por ello deja de
necesitarunciertoejercicioparaadaptarseverdaderamente,niesmenossus-
ceptibledeacomodacingradualalarealidadexterior(p.37).
Elejerciciodelosdistintosrefejoslesirvealbebhumanocomopuntodearranque
parasudesarrollopsicolgico.Losrefejosdelrecinnacido,porejemplo,eldesuccin
oeldeprensin,experimentanenesteprimerestadiopequeasadaptacionescombi-
nacindeasimilacinyacomodacin,yenesteejerciciosemodifcan,constituyndo-
seentoncesenconductascadavezmsalejadasdelopuramentebiolgico-hereditarioy
acercndosegradualmentealoqueconstituyenlasprimerasconductasadquiridas,pro-
pias ya del segundo estadio.Veamos una detallada observacin realizada por el propio
Piaget en relacin a este tipo de actividades que ocupan a los bebs menores de 2
meses:
Observacin10:Alos0;0(25)
3
Laurentseencuentratendidobocaarriba,sin
demasiadoapetito(nohalloradodesdesultimatoma)yestablecemosuncon-
tacto entre el pezn y su mejilla derecha. Se gira hacia el lado correcto pero
apartamos el seno hasta unos 5-10 cm. Se orienta durante algunos segundos
hacialadireccincorrecta,peroluegorenuncia.Trasunosinstantes(contina,pues,acos-
tado boca arriba, con su cara mirando el techo), comienza a mover la boca aunque dbil-
mente,yaquelacabezaoscilaalaizquierdayaladerechaparaacabarorientndosefnal-
mentehaciaelladoincorrecto.Brevebsquedaenestadireccin,seguidadeunammicade
llanto,ynuevadetencin.Despusdeunosmomentos,nuevabsquedaenladireccininco-
rrecta.Letocamoselcentrodesumejilladerecha:ningunareaccin.Solamentecuandoel
peznlerozalapiela1cmaproximadamentedesuslabiosescuandosegiraylocoge.
Parecera,alleerestadescripcin,quetodoelejerciciodelasltimassemanashasido
vano... Pero al repetir al da siguiente la misma experiencia se obtienen unos resultados
exactamentecontrarios,comoseguidamentevamosaver.
Alos0;0(26)Laurentseencuentratumbadobocaarribadandomuestrasdegranape-
tito.Letocoelcentrodelamejillaconmidedondicereplegado,tanprontoenelladode-
rechocomoenelizquierdo:acadaocasinsevuelveinmediatamentehaciaelladocorrecto.
Luego,mientrassiguerecostadobocaarriba,sienteelpeznenelcentrodesumejilladere-
cha. Pero cuando intenta cogerlo, se lo apartamos unos 10 cm. Estira entonces el cuello,
siemprehaciaelladocorrecto,ybuscadeunmodoclaro.Cansadoporelesfuerzo,descan-
sauninstante,siempreconelrostroorientadohaciaeltecho;luegosubocareemprendela
bsqueda y su cabeza se orienta inmediatamente hacia el lado idneo. En esta ocasin, se
adelantahastatocarelpezn,primeroconlanariz,luegoconlareginintermediaentrelos
orifciosnasalesylacomisuradeloslabios.Entoncesrepiteendosocasionesydemanera
muyprecisaelgestoanotadoen0;0(24).(Ibd.,pp.35-36.)
3
EnelsistemadenotacinutilizadoporPiagetlaedaddelosniosdesusobservacionessecodifcaen
aos (primer dgito), meses (segundo dgito) y das (tercer dgito, entre parntesis). De modo que 0;0 (25)
correspondealaedadde25das,y1;2(10)corresponderaa1ao,2mesesy10das
Captulo 2. El desarrollo cognitivo del beb 73
LaimportanciatericadestayotrasobservacionesquePiagetofreceensuestudio
del perodo sensoriomotor permiten comprender cmo un sistema de puros refejos se
constituyeenconductapsicolgica,adaptndosepasoapasoalarealidadexterior.
ESTADIO2:Lasprimerasadaptacionesadquiridasylasreaccionescirculares
primarias(1-4mesesaproximadamente)
Duranteestesegundoestadioaparecen,porquesehanidogestandodesdeelnacimiento,
lasprimerasconductasadquiridasyloquePiagetdenominreaccionescircularesprima-
rias. La mejor manera de apreciar de qu tipo de actividades hablamos es citando de
nuevootradelasobservacionesdelautor:
Observacin17:Alos0;1(2)Laurentgritadehambreensucuna.Selecoge
mantenindoleenposicincasivertical.Sucomportamientopasaentoncespor
cuatro fases sucesivas que se distinguen con bastante nitidez. Comienza por
calmarseeintentamamargirandolacabezaaizquierdayderechamientrasque
susbrazossemuevenalazar.Despus(segundafase),losbrazos,enlugardedescribirunos
movimientosdeenvergaduramxima,parecenaproximarsehacialaboca.Envariasocasio-
nes, una y otra mano rozan los labios; la mano derecha se pega a la mejilla del nio y la
estrechaduranteunossegundos.Durantetodoestejuego,labocapermanececompletamen-
teabiertaeintentasincesaraferraralgo.Entoncesquedaatrapadoelpulgarizquierdoylos
dosbrazosseinmovilizandepronto,elbrazoderechoquedadobladosobreelpecho,debajo
delbrazoizquierdo,queestasuvezretenidoporlaboca.Enunatercerafaselosbrazos
recorrendenuevoelespaciodesordenadamente,unavezqueelpulgarizquierdohabasali-
dodelabocadespusdealgunosminutos.Duranteestetiempo,elnioseagitaporlac-
lera,conlacabezatiradahaciaatrsysusgritosalternanconlosintentosdesuccin.Fi-
nalmente se inicia una cuarta fase durante la cual las manos se aproximan de nuevo a la
boca;staintentaentodomomentoalcanzarlosdedosquelerozan.Estosltimosintentos
noconsiguenningnresultadopositivoyelllantosereanudadefnitivamente.
Podemoshablarenestaocasindecoordinacin?...Lasucesindeestascuatrofases
pareceindicaruncomienzoderelacinentrelosmovimientosdelosbrazosylosintentosde
succin.(Ibd.,pp.57-58.)
Despus, la observacin 20 nos proporciona un claro ejemplo de reaccin circular
primaria,cuandoLaurentsechupaeldedopulgar:
Alos0;0(17),encambio,meloencuentrochupndoseelpulgar,apesarde
hallarsetumbado.[...]Elpulgar,despusdehabersalidodelaboca,vuelvea
ellaenunaseriedeocasiones.(Ibd,p.59.)
Las reacciones circulares primarias son ya conductas adquiridas que se logran me-
diantelarepeticindeaccionessobreelpropiocuerpo,accionesenlasquesevenimpli-
cadosclaramentelosmecanismosdeasimilacinporejemplo,asimilacinalesquema
refejodesuccinyacomodacinporejemplo,aldedoquesechupabaLaurent.
74 Bloque I. El desarrollo temprano
ESTADIO3:Reaccionescircularessecundariasyprocedimientosdestinados
aprolongarespectculosinteresantes(4-8mesesaproximadamente)
Lasreaccionescircularessecundarias,comodetallbamosmsarriba,implicanyaobje-
tos externos al propio cuerpo, por tanto, estamos ante un beb que se interesa por los
efectosqueprovocansuspropiasacciones:tirar,empujar,golpear,agitar,etc.Noobstan-
te,hayquerecordarqueenesteestadiolacapacidadintencionalnohahechosuaparicin
en el escenario psicolgico, por tanto, las actividades tpicas del mismo no son conse-
cuenciasplanifcadasobuscadas,sinoefectosprocedentesdedescubrimientosazarosos
queserepitenporelplacerqueproporcionanalbeb.LasiguienteobservacindePiaget
recogelascaractersticasdeestosprocedimientos:
Observacin 105: Desde 0; 4 (19), Laurent, como hemos visto (observacin
103),sabegolpearconlamanointencionalmentelosobjetoscolgados.Ahora
bien:alos0;4(22)sujetaunpalo,conelcualnosabequhaceryqueseva
pasandolentamentedeunamanoaotra.Elpalorozaporcasualidadunsona-
jerocolgadodelacapota:Laurentinteresadoenelactoporesteefectoinesperado,mantie-
neelbastnderechoenlaposicinqueacabadeocuparyloacercavisiblementealsonaje-
ro.Lorozaasporsegundavez.Haceretrocederelpalo,peroalejndololomenosposible,
comoparaintentardenuevolaposicinfavorable,yluegoloacercaalsonajero,yvuelvea
empezarcadavezmsrpidamente.(Ibd.,p.172.)
ESTADIO4:Lacoordinacindelosesquemassecundariosysuaplicacin
anuevassituaciones(8-12mesesaproximadamente)
A diferencia del estadio anterior, en el estadio 4 se observan ya conductas claramente
intencionales (CI). Esta nueva conquista, la intencionalidad, se logra a partir de que el
bebcoordinadosesquemasdistintosyunodeellossesubordinaalotroalesquema
que constituye el fn u objetivo de la conducta. Por ejemplo, el esquema de tirar o
arrastrar en el caso que utilizbamos al defnir CI se subordina al esquema de alcanzar
un juguete.Veamos en la siguiente observacin de Piaget, con su hija Jacqueline, este
tipodecoordinaciones:
Observacin 129: a los 0; 9 (24), Jacqueline est sentada e intenta coger su
pato, colocado cerca de sus pies. Como no lo consigue, lo acerca con su pie
derecho. No he podido ver si haba todava algn tanteo o si la reaccin era
inmediata.Alos0;11(21),encambio,dejacaeralsuelo,delcolumpioenque
sebalancea,uncisnedeceluloide:comonoconsiguerecogerlo,lodesplazainmediatamen-
teconlospiesyseloaproxima.(Ibd.,p.217.)
Estetipodeconductasyaintencionalescoincideneneldesarrolloconlosprimeros
indicios de anticipacin por parte del nio. Por ejemplo, el beb que se encuentra en
esteestadioanticipaquesumadrevaasalirdecasacuandolaveponindoseelabrigo.
Captulo 2. El desarrollo cognitivo del beb 75
Esdecir,sedaunreconocimientodequealgovaasuceder,perosiempreenelcontex-
to de acciones rutinarias que no implican an capacidad representacional. Hemos de
esperaranalestadio6paraobservaraccionesquerequieranelusodeestetipodeca-
pacidad.
ESTADIO5:Lareaccincircularterciariayeldescubrimientodelosnuevos
mediosmedianteexperimentacinactiva(12-18mesesaproximadamente)
Enesteestadionosencontramosdenuevoconreaccionescirculares,esdecir,actividades
queseiniciandemanerafortuitayqueserepiten;sinembargo,enestecasolareproduc-
cindelaaccinoelfenmenodalugaraunaverdaderaexperimentacin.Yanoesmera
repeticinperse,porelplacerqueprovocaelresultado.Enestecasoelniovamsall
yvara,grada,cambialigeramentesusmodosdeaccinobservandolasconsecuencias
queprovocan.Veamosmsclaramenteestetipodeactividadmedianteunejemplo:
Observacin141:Unprimerejemplonospermitircomprenderlatransicin
entre las reacciones secundarias y las reacciones terciarias: consiste en esta
conductaperfectamenteconocidapormediodelacualelnioexploraelespa-
cioalejadoyconstruyesurepresentacindelmovimiento,laconductadesoltar
odearrojarlosobjetosparaintentarseguidamenterecogerlos.
Recordemos(obs.140)cmoLaurentalos0;10(2)descubriexplorandounestuche
dejabn,laposibilidaddesoltaresteobjetoydedejarlocaer.Ahorabien,loqueleinteres
inicialmentefue,noelfenmenoobjetivodelacada,esdecir,latrayectoriadelobjeto,sino
msbienelactomismodesoltar.Paracomenzar,selimitareproducirsinmselresultado
observado fortuitamente, lo que constituye todava una reaccin secundaria, derivada, es
cierto,perodeestructuratpica.
Encambioalos0;10(10),lareaccincambiayseconvierteenterciaria.Enefecto,
ese da Laurent manipulaba un trozo de miga de pan (sin ningn inters alimentario: no
lo haba probado todava y no tiene idea de comerlo) y lo suelta continuamente. Llega
inclusoadesgajarunasmigajasqueluegodejacaerunastrasotras.Contrariamentealo
que suceda en das precedentes, no presta ninguna atencin al acto de soltar, mientras
sigue con la mirada con gran inters el mvil: en particular, lo mira durante largo rato
unavezcado,ylovuelvearecogercuandopuede.Alos0;10(11),Laurentestrecosta-
dosobresuespaldaperoreanudasinembargosuexperienciadelavspera.Cogesucesi-
vamenteuncisnedeceluloide,unacaja,etc.,extiendeelbrazoylosdejacaer.Vavarian-
doclaramentelasposicionesdelacada:tanprontoalzaelbrazoverticalmentecomolo
sostiene oblicuamente, hacia delante o hacia atrs respecto de sus ojos, etc. Cuando el
objetocaeenunaposicinnueva(porejemplo,sobresualmohada),lovuelveadejarcaer
dosotresvecesenelmismositio,comoparaestudiarlarelacinespacial;despusmodi-
fcalasituacin.(Ibd.,p.257.)
Mediantelasreaccionescircularesterciarias,elnioprovocasituacionesnuevas,aco-
modndose a los distintos objetos y luego las repite componente de asimilacin. Su
actividadexperimentadoralellevaadescubrirnuevosmediosparaconseguirlosfnes
76 Bloque I. El desarrollo temprano
quesepropone.Noobstante,estaexperimentacintienelugaranenelplanodelaac-
cin sensoriomotriz, no en el de la representacin. Hemos de esperar hasta el prximo
estadio, el estadio 6, para observar cmo la experimentacin se traslada al plano de la
representacinmental.
ESTADIO6:Lainvencindenuevosmediosmediantecombinacionesmentales
(18-24mesesaproximadamente)
Comoanticipbamosantes,elestadio6constituyeelpuntodetrnsitodelperodosen-
soriomotoraldeoperacionesconcretas.Eliniciodelacapacidadsimblicaorepresen-
tacionalconstituyeunhitoimportantsimoeneldesarrollodelainteligencia,quesupone
uncambiocualitativoenelmismo.Sematerializaenelpasodelainteligenciasensorio-
motriznosimblica,norepresentacionalalainteligenciaoperatoria,primeroalas
operacionesconcretasyluegoalasoperacionesformales.
Pero veamos, mediante un ejemplo, cmo el nio inventa nuevos medios mediante
combinaciones,yanomaterialesofsicas,sinomentales;esdecir,cmoplanifcasu
accinantesdellevarlaacabofsicamente.
Observacin179:Unejemplomscomplejoeseldelacadenadelrelojque
ha de hacerse penetrar en el orifcio de 16 34 mm. Recordemos tambin en
estecaso,lostanteosdeJacqueline.Lucienne,encambio,resolvielproblema
mediante una brusca invencin. A los 1; 4 (0), sin haberlo visto nunca antes,
Luciennemiralacajaqueleacercoyquevuelvosinquehayapodidoverelcontenido:la
cadenacaeyseextiendeenelsuelo,ylaniaintentainmediatamentevolverlaameter.Em-
piezapormetersencillamenteunextremodelacadenaenlacajaytratadehacerseguirel
resto, progresivamente. Este procedimiento que es el primero que emple Jacqueline, sale
bienporcasualidaddurantelaprimeraprueba(elextremointroducidoenlacajasequeda
casualmenteenganchado),perofracasaporcompletoenlasegundayterceratentativas.En
lacuartaprueba,Lucienneempiezacomoantes,seinterrumpey,trasunbrevemomentode
deteccinponeellamismalacadenaenunarepisacercana(elexperimentosellevaacabo
sobreunchal),haceunabolaconellaintencionadamente,tomalabolaentrelosdedosyla
introducedeunavezenlacaja.Alaquintavez,lapruebaempiezaporunregresomuybre-
vealprimerprocedimiento.PeroLucienneseinterrumpeinmediatamenteyvuelvealmtodo
correcto.Sextaprueba:xitoinmediato.(Ibd.,p.320.)
Adiferenciadelasaccionesqueseobservabanenelestadioanterior,lasconduc-
taspropiasdelestadio6noparecenoperaryamediantetanteoenelplanodelaaccin,
sinomedianteinvencin;adems,labsquedadelasolucinofndelaaccinest
de alguna manera controlada por el nio a priori, mediante combinaciones menta-
les.Elnioprev,anticipa,qumaniobrashadellevaracaboparaconseguirloque
quiere.
Estacapacidaddeanticipacinoprevisin,deplanifcacinendefnitiva,esunlogro
devitalimportanciaeneldesarrollointelectualdelnio,quemarcaelfndelainteligen-
ciasensoriomotriz,propiadelosprimerosmesesdevidadelbeb.
Captulo 2. El desarrollo cognitivo del beb 77
Tabla 2.2. Sntesis del perodo sensoriomotor
ESTADIO 1 (0-1 mes) Ejerciciodelosrefejos.
ESTADIO 2 (1-4 meses) PrimerasadaptacionesyRC1.
ESTADIO 3 (4-8 meses) RC2.aplicacinesquemassensoriomotoresaobjetosexternos.
ESTADIO 4 (8-12 meses)
Coordinacin de esquemas secundarios y aplicacin a situaciones
nuevas[CI].
ESTADIO 5 (12-18 meses) RC3.repeticindeunaconductaconvariaciones.
ESTADIO 6 (18-24 meses) Experimentacininterna[ICS].
Lecturas complementarias
MacFarlane,A.(1998).Psicologadelnacimiento.Madrid:Morata.
Piaget,J.(1936)Elnacimientodelainteligenciaenelnio.Barcelona:EditorialCrtica,1985.
Rochat,P.(2004).Elmundodelbeb.Madrid:Morata.
Actividades
1. Conteste a las siguientes preguntas.
A un grupo de recin nacidos se les muestran dos tipos de estmulos visuales: unos son
dibujos de rostros humanos esquemticos y otros son dibujos con los mismos rasgos
faciales pero colocados de forma desordenada. Midiendo el tiempo de jacin visual se
observa que los bebs miran ms al primer tipo de dibujos. Qu tipo de mtodo se ha
utilizado en este experimento?
a) Habituacin.
b) Preferencia.
c) Deshabituacin.
Imaginemos a un beb que jugando con el sonajero lo ha arrojado fuera del alcan-
ce de su mano e intenta cogerlo tirando de la manta sobre la que ha cado. Este es un
ejemplo de:
a) Una conducta claramente intencional.
b) Una reaccin circular secundaria.
c) Una conducta preoperatoria.
2. Comentario de texto
A continuacin aparece un texto que relata, dados los avances de la ciencia en la repro-
duccin humana, cmo podra ser el proceso de tener un hijo dentro de 20 aos. La-
lo con atencin y reexione sobre las cuestiones que se plantean al nal:
78 Bloque I. El desarrollo temprano
Clara, nacida en 2005, tiene hoy 25 aos. Tiene una buena situacin,
acabadecasarseyhadecididotenerunhijo.Paraello,decidepedircita
conunequipodeespecialistasdelaprocreacin.[...]Primeraetapa:Cla-
radebeaportarunamuestradeovocitos.[...]UnavezqueClaraestlista,
haceproducirinvitrounasdecenasdeembriones.Aprovechaparadecidirquesufutu-
rohijoserunaniamedianteunaseleccinpreviadelosespermatozoides.Desdeel
primerestadiodeldesarrolloelncleodeunacluladecadaembrinsesometeaun
examen gentico completo [...]. Por supuesto, los embriones portadores de genes sus-
ceptiblesdedesencadenarenfermedadesgenticas,desdeelautismoalamucoviscido-
sis,soneliminadosdeentrada.[...]Losembrionesquehansuperadoestaprimerase-
leccinsonsometidosaunanlisismsfno.Clarapodrapartarlosquetenganriesgo
dedarunniosordo,obeso,enclenque,demasiadograndeodemasiadopequeo,agre-
sivo,torpe,tmido,depresivo...[...]
Unavezterminadalaseleccindelosindeseables,sepasaalaseleccinpositiva.
Losembrionespreseleccionadossecomparanaperflestipoestablecidosgraciasalas
basesdedatosquecontienenmillonesdemapasgenticosindividuales.Segnsuspre-
ferencias,Clarabuscarunembrincuyoperflseacerquealdeuncampendeportivo,
de un premio Nobel, de una modelo, de un poeta, de un director de empresa, de un
monje,deunviolinistavirtuoso...Sisusambicionessonmodestas,podradetenerseaqu
eimplantarseelembrinmsefcienteentrelosquelanaturalezalehaotorgado.Pero
siningunodeelloslesatisfacepasaraalestadiosuperior,esdecir,alamanipulacin
gentica de uno de sus embriones. Los mdicos intentaran primero inhibir los genes
portadoresderasgosnodeseablesyestimularlosgenesconpotencialesprometedores
pero que son poco activos.A partir de ahora sabemos cambiar el comportamiento de
ungensintocarlo,actuandoatravsdelaqumicasobrelossistemasdeautorregula-
cinycomunicacinnaturalesdelaclula.
Parairanmslejos,habrqueintervenirconcirugaenunoovariosdelos23
paresdecromosomasquecontienenlos20.000genesdelgenomahumano.Elobjetivo
serintroducirvariantesdegenesqueniClaranisumaridoposeen.Desdehacevarios
aossabemosquitardelaclulalosgenesportadoresdeanomalasgravesyrempla-
zarlosporgenessanosfabricadosenlaboratorio.
LeMonde,6/8/05.
Reexione sobre las siguientes cuestiones:
Es lgico que la reproduccin humana permita la seleccin de rasgos fsicos y de
personalidad?
Existe algn caso para el que la seleccin gentica de rasgos debera no slo
permitirse sino implantarse como una tcnica comn?
Cree que existe algn peligro en la realizacin de esta seleccin de rasgos?
3. Comentario de texto
A continuacin tiene un texto que plantea la controversia entre las inuencias genticas
y ambientales en el desarrollo de las personas. Lalo con atencin y reexione sobre las
cuestiones que se plantean al nal.
Captulo 2. El desarrollo cognitivo del beb 79
Algunos autores defenden que los seres humanos han evolucionado en
formasqueloshacensensiblesaunaampliagamadeambientesyque:
1. Dentrodelampliorangodelosambientesfamiliarestpicos,losnios
exhibenpatronesadaptativosdedesarrollonormal.
2. Lasprcticasparticularesdecrianzadelosniosnoinfuyenengradoconsiderable
enlosresultadosdeldesarrollo.
3. Slo aquellos ambientes familiares muy alejados del rango normal (por ejemplo,
aquellosenlosquelospadressonviolentos,abusivosonegligentes)esprobableque
restrinjanenformanotableeldesarrolloyproduzcanresultadosdesadaptativos.
Por supuesto, desde estas posturas se supone que nios diferentes responden en
formasalgodistintasanteelambientefamiliartpico(odeseablepromedio)debido,
engranparte,alhechodequetienengenesdiferentes.Adems,eldesarrollodeunnio
o adolescente es infuenciado tanto por las reacciones que provoca en otras personas
que no son sus padres como por los nichos ambientales que construyen las prcticas
paternas de crianza aunque stas tienen poco efecto sobre el desarrollo siempre que
seanlobastantebuenas(esdecir,queestndentrodelrangodeloquepodraconsi-
derarse normal para los seres humanos). Desde este punto de vista, los padres slo
necesitanproporcionarunambientedeseablepromedioafndefomentarundesarro-
llosanoysatisfacersupropiafuncincomoguardianesefectivos.
Schaffer,D.(2000)Psicologadeldesarrollo:Infanciayadolescencia.
Le parece que un ambiente deseable promedio es suciente para que los nios
desplieguen sus potencialidades? Busque algn argumento que contradiga la postura
expuesta en el texto.
Cree que estas ideas pueden tener algn efecto en las pautas educativas que los
padres emplean con sus hijos?
En cuanto a las polticas sociales de un pas, podran estas ideas perjudicar a ciertos
sectores de la poblacin? Si cree que s explique a cules y por qu.
Soluciones a las actividades
1. Preguntas
Para la primera pregunta la respuesta correcta es la b). Se utiliza un mtodo de prefe-
rencia porque a los bebs se les exponen ambos estmulos a la vez y se observa cul de
los dos preeren mirar. La alternativa a) es falsa puesto que no se trata de una habi-
tuacin. No se presenta un primer estmulo hasta que el beb se cansa de mirarlo y
despus otro para ver si recupera la atencin. La alternativa c) es falsa puesto que la
deshabituacin no existe.
Para la segunda pregunta la respuesta correcta es la a). El beb que se describe
quiere recuperar el sonajero y por tanto realiza una conducta intencional. La alternativa
b) es falsa porque la reaccin circular secundaria, aunque implica acciones con objetos,
no incluye la intencionalidad. Se trata ms bien de conductas azarosas que el beb re-
pite por placer pero no con una intencin. Por ltimo, la alternativa c) es falsa puesto
que se trata claramente de una actividad sensoriomotora, basada en la accin y no
preoperacional.
80 Bloque I. El desarrollo temprano
2. Comentario de texto
Actividad libre.
3. Comentario de texto
Estas posturas ms inclinadas hacia el innatismo han sido enormemente criticadas. Mu-
chos autores piensan que dentro de lo que se puede considerar un rango de paternidad
sucientemente buena se producen grandes diferencias en el desarrollo de los nios
y los adolescentes. As por ejemplo, se ha encontrado que los padres muy demandantes
y sensibles tienen hijos con un mejor desempeo acadmico y se adaptan mejor al en-
torno social que los hijos de padres moderadamente sensibles y demandantes, que
entran dentro del rango normal en estas dimensiones de paternidad. Por otra parte,
desde algunos foros se ha expresado preocupacin por el efecto que puede tener en
los padres las pautas sucientes de crianza. Esa idea podra desmotivar a muchos
padres y provocar un menor compromiso a la hora de estimular y desarrollar las capa-
cidades de sus hijos. Por ltimo, tambin se ha sealado el efecto de estas premisas en
las polticas sociales y las repercusiones que pueden tener a la hora de elaborar planes
de intervencin para las poblaciones ms desfavorecidas. Pensar que poner mucho em-
peo en estimular y desarrollar las capacidades de los nios tiene el mismo efecto que
cuando slo se alcanzan niveles aceptables, puede provocar el abandono por parte de
polticos y profesionales de la implantacin de programas de prevencin e intervencin
que, denitivamente, han mostrado su ecacia en numerosos mbitos del desarrollo.
Los inicios
de la comunicacin
y el lenguaje
81
3
SONIA MARISCAL ALTARES
Esquema-resumen
Objetivos
Introduccin
1. Comunicacin y lenguaje
1.1. Denicin de conceptos
1.2. Componentes del lenguaje
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
2.1. Cundo comienza la comunicacin intencional? Requisitos cognitivos y
sociales
2.2. El papel del adulto: sobreinterpretacin de las actividades del nio como
conductas genuinamente comunicativas
2.3. Principales hitos en el desarrollo comunicativo durante el primer ao y
medio de vida
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
3.1. Atencin temprana al lenguaje
3.2. La percepcin inicial del habla
3.3. Hacia las primeras palabras
3.4. El inicio del desarrollo gramatical
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se abre la
polmica
Lecturas complementarias
Actividades
Soluciones a las actividades
82 Bloque I. El desarrollo temprano
Esquema-resumen
1. Comunicacin y lenguaje
Comunicacin y lenguaje no son sinnimos.
El lenguaje implica el uso de un sistema de smbolos convencional (lengua).
Diferenciacin lenguaje-lengua-habla.
Componentes del lenguaje: fonolgico, lxico-semntico, gramatical y pragmtico.
2. Desarrollo temprano de la comunicacin: del nacimiento hasta los 18 meses
El problema de la intencionalidad: los actos comunicativos como conductas intenciona-
les e intencionadas.
Perspectivas tericas sobre el estudio de la comunicacin: modelos cognitivos y mo-
delo funcional-interactivo.
Concepto de intersubjetividad primaria y secundaria.
El papel del adulto en el desarrollo de la comunicacin: sobreinterpretacin de con-
ductas del nio como genuinamente comunicativas desde el comienzo. Funcin no slo
activante, sino formante de este desarrollo.
Principales hitos en el desarrollo comunicativo durante el primer ao y medio:
Fase neonatal (preferencias por el rostro y voz humanos) y comunicacin de afec-
tos (2-3 meses); aparicin de la sonrisa social, protoconversaciones.
La mitad del primer ao: conductas anticipatorias, an no intencionales.
El perodo de 8 a 12 meses: atencin conjunta, referencia social, protoimperativos
y protodeclarativos.
El perodo de 12 a 18 meses: gestos comunicativos y vocalizaciones.
3. Desarrollo temprano del lenguaje: del nacimiento hasta los 3 aos
El desarrollo del lenguaje comienza mucho antes de que los nios empiecen a decir sus
primeras palabras.
Atencin temprana al lenguaje:
Anlisis perceptivos del habla desde antes del nacimiento. Experimentos con be-
bs dentro del tero y recin nacidos.
Percepcin inicial del habla:
El desarrollo de las habilidades perceptivas durante el primer ao; diferenciacin
de lenguas en funcin de las caractersticas prosdicas.
Segmentacin y extraccin de las primeras palabras:
El problema de la segmentacin inicial de las palabras.
Hacia las palabras:
Precedentes evolutivos de las primeras palabras: vocalizaciones prelingsticas
juego voclico, balbuceo cannico y modulado, jerga.
Gestos comunicativos y simblicos y primeras palabras.
El inicio del desarrollo gramatical: adquisiciones ms all de las palabras aisladas
conocimiento morfosintctico.
4. Existe continuidad entre la comunicacin prelingstica y el lenguaje?: se
abre la polmica
Desacuerdos en torno a la continuidad entre la comunicacin anterior al lenguaje y la
comunicacin lingstica.
Captulo 3. Los inicios de la comunicacin y el lenguaje 83
Introduccin
Sihayunahabilidadquecaracterizadeformamuyespecfcaalosmiembrosdelaespe-
ciehumanaessucapacidadparacomunicarse,ascomolosdiversosmodosdecomuni-
cacinqueutilizanenlaprctica.Antesdeadentrarnosenelterrenodeldesarrollodelas
habilidadescomunicativaslingsticasynolingsticasconvienehacerunaseriede
precisionessobrequeslacomunicacinyqudiferenciashayentrelenguajeycomu-
nicacin.Porotraparte,parapoderentendereldesarrollodellenguajeesnecesariotener
presentelacomplejidaddeste;esdecir,qucomponentestieneellenguajeycmose
relacionanentreellos.Veamosunoaunoestosaspectos.
1. Comunicacin y lenguaje
1.1. Denicin de conceptos
Comunicacinylenguajenosonsinnimos.Sondostrminosconceptualmentediferen-
tes, pero adems su distincin es crucial para poder entender el proceso de desarrollo
ontogenticonormalyalterado,paraestudiarlasdiferenciasentrelasdiversasespecies
Objetivos
Diferenciar comunicacin y lenguaje.
Distinguir comunicacin prelingstica y lingstica.
Revisar los principales componentes del lenguaje.
Identicar los principales criterios que denen la comunicacin intencional.
Conocer los requisitos cognitivos y sociales de la comunicacin y los modelos
explicativos propuestos en relacin a unos y otros.
Establecer cul es el papel que tienen los adultos en el desarrollo comunicativo
de los nios.
Describir las principales fases de la comunicacin prelingstica.
Describir las principales fases y procesos implicados en el desarrollo temprano del
lenguaje, en la vertiente perceptiva y productiva.
Conocer algunos mtodos de investigacin de las habilidades perceptivas tem-
pranas.
Diferenciar las explicaciones continuistas y no continuistas sobre la relacin entre
la comunicacin prelingstica y el lenguaje.
Modelo funcional-interactivo: apoyo a la hiptesis de la continuidad.
Modelos lingsticos: apoyan slo una continuidad funcional, no formal.
Aplicaciones del Modelo Natural de Adquisicin: los programas de estimulacin del
lenguaje antes de los 3 aos.
84 Bloque I. El desarrollo temprano
animalesincluida,porsupuesto,lahumana,paradisearestrategiasefcacesdein-
tervencinenestosdominios,etc.
Para distinguir ambos conceptos, vamos a acudir al reino animal. Pensemos en los
primates; uno de los rasgos principales de estos animales es que normalmente forman
grupossocialescomplejos.ComoapuntaGmez(2004),cuandounprimatequierehacer
algoconunobjetolotocayefectaunactomecnicoconlcomoagarrarlo,llevarloa
laboca,etc.Sinembargo,siquierehaceralgoconotroprimate,porejemplojugar,tiene
queactuardeformamuydiferente:tienequeproducirsealescomunicativas,talescomo
modifcar la direccin de su mirada, cambiar la expresin de su cara o realizar ciertas
posturasygestos,conelfndetransmitirasucongneresuobjetivo.
Parececlaroqueningunadelasaccionesanterioressonconductaslingsticas,aun-
quescomunicativas.Sinembargo,tambinenelreinoanimalencontramosconductas
msdifcilesdecategorizar.Porejemplo,losmonosvervet,parientesbastantelejanosdel
homosapiens,producenunconjuntodevocalizacionesqueusanencontextosbiendife-
renciadosydefnidos.Cuandovenundepredadorefectanemisionesvocalesdistintassi
se trata de un guila, de un leopardo o de una serpiente. Es decir, tienen al menos tres
tiposdevocalizacionesrelacionadascontresreferentesdistintos.Noestnestasvocali-
zacionesmsprximasalaspalabrasqueutilizamosloshumanos?
Porotraparte,siobservamosaunbebhumanode6o7mesesdifcilmenteescucha-
remosalgunapalabrareconocible.Emitirsonidosvocales,peronounidadeslingsticas.
Sin embargo, si preguntamos a sus padres si su beb se comunica de algn modo con
ellos, su respuesta ser afrmativa sin duda. Cuando ese nio ya hable habr ampliado
considerablemente su capacidad comunicativa mediante el uso del lenguaje. Si el nio
fuera sordo podra aprender el lenguaje, pero utilizando otra modalidad distinta de la
vocal:lamodalidadgestualquecaracterizalaslenguasdesignos.
La consideracin de los ejemplos anteriores nos permite ubicar correctamente los
conceptosdecomunicacin,lenguajeyhabla.Comunicacinestodoprocesodetrans-
misin de informacin de un emisor a un receptor/es a travs de sistemas de seales
olfativas,visuales,etc.ydesignosmuydistintos,desarrolladosespecfcamentepara
comunicarsevocalizaciones,palabras,gestos.
Eltrminolenguajesereferealacapacidaddecomunicacinotransmisindein-
formacin mediante signos arbitrarios, sonidos verbales o gestos manuales, que tienen
unaformaconvencionalyunsignifcado,ysecombinansiguiendounasreglasdetermi-
nadas. El lenguaje es una capacidad especfcamente humana, que se materializa en el
conocimientoyusodelasdiversaslenguasconstruidasalolargodelahistoria.Eltr-
minohablaslohacereferenciaalalenguaoral,frentealaescritaosignada.
Portanto,enelreinoanimalseencuentrandistintossistemasdecomunicacin,pero
lacomunicacinhumanaeslanicaqueincluyesistemasnolingsticosysistemaslin-
gsticos lenguas. El esquema de la Figura 3.1 pretende refejar las relaciones entre
estosconceptos.
1.2. Componentes del lenguaje
Generalmentenosreferimosallenguajecomounafacultadohabilidadunitaria.Sinem-
bargo,ellenguajeconstituyeunsistemamuycomplejo,integradopordistintoscompo-
Captulo 3. Los inicios de la comunicacin y el lenguaje 85
nentes o subsistemas, y cuyo dominio implica habilidades muy diferentes y de muy
distintos tipos. Pensemos qu es necesario para comprender la simple frase Hoy hace
solcuandoalguienlapronunciaenvozalta.Porunaparte,esnecesariodisponerdeun
sistemaauditivoquefuncionecorrectamenteyqueseacapazdetransmitirelmovimien-
todelaspartculasdeairequeproducelavibracindelascuerdasvocalesstaesla
defnicinfsicadecualquiersonidodelodoalcerebro,concretamentealreaauditi-
vaprimariadelacortezacerebral.
La audicin es un mecanismo muy variado. Comienza como un proceso
acstico,conlallegadadelaondasonoraalodoexterno;seconviertedes-
pusenunproceso mecnico,cuandoestaondasetransformaenmovimiento
deloshuesecillosenelodomedio;luegosetransmutaenunproceso hidru-
lico, en la cclea, cuyo medio acuoso cambia los movimientos anteriores en ola; por fn,
ensuetapamscompleja,loencontramosenformadeimpulso nervioso, electroqumico,
asupasodesdeelrganodeCortiporelnervioauditivohastalacortezacerebral.(Ma-
rrero,2000,p.99.)
Ademsdelossistemasauditivoynervioso,esnecesariodisponerdeunconjuntode
sistemas de conocimiento o representaciones relativos a: 1) los sonidos lingsticos
componente fonolgico, 2) el vocabulario de una lengua componente lxico-
semntico,3)lasreglasdecombinacindelaspalabrasparaformarfrasescompo-
nentegramaticaly,4)elusodelaspalabrasyexpresionesenfuncindelcontextoe
interlocutorcomponentepragmtico.Elfuncionamientoeinteraccindetodosestos
componentesesnecesarioparapodercomprenderelsignifcadodecualquierexpresin.
Siloquequeremosesproduciresamismaemisinlingstica,alashabilidadesan-
terioresfonolgicas,lxico-semnticas,morfosintcticasypragmticashayqueaa-
dirlacapacidadparaarticular,esdecir,realizarlosmovimientosdelosrganosarticula-
torios necesarios para pronunciar esas palabras. La actividad articulatoria implica una
complejacoordinacinneuromuscularyrespiratoria.
Aunquemuchosautoresalolargodelahistoriahansealadoquelosniosaprenden
el lenguaje sin esfuerzo, hay mltiples estudios que ponen en cuestin este aserto.

COMUNICACIN
LENGUAJE
LENGUAS
Oral (HABLA)
Escrita
Signos manuales
Figura 3.1. Relaciones comunicacin-lenguaje-lengua.
86 Bloque I. El desarrollo temprano
Especialmentedesdeunmarcotericoconstructivista,ellenguajeseconsiderasujetoa
uncomplejoprocesodeadquisicinoaprendizaje,quecomienzacomoveremosenel
Epgrafe 3 antes del nacimiento y se extiende prcticamente hasta el fnal del ciclo
vital.
2. Desarrollo temprano de la comunicacin:
del nacimiento hasta los 18 meses
Comoveamosenelapartadoanterior,losbebsson,comoloschimpancsydemsan-
tropoides,seresquepuedencomunicarse,peronodemodolingstico.Hastaelaode
edadaproximadamentelosniosnoempiezanaemitirsusprimeraspalabras.Pero,pue-
den comunicarse desde el momento del nacimiento? Qu habilidades son necesarias
paracomunicarse?Dequtiposondichashabilidades:cognitivas,socio-emocionales?
Apartirdequmomentosetransformanlosbebshumanosensereslingsticos?De-
sarrollaremoslasrespuestasalasprimeraspreguntasenlostressiguientesSubepgrafes.
EnelEpgrafe3nosocuparemosdelaltimapregunta.
2.1. Cundo comienza la comunicacin intencional?
Requisitos cognitivos y sociales
Enunsentidomuygeneralsepodraconsiderarquelacomunicacincomienzadesdeel
nacimiento.Elbebhumanopuederealizarconductascomollorar,expresarconelrostro
algunasemociones(vaseCaptulo4)yemitiralgunossonidosvocalesdesdequenace.
Dichasmanifestacionestienenunclarovalorcomunicativoparasuspadres.Puestoque
sonconductasinnatas,elllantoylaexpresinemocionalnoseaprenden;constituyenun
legadodelabiologaquepermitealnioexpresarestadosemocionalesbsicosynece-
sidadesdediversostipos.Perosonrealmenteconductascomunicativas?
Cuandolosinvestigadoreshantratadoderesponderaestacuestin,siempresehan
topadoconelproblemadelaintencionalidad.Unacosaesemitirunaconductaexpre-
sivadeunestadocualquierayotrabiendistintaemitirdichaconductavocal,gestual,
etc.conelobjetivoclarodequeotroorganismosehagaconscientedeesasealyel
propsitoligadoaella.Losbebsrecinnacidosemitenconductasexpresivasqueson,
comoveremos,sobreinterpretadasporeladulto,peronosonconductasdirigidasacomu-
nicaralgoaalguien.
Lamayoradelosinvestigadoresestndeacuerdoenconsiderarqueunaconductaes
verdaderamentecomunicativacuandoesintencionadamentecomunicativa;esdecir,slo
cuandoelniomanifestaquetieneintencinopropsitodecomunicarse.Pensemosen
otro ejemplo relacionado con el llanto: un nio de 4 o 5 meses llora insistentemente;
llegasumadre,lesacadelacunaycesadellorar.Enesteejemplo,sepuedeconsiderar
que el llanto es una conducta comunicativa? Desde luego no se trata de una conducta
prototpicaoclaramentecomunicativa,sinomsbienborrosa.Elniopuedehabersen-
tidoincomodidad,queexpresallorando,yslodejadellorarcuandocambialasituacin;
oelniopuedehaberaprendidoaasociarsullantoalallegadademam,sinms.Pare-
ce,pues,quecomunicarserequierelautilizacindeunaaccingesto,vocalizacindel
Captulo 3. Los inicios de la comunicacin y el lenguaje 87
tipoquesea,movimientoparatransmitirinformacindeformaintencionadaacerca de
algo. Tcnicamente, esto es equivalente a plantear que la conducta comunicativa lo es
porquetambinesintencional.
Tabla 3.1. Rasgos de las acciones o conductas comunicativas
Las acciones comunicativas son:
Intencionadas:sonactividadesconpropsito;porejemplo,muevolamanoconelpropsitode
llamarlaatencindealguien(intencincomofnalidad).
Intencionales:sonacercadealgo;esdecir,sonactividadesmentalesquetienencontenido(por
ejemplo:piensosobrealgo,adivinoalgo,creoalgo,etc.)
Serealizanmediantesignos(semiticas);lossignospuedentenerdistintosgradosdearbitrariedad
(desdelosndicesosealeshastalaspalabras).
Como vemos en la tabla anterior, al carcter intencionado e intencional, hay que
aadirelsemitico.Esdecir,unaconductacomunicativaloesporquetieneelcarcter
de smbolo o signo para otra persona. Est en lugar de algo, remite a otra cosa. En el
caso de las palabras es claro su valor semitico; pero tambin un gesto con la mano
puedeserunsignocomunicativo,desaludoporejemplo,ounamiradaunidaaunason-
risa en el marco de una interaccin entre dos personas puede querer decir algo para
ambos.
Siguiendo con este planteamiento, en la bibliografa (Bates, Camaioni y Volterra,
1975;Bates,Benigni,Bretherton,CamaioniyVolterra,1979;Camaioni,VolterrayBa-
tes,1976;entreotros)sehasealadoquelacomunicacinintencionalapareceentrelos
8y10meses,coincidiendoconelmomentoevolutivoenelquelosniossoncapacesde
coordinar los esquemas de accin dirigidos a los objetos con los esquemas dirigidos a
personaspararesolverunproblema(vaseCaptulo2).Esdecir,segnestemodelocog-
nitivo,lacomunicacinesunaconductaintencionadaquerequierelautilizacinycoor-
dinacindeesquemasqueseusancomomediosparaconseguirunametacoordinacin
medios-fnes. Por ejemplo, cuando un nio seala un juguete con el dedo para que su
padreseloacerqueestutilizandounmedioelgestodesealarparaconseguirun
fneljuguete.
Pero,bastaconlaexplicacincognitivaanteriorparapodercomprenderqusucede
entornoalos8-10mesesparaqueelniorealiceaccionescomunicativas?Essufcien-
teeldesarrollosensoriomotorparaexplicareldesarrollodelacomunicacin?Rotunda-
mente,no.
Lacomunicacinesuntipodeaccinentredosomsorganismosopersonasaun-
quetambinunopuedecomunicarseconsigomismo,obviaremosdemomentoestetema.
Portanto,eltrminointeraccinesmsapropiadoparareferirsealasaccionescomuni-
cativas.
ComovimosenelCaptulo2,elrecinnacidoyadisponedesistemasparaexpresar
estados.Desdeelnacimientoelnioestinmersoenunmundosocialformadoporper-
sonasque,comoacabamosdever,interpretandemodoinevitablesusacciones,susges-
tos, incluso sus sonidos vegetativos. Esta experiencia, tal y como puso claramente de
manifestoVygotski,noesbalad.
88 Bloque I. El desarrollo temprano
Nadel y Camaioni (1993), reco-
giendo tambin las aportaciones de
otros autores que se alinean con un
modelo funcional-interactivo
1
, plan-
tean que la comunicacin, como pro-
cesoinsertoenuncontextodeinterac-
ciones sociales, es ms que la mera
transmisindeinformacindeunemi-
soraunreceptor.Utilizanlametfora
de una orquesta como analoga de lo
queimplicaunprocesocomunicativo.
En primer lugar, no hay un intrprete
individual,sinoquedistintaspersonas
intervienen, pero no como elementos
aislados, sino interdependientes. En
segundolugar,lamsicaresultante
no se puede separar del proceso mis-
mo de interpretacin.Y, en tercer lu-
gar,aligualqueenlosgruposdejazz,
no hay una partitura cerrada o prede-
terminada desde el comienzo que sea
transmitida de persona a persona/s.
Del mismo modo que en este tipo de
orquestas la msica es un logro con-
junto y emerge en el proceso mismo
de interpretacin, la comunicacin
tambinsellevaacaboconjuntamen-
te. Los procesos comunicativos no
existenslocomoprocesosmentales/
representacionales independientes de
lainteraccinmisma.Endefnitiva,lacomunicacinnoesunprocesoqueseencuentra
sloenlamentedelemisorqueplanifcaelmensaje,sinoqueesmuchomsdinmico.
Adoptando esta metfora, el desarrollo de la comunicacin constituye un proceso
evolutivo que requiere de la participacin de habilidades cognitivas y sociales, algunas
tanbsicasqueconstituyenpredisposicionesinnatasdetipoperceptivo.Estaspredispo-
sicionesopreferenciasperceptivascontribuyenaquelosbebs,desdesunacimiento,se
encaminenporlasendadelainteraccincomunicativaconlosotros.
Recordemosalgunasdelaspreferenciasyrespuestasatencionalesqueelbebmani-
festadesdequenace(vaseCaptulo2):
La fuerte orientacin hacia la voz humana. Los bebs preferen escuchar la voz
humanaaotrossonidosdelambiente(Friedlander,1970).
Identifcacintempransimadelavozdelamadre,queeslaqueprefereentreotras
voces.
1
Otrosautoresutilizaneltrminosocioconstructivistaparareferirseaestosplanteamientostericos.
Figura 3.2. La comunicacin cara a cara es tpica
de las interacciones con bebs desde
su nacimiento.
Captulo 3. Los inicios de la comunicacin y el lenguaje 89
Preferencia por rostros humanos frente a otros estmulos visuales prcticamente
desdeelnacimiento.
Emparejamiento rostro-voz: los bebs miran ms a caras parlantes que silen-
ciosas;lesinteresanmsyaqueremitenauncontextosocialdeinteraccin.
Recordemosasimismoqueademsdeestaspreferenciasperceptivo-atencionales,los
recin nacidos tambin estn adaptados para actuar y captar la atencin de los otros.
Comovimosenelcaptuloanterior,eldatomssorprendenteenestesentidovinodela
manodeMeltzoffyMoore(1977),quienesmostraronensusexperimentoscmorecin
nacidoserancapacesdeimitaralgunosgestosquerealizabaunadultofrenteaellos(va-
seCaptulo2).Sibienestetrabajohadadolugararosdetintayainterpretacionesen-
frentadas,lociertoesquelacapacidaddeimitacintempranaesunaherramientamuy
tilparalainteraccincomunicativa.Imitaraotroesalgoascomodecirle:soycapazde
estarenlomismoquet;eseestarenlomismoesunrequisitofundamentaldetoda
accincomunicativa.Elhechodequelasimitacionestempranasseanmsfcilesdeeli-
citarensituacionesexperimentalesenlasqueelmodeloadultoseimplicaensituaciones
deinteraccinafectiva,ymuchomsdifcilesdeprovocarensituacionesenlasquetan
slo se presentan los estmulos experimentales sin ms (Kugiumutzakis, 1993), apoya
estarelacinimitacin-comunicacin.
Trevarthen(1982)tambinapoyalahiptesisdelaintersubjetividad,peropostulaque
losniosnacenyaconunamotivacinyunasociabilidadlatentes,quedenominacapa-
cidades de intersubjetividad primaria. Estas capacidades impelen a los neonatos a
buscarcontactosocialparacompartirafectoyatencin.Segnesteautor,sucapacidad
decomunicarsesedesarrollaconeltiempoencuantoasucomplejidadeintencionalidad,
perolosbebsyanacenconlaposibilidaddeexpresarintenciones,entreotras,lasinten-
ciones comunicativas. Este autor prefere usar el trmino motivos para referirse al
componenteinnatoyeltrminointencionesparalaelaboracindeestosmotivospri-
migenios gracias a la experiencia. Los motivos comunicativos seran sencillamente la
necesidadoelimpulsodebuscarcompaayenrolarseenintercambiosafectivo-comu-
Adulto
Nio Objeto
Figura 3.3. Triangulacin de las relaciones nio-objeto-adulto, base de la intersubjetividad
secundaria.
90 Bloque I. El desarrollo temprano
nicativos; no se refere en ningn caso a acciones dirigidas a otros para conseguir, por
ejemplo,confortoaliviarelhambre.
Alrededordelos9-10meses,laedadmgica,elbebempiezaasercapazdeinte-
grardosmanerasdeactuarquehastaesemomentopermanecenseparadas:lainteraccin
socialdirigidaapersonasylaaccindirigidaaobjetos.Trevarthendenominaaestaca-
pacidadintersubjetividadsecundaria.
Si bien el planteamiento deTrevarthen parte de un presupuesto innatista, no niega
el papel de la experiencia social y de la interaccin con los adultos en el proceso de
desarrollo comunicativo. En este sentido, coincide con los planteamientos funcional-
interactivosqueveamosantes.Dedicaremoselsiguientesubapartadoarevisarcules
el papel del adulto y a dirimir si su carcter es activante o formante en el desarrollo
comunicativo.
2.2. El papel del adulto: sobreinterpretacin
de las actividades del nio como conductas
genuinamente comunicativas
Yahemosmencionado,desoslayo,quelosadultos,deformainevitable,ademsdecon-
templaralosbebs,interpretanconstantementecualquiermirada,sonido,sonrisa,gesto
facialomovimientodelosmismos.Tiendenadarunvalorintencionadoycomunicativo
aalgoqueestrictamentehablandosonsloconductasexpresivo-emotivas.Sinembargo,
esestaactividaddesobreinterpretacinreiterada,deatribucindeintencionalidad,laque
ir constituyendo el andamiaje
2
necesario para que poco a poco el beb humano vaya
siendo capaz, por s mismo, de realizar actos intencionales. Veamos cmo se expresa
Rivire(1986)sobreestefenmeno:

Sudelicadaestrategiadecrianza(delospadres)lesconvierteenelparadigma
de los psiclogos naturales de los que habla Humphrey; seres que asignan
intenciones, predicen conductas, reconstruyen empticamente el mundo expe-
riencialdesusbebsycooperanconellosdeformapeculiar.Adems,nodan
lamismasignifcacinintencionalatodaslasconductasdelnio,sinoqueselaatribuyen
sobretodoasusproto-gestosyesquemasdepersona,porejemplo,alasconductasque
losbebsproducencaractersticamenteantelosestmulossocialesynoantelosfsicos[...].
Precisamente porque las madres atribuyen signifcado a las conductas de sus bebs, stas
lleganaconstituirseenaccionessignifcativasdelospropiosbebs.
2
Eltrminoandamiaje(scaffolding)fueutilizadoporprimeravezporBrunerenelsiguientesentido
metafrico:aligualquelosalbailesalconstruirunacasanecesitanprimerolevantarandamiosdeunaaltura
mayor que la que tiene la incipiente construccin, y trabajando en ese espacio es cmo pueden levantar el
edifcio,aslasmadresofgurasdecrianzasitansusaccioneseinterpretacionesenunnivelalgomayorque
lasdelnio,ayudandodeestemodoaldesarrollodelmismo.Alfnaldelprocesodeconstruccindeledifcio,
seretiranlosandamios.Astambin,unavezfnalizadoelprocesodeconstruccindeunafuncinpsicolgi-
caseretiranlasayudasexternasylaconstruccinsesostieneporsmisma.Larelacinentreesteconcep-
todeandamiajeyeldeZonadeDesarrolloPrximoesevidente(vaseCaptulo1).
Captulo 3. Los inicios de la comunicacin y el lenguaje 91
Lacitaanteriorponederelieveunaexplicacinmuyvygotskianasobreeldesarrollo
comunicativo: los nios llegan a tener intenciones comunicativas porque los adultos se
lasatribuyenantesdequepuedantenerlasrealmente.
Existenalgunosfenmenosrelacionadosconestosmodosespecialesdeinteraccin
bebs-adultos:
La sobreinterpretacin de miradas, sonrisas y vocalizaciones: los adultos ante la
mirada del beb tendemos a inferir que quiere algo, que busca algo y que nos
pidequemiremosdondelmiraparacomentarsobreello,cogerlo,etc.Delmis-
momodo,interpretamoslassonrisasomuecasdesonrisadesdemuytempranamen-
te,aunqueannotengancarctersocial(vanseCaptulos2y4).Encuantoalas
vocalizaciones,tambinselesatribuyeunvalorcomunicativo,aunquenosimbli-
co.Contodoello,losadultoslesvanenseandoalosbebsqutemassepueden
compartirycmoexpresarlos.
Lasprotoconversaciones:talcomosealSnow(1977)lasinteraccionesverbales
quelosadultosestablecenconlosbebsposeen,desdeelprincipio,unformatode
conversacin; es decir, los adultos ayudan a construir y mantener una estructura
cclicadealternanciadeturnos,aunquelosbebsannopuedanrellenarconpa-
labras sus intervenciones. Inicialmente, la madre u otro interlocutor sustituye las
carenciascomunicativasdelniorespondindoseasmismayaceptandotodotipo
deconductasdelbebsonrisas,gestos,gorjeos,inclusoeructos.Alprincipiono
seintercambiainformacin,sinoafectos.Progresivamente,lasconductasinfantiles
aceptablessonslovocalizacionesygestossusceptiblesdeserinterpretadoscomu-
nicativamente. De este modo los adultos seleccionan los medios comunicativos
vlidos, a partir de las diversas posibilidades expresivas del beb. La Tabla 3.2
muestralaestructuratpicadeestosintercambios.
Tabla 3.2. Ejemplo y estructura de una protoconversacin
Estructura de una protoconversacin
1. Elbebvocaliza
2. Elbebsonre
3. La madre sonre y acaricia
albeb



lamadrerespondevocalizando
lamadrehabla,sonreore
elbebsonreovocaliza
Incluso en situaciones como la de alimentacin, la madre y el beb establecen este
tipodepautasdeinteraccinqueKaye(1982)describidetalladamente.As,cuandoel
niocome,hacefrecuentespausasquealparecernotienenunafuncionalidadfsiolgica,
esdecir,nolesirvenparafacilitarladeglucin,nilarespiracin;sinembargo,lamadre
aprovechaesaspausasparahablarle,estimularleloslabiososonrerlehastaqueelnio
iniciaotroturnodesuccin.Seconstituyeas,conunaseriedeajustes,unaespeciede
dilogooconversacincorporal,quepermiteestarenlomismo.Comoveremosms
adelante,estetipodeintercambiosnoslofavoreceneldesarrollodelacomunicacin,
sinotambineldellenguaje.
92 Bloque I. El desarrollo temprano
Elpapeldeladultoenestetipodeinteraccines,sobretodoalcomienzo,muyactivo.
Eseladultoquienllevaelpesodelainteraccin.Sinembargo,elbebponetambinen
marchadesdemuytempranounrepertorioconductualquelepermiteengancharseen
estosepisodios.Elpapeldeladultonoparecesloactivanteoreforzante.Segnelmar-
coexplicativofuncional-interactivoosocioconstructivista,deudordelplanteamientoini-
cialdeVygotski,estetipodeactuacinayudaaldesarrollodeintencionescomunicativas
enelnio.Tieneunpapelformante,puespropicialaformacinoconstruccindeinten-
cionescomunicativasenelpropionio.
Enelsiguienteepgrafevamosapresentarunpanoramaevolutivodelosprincipales
momentoseneldesarrollocomunicativo.Estapresentacinserdescriptivayesquem-
tica,yaquehemosidodesglosandolosdosprincipalesplanteamientosexplicativosenlos
epgrafes anteriores (2.1. y 2.2.): la explicacin cognitiva y el enfoque socioconstructi-
vista.
2.3. Principales hitos en el desarrollo comunicativo durante
el primer ao y medio de vida
SiguiendoaReddy(1999),vamosadividirencincofaseselperododelacomunicacin
prelingstica,queabarcadesdeelnacimientohastalos12-18meses:lafaseneonatal,el
perododelos2-3meses,lamitaddelprimerao,elperodode8a12mesesydelos
12alos18meses.Estadivisinsehahechoenfuncindeloshallazgosempricossobre
eldesarrollocomunicativotemprano;sinembargo,hayquesealarquesehanrealizado
msinvestigacionessobrelasdosprimerasylaltimafase,queenelperododelos5a
los 11 meses.Veamos a continuacin una caracterizacin de cada una para obtener un
panoramadeldesarrollocomunicativoquetienelugarduranteelprimeraoymediode
vidadelnio.
2.3.1. Fase neonatal y comunicacin de afectos (2-3 meses)
Como acabamos de sealar, los bebs recin nacidos vienen dotados de programas de
sintonizacinyarmonizacindelapropiaconductarespectoaladelosotros,queinclu-
yentodaslaspreferenciasperceptivasyconductasexpresivasquepermitensuvinculacin
consuscongneres.Estosprogramas,alintersectarconlospropiosmecanismosdesin-
tonizacinenlamadreofgurasdecrianza,permitendarlugarymantenerunarelacin
que optimiza el desarrollo y que asegura las condiciones para la construccin mutua y
progresivadelarelacincomunicativo-afectivaentreelbebylosotros.
Si bien, como sealamos en el Epgrafe 2.1, los bebs presentan preferencias y un
interspeculiarporlavozyelrostrohumanodesdeelnacimiento,lociertoesquehasta
las4-6semanaslosbebsanpermanecenpocoactivosensusinteraccionesconeladul-
to.Sinembargo,entornoalos2mesesvanconfgurndoseconductasquefavorecenla
interaccincomunicativadeunmodomsactivo.Nosreferimosalasonrisasocial(va-
seCaptulos2y4)yalautilizacindemovimientos,vocalizacionesymiradasdemodo
mscoordinadoyactivoenlosintercambiosconlosadultos.Lasonrisasocialyanoes
lamuecaqueslosuperfcialmentesepareceaunasonrisa,sinoqueesunaconfguracin
facialclaramenteindicativadeplacerobienestarqueseproducenicamenteanteotras
personas;esdecir,enuncontextodeinteraccinsocial.
Captulo 3. Los inicios de la comunicacin y el lenguaje 93
Losintercambiosqueseproducenentreelbebylosotrossonmsdetipoafectivo-
expresivo.Elbebanteeladultoyasonre,vocaliza,semueve,iniciandodeestemodo
ciclosinteractivosenlosqueseintercambianafectos,perotodavanoinformacin.Las
protoconversacionesquemencionbamosantessonmarcosoformatostpicosparaestos
intercambios.
Tabla 3.3. El concepto de formato de interaccin
Qu es un formato de interaccin?
ElconceptodeformatofueelaboradoporBruner(1982).Esteautorsealaqueunformatosuponeuna
interaccin contingente entre al menos dos partes actuantes, contingente en el sentido de que puede
mostrarsequelasrespuestasdecadamiembrodependendeunaanteriorrespuestadelotro.Seobservan
formatos en las rutinas de interaccin que se establecen entre nios pequeos y adultos en situaciones
cotidianas:juego,comidas,bao.Enellasadultoyniohacencosaselunoparaelotroyentres,yestas
accionesestnpreviamentereguladasodefnidasporreglas.Porejemplo,alahoradelbaounbebysu
madrejueganarersecuandoestatapaydestapasucaraconlatoalla.Estetipodejuegoscircularesde
relacinexpresiva,queyaseobservanenelestadio2delperodosensoriomotor,sonejemplostempranos
deestosformatos,queluegosehacenmscomplejosyserellenandepalabrasenmomentosposteriores
deldesarrollo.
Entrminospiagetianos,aunqueelpropioPiagetnoabordestetema,sepodrade-
cirquelosjuegoscircularescaraacaraseranproductodelaasimilacinrecprocade
losesquemasdedosomspersonas.Veamoslanarracindeunadeestassituacionesde
lamanodeSchaffer(1989):
La madre mira atentamente al nio con la cara inmvil y espera. La cabeza
delniosevuelvehaciaunladoysumiradaseaparta.Despusdeunratose
vuelvehacialamadreeinmediatamenteentraenjuegoelrepertoriodeconduc-
tas de ella especfcas para con el nio: recibe la atencin de este con gran
alegra,aproximasucaraaladel,letocayvocalizadeesemodoqueleestespecialmen-
tedestinado.Elnioobservaalprincipioensilencio;despus,tambinlentraenaccin,
sonriendoymurmurandoyponiendolascuatroextremidadesenmovimiento.Puedequemuy
prontomiredenuevohaciaotraparte,aunquetalvezsloduranteunafraccindesegundo
antesdevolveraatenderalasgraciasdesumadre.Finalmente,miraraotroladodurante
bastante tiempo, como si, por el momento hubiese roto el contacto. Tambin la madre se
calmaentonces;siguevigilando,sinembargo,preparadaparaelsiguienteepisodio(p.64).
2.3.2. La mitad del primer ao: conductas anticipatorias
Entornoalos6-7meseslosbebsparecendirigirmssuatencinalosobjetosyeven-
tosdelambiente.Denuevo,noeslsloelquedescubrelosobjetos,sinoqueeladul-
to los va introduciendo en su relacin con el nio, se los muestra, los utiliza, hacin-
doselos atractivos (Rodrguez y Moro, 1998). El inters del beb viene reforzado
ademsporlamejoraensusdestrezassensoriomotoras,queaplicaalosobjetosexter-
94 Bloque I. El desarrollo temprano
nos(vaseenelCaptulo2elestadio3delperodosensoriomotor).Laexperienciacon
elmundofsicoysocialpermitequeelniopuedayairanticipandolassituacionesen
lasquehaparticipadorepetidasveces.Deestemodo,cuandolamadre,porejemplo,se
aproximaalbebtendindolelosbrazos,lanticipaquelevanacogerytiendetambin
lossuyos.
Lacrecienteparticipacindelosbebsenjuegosinteractivoscomolosqueseal-
bamosenlafaseanteriorlespermitepoderiniciaryaestetipoderutinas.Porejemplo,
trasjugarrepetidasvecesaaproximarlacabezaaladultoychocarcabezaconcabeza,el
bebpuedebuscaractivamentequeeladultorepitaunciclomsdeaproximaciones.Sin
embargo,laconductadelbebenestoscasosesanticipatoria,peroannointencionalen
sentidoestricto.Elniosloescapazdeutilizarsusesquemasanticipatorioseninterac-
cionesqueyahansidoiniciadasporeladulto.Enelejemploanterior,elbebaproximan-
dosucabecitaaladultoleindicaquequiereseguirjugando,peronoescapazdeprovocar
porsmismomedianteconductascomunicativaselnacimientoenelcompaerodere-
lacin de intenciones que ste no poseyera previamente, sino que inserta sus primeros
esquemas interactivos en escenarios defnidos por la intencin previa del adulto (Ri-
vire,1986,p.132).
La creacin de rutinas interactivas es pues importante no slo para regular al beb,
sino para permitirle que vaya extrayendo constancias y regularidades que van a ser de
vital importancia, no slo desde un punto de vista cognitivo, sino especialmente desde
unpuntodevistasocial.Constituyenlasbasessobrelasquesevaconstruyendoelpro-
cesodecomunicacinconlosotros.
2.3.3. El perodo de 8 a 12 meses: el inicio de la conducta intencional
Antesdepodercoordinarlainteraccinconpersonasylaaccinsobreobjetos,losbebs
manifestanunconjuntodeconductasquesegnalgunosautoresapoyanlacontinuidad
deldesarrollocomunicativoysuprogresinhacialaconquistadelacomunicacininten-
cional.Estasconductasestnrelacionadasconsituacionesdeatencinconjunta.Atender
aunmismoobjeto/eventoalavez,buscaryprovocarestassituacionespareceunrequi-
sitodelacomunicacin.
Desde los 2 o 3 meses los bebs llegan a ser capaces de llamar la atencin de los
adultoshaciaellosllorando,utilizandosonidosvocalesdellamada,respondiendocon
sonrisasalosotros,peroapartirdelos8-11mesesrealizanotrasaccionesqueyama-
nifestan ms claramente su deseo de compartir la atencin con el adulto en relacin a
objetososituacionesexternas.Estasaccionesincluyendarobjetosalosotros,seguirla
miradadelosotros(Butterworth,1991)paraaveriguarculessuobjetodeinters,rea-
lizaraccionesprovocativasporejemplo,accionesprohibidascomotocarlasplantas
paraasegurarsequeeladultoatender.Elfenmenoconocidocomobsquedaderefe-
rencia social en el que el nio mira la expresin del adulto, buscando informacin en
ella,cuandoencuentraunapersona,situacinuobjetoambiguoynosabecmoactuar
antel,tambinconstituyeunaconductadeatencinconjunta.
Alfnaldelprimeraodevidaseproduceunhitomuyimportanteeneldesarrollo
comunicativo del beb. Este va a ser capaz de coordinar los esquemas de accin con
objetosylosesquemasdeinteraccinconpersonas,enloquesedenominaunesquema
tridiconico.EltringuloderelacinqueincluimosenlaFigura3.3esquematizaba
Captulo 3. Los inicios de la comunicacin y el lenguaje 95
esta nueva situacin, que presupone claramente atencin conjunta sobre un objeto ex-
terno.
El empleo de protoimperativos y protodeclarativos constituye la materializacin
deesteprocesodetriangulacinyesreconocidoporlacomunidadcientfcacomondi-
cedeunaautnticacomunicacinintencionalporpartedelnio.
Tabla 3.4. Conductas protoimperativas y protodeclarativas
Conductas protoimperativas y protodeclarativas
Bates,CamaioniyVolterra(1975)enuntrabajoyaclsicosealaronquedosdelosgestoscomunicativos
(intencionales,portanto)msimportantesson:
Los protoimperativos: gestos mediante los cuales el nio utiliza al adulto para conseguir algo. Son
peticiones de objetos, ayuda, acciones, etc., que los nios realizan utilizando medios no lingsticos
an.
Los protodeclarativos: gestos que utiliza el nio para compartir la atencin del adulto respecto a un
objetooeventoalqueseala.
La conducta de sealar (extender el dedo ndice hacia algo) puede ser utilizada como un protoimperativo
(porejemplo:elniosealaunagalletaparaquesumadreselad)ocomounprotodeclarativo(porejemplo:
el nio seala un coche que pasa por la calle para que su madre repare en l, comente sobre l, etc.)
2.3.4. El perodo de 12 a 18 meses: gestos comunicativos
y vocalizaciones
Eliniciodelasconductasdesealarconfnesprotoimperativosyprotodeclarativos(va-
seFigura3.4)puedeobservarseapartirdelos9o10meses;sinembargo,lamayorade
losniosnoexhibenestetipodeconductashastapasadoslos12meses(FrancoyBut-
terworth,1988).Pareceadems,quelosprotoimperativosantecedenalosprotodeclara-
tivos. Realmente, los segundos constituyen un tipo de conducta ms compleja que los
primeros.Unniopuedesealarparaqueledenunjugueteyellonoimplicanecesaria-
menteunaconductaintencional,sinounactoinstrumentalparaconseguirlodeseado;en
gorilasychimpancscriadosencautividadtambinseobservaestetipodeacciones,y
sin embargo no se observan protodeclarativos. Esta misma disociacin tambin se pro-
duceenniosautistasquepuedensealaroconducirlamanodeladultohaciaelobjeto
deseado,peronoparecensealarparacompartirsuintersconotroentornoaunobjeto
osituacindeterminada.
Lacaracterizacindeestosdostiposdeconductasesantemadedebateentredis-
tintosinvestigadores(vaseporejemplo,Gmez,SarriyTamarit,1993;Reddy,1999).
Deloquenocabedudaesdequelasactividadesdeinteraccinyatencinconjuntaque
seobservanyevolucionanalolargodelprimeraodeedadpreparanelterrenoparael
establecimiento de los signifcados compartidos, piedra angular de la comunicacin
lingstica.Lasprimerasprotopalabrasemergenenelcontextodelasactividadescomu-
nicativasquehemosestadoabordandoalolargodeesteapartado.Ademsestasprimeras
palabrasconvivencongestossimblicosorepresentacionales,quesonmovimientosdel
cuerpo,generalmentedelasmanos,querepresentanoseasocianconsignifcadosdeter-
96 Bloque I. El desarrollo temprano
minados,msomenosconvencionales.Porejemplo,elgestodeadisconlamanooel
gestofacialacompaadodelsonidoaummmparaindicarcomida.
Enelsiguienteapartadoentraremosdellenoeneldesarrollodelacomunicacinlin-
gstica,querequierelaconjuncindesignifcadoygestosvocalesomanualescon-
vencionales.Nosreferiremosalosprimerospasosquesesucedenhastaaproximadamen-
telostresaosdeedad.
3. Desarrollo temprano del lenguaje:
del nacimiento hasta los 3 aos
Esinnegablequeelintersquemuestranlosbebsdesdeelcomienzoporcomunicarse
con las personas que les rodean constituye un motor para el desarrollo del lenguaje, al
igualquelaparticipacinactivadedichaspersonas.
Sinembargo,adquirirellenguajequees,entreotrascosas,uninstrumentoprivilegia-
doparalacomunicacin,implicairmsalldedichashabilidadescomunicativas.Apren-
der una lengua, como vimos en el Epgrafe 1.2, es aprender muchas cosas diferentes,
aunquerelacionadas:lossonidosquelaforman,cmoseagrupandichossonidosenpa-
labras,qusignifcanlaspalabras,qutiposdepalabrashay,cmosecombinanparadar
lugarafrasesqueexpresanideassobrelosobjetos,laspersonas,loquesucedeosucedi,
etctera.Ytodoestoconstituyelatareaalaqueseenfrentaunniodesdequenace...o
quizsdesdeantes.
Figura 3.4. Nia de 14 meses utilizando un gesto protodeclarativo.
Captulo 3. Los inicios de la comunicacin y el lenguaje 97
Pensemos en un recin nacido...
Figura. 3.5. El proceso de adquisicin del lenguaje comienza antes de emitir las primeras pa-
labras.
Esevidentequeunbebmuypequeoannocomprendeellenguajeni,porsupues-
to, produce nada que se parezca al lenguaje. La nica actividad vocal que manifesta
desdequenaceeselllantoyalgunossonidosvegetativos.Engeneral,losnioscomien-
zanadecirsusprimeraspalabrasalrededordelao.Perohoysabemosqueestonosig-
nifcaquehastaentoncesnohayanaprendidonadasobrelalenguamaterna.Veamosqu
sucedealolargodeldesarrollotempranodelnio.
3.1. Atencin temprana al lenguaje
Comencemoscondospreguntas:Cundoempiezalaadquisicindellenguaje?Qu
sabenlosbebssobreellenguajeantesdedecirlasprimeraspalabras?Lasrespues-
tasaestaspreguntasconstituyentodaunreadeinvestigacin,relativamentereciente,
peromuyproductiva,quenoshapermitidocomprobarcmolosbebsmanifestancla-
ramenteunaatencintempranaallenguaje.Estaactividadsilenciosa,peropresen-
te desde muy pronto constituye la base sobre la que se asienta todo el aprendizaje
lingsticoposterior,elqueyaobservamoscuandolosnioscomienzanadejardeser
silenciosos,produciendosusprimeraspalabrasyavanzandoeneldesarrolloposterior
dellenguaje.
Enquconsisteestaatencinactivaallenguaje?Enprimerlugar,recordemosque
losestudiosrealizadosconfetosde6o7mesesdeedadgestacionalhanmostradoque
desdeaproximadamenteelsptimomesdeembarazoelniorespondealossonidosque
lellegandesdeelexterior.Estoesposibleporquelasvasauditivasylacortezatemporal
yasonfuncionalesaesaedad.Mltiplesexperimentosrealizadosconfetosdeesasedades
hanmostradoquestospuedenresponderasonidosexternoscomolavozhumanayso-
nidosmusicales(vaseelCaptulo2).Sielbebdetectadealgunamaneraelsonidode
lavoz,puedecomenzaraalmacenarestainformacinycrearrepresentacioneseviden-
tementemuylimitadasdedichoestmulo.Pero,quoyenrealmentelosbebsdentro
del tero?, o, cmo se oye lo que oyen los bebs?Algunos investigadores utilizan la
metforadeunapiscinaparaexplicarqueloqueoyenlosbebsenelmedioacuosoen
elqueseencuentranessimilaralaexperienciaauditivaquetenemosalsumergirnosen
unapiscina.Losbebsoyenlossonidosfsiolgicosdelamadre,entreelloselbombeo
delcorazn.Estossonidosconstituyenunabaseconstantedebajasfrecuenciasquecon-
trastanconlossonidosexteriores,enespeciallosdefrecuenciasaltas,comoelruidode
la sirena de una ambulancia, la msica y la voz humana. En condiciones intrauterinas,
98 Bloque I. El desarrollo temprano
quehanpodidoinvestigarsemediantelautilizacindemicrfonosresistentesalagua,se
pierdetodalainformacinfonticadellenguaje,ysemantienenicamentelainforma-
cin prosdica: la entonacin y el ritmo. En el siguiente apartado veremos cul es la
relacin entre este dato y los procedentes de experimentos de percepcin con bebs ya
nacidos.
3.2. La percepcin inicial del habla
Enelcaptuloanteriorsemencionabanlasfnascapacidadesdediscriminacinquepre-
sentan los recin nacidos en relacin a sonidos fonemas procedentes de distintas
lenguas. La evidencia emprica acumulada hasta hoy permite concluir que los bebs
menoresde6mesespuedendistinguirlalenguamaternadeotraslenguas.Enelsiguien-
tecuadroserecogeunodelosprimerosexperimentosqueaportarondatosenestesen-
tido.
Cmo se ha investigado? Mediante el paradigma de habituacin-deshabituacin en
el que se utiliza como medida la tasa de succin no nutritiva (Mehler, Jusczyk, Lambertz,
Halstead, Bertoncini y Amiel-Tison, 1988).
Procedimiento: Se presentaban grabaciones en la lengua materna (francesa) a nios
recin nacidos. Una vez habituados, se les presentaban grabaciones en otra lengua
(ruso).
Qu se observa? Al escuchar las grabaciones en ruso, los nios aumentaban la tasa
de succin signicativamente.
Conclusin: Bebs de 4 das!! de madres francesas, discriminan francs-ruso aunque
preferan escuchar la lengua materna.
CON LOS PIES
EN LA TIERRA Discriminan los bebs entre lenguas?
Otrosestudiosposteriores(Moon,Panneton-CooperyFeifer,1994)encontraronre-
sultados similares a los de Mehler y col., contrastando las lenguas espaola e inglesa.
Asimismo,Nazzi,BertonciniyMehler(1998)comprobaronquebebsrecinnacidosno
sloerancapacesdediferenciarsulenguamaternalaquehablansusmadresyuna
segundalengua,sinoquepodandiferenciardoslenguasnomaternas;porejemplo,bebs
francesesdistinguanlaslenguasinglesayjaponesa.
Quiereestodecirquelosbebshumanosrecinnacidossonalgoascomopequeos
polglotas en potencia? Los investigadores han sido especialmente cuidadosos al inter-
pretarestosdatosaparentementetansorprendentes.Qudistinguenrealmentelosneo-
natos?Culeselorigendeestastempransimashabilidadesdiscriminativas?
Como anticipbamos en el epgrafe anterior, los bebs no discriminan los detalles
fonticos, sino la informacin suprasegmental o prosdica entonacin, ritmo de las
lenguas.Estolosabemosapartirdeexperimentosquehanutilizadotcnicasdefltrado
delasmuestrasdehabla.Sinentrarendetallestcnicosprecisos,medianteestastcnicas
Captulo 3. Los inicios de la comunicacin y el lenguaje 99
se consigue manipular las grabaciones de habla de modo que se eliminan los detalles
fonticos;esdecir,lasemisionesfrasessintetizadasporordenadortraselfltradono
se entienden, aunque pueden reconocerse los patrones de entonacin y las estructuras
rtmicas.Presentandoemisionesdeestetipoalosbebs,estossiguendiferenciandoentre
sulenguamaternayunasegundalengua,especialmentesiestaltimasediferenciades-
deelpuntodevistaprosdicodelalenguamaterna.
Retomandolapreguntaporelorigendeestashabilidadesdediscriminacintempra-
na,sepuedesuponerquelaexperienciaintrauterinadelbebconstituyeunaprimerabase
de conocimiento, muy poco analtica, pero sufciente para que se inicie el proceso de
discriminacin prosdica temprana. Hemos visto que los sonidos y el lenguaje que le
lleganalfetonosonidnticosalosqueomoslaspersonasqueestamosenelexterior.
Todaestainformacinauditivalellegaalniofltradaoatenuada,puesentreelmundo
yelfetoseinterponeunabarrerafsica:elvientredelamadre(recurdeselametfora
delapiscina).Elbebnooyenipercibebienlosdetallesdelossonidos,nidelaspala-
bras, pero s puede comenzar a percibir algunos de los aspectos ms importantes del
lenguaje:laentonacinyelritmo.
Lasdistintaslenguastienenentonacionesyritmosdiferentes.Pensemosenlaento-
nacintpicadelidiomaalemnodelchinoyensusdiferenciasconlaentonacinespa-
ola.Sielbeb,apartirdelsptimomesdeembarazo,tienesusistemaauditivoenfun-
cionamiento,puedecomenzaraaprenderalgosobrecmosuenalalenguamaterna.Por
eso,alnacerreconocecomofamiliarlavozylalenguadelamadre,prefereestossoni-
dos a otros, y es capaz de darse cuenta de que esta lengua suena de modo diferente a
otras.Enlasiguientetablaseexponenlasprincipalesfasesenlaevolucindelashabili-
dadesperceptivo-discriminativasalasquenosestamosrefriendo.
Tabla 3.5. Evolucin de las habilidades de percepcin del habla
Edades aproximadas Habilidades de percepcin
6-7mesesdeedadgestacional Respuestaantelavozhumana,medidaatravsde
ladeceleracindelritmocardiaco.
Nacimientohasta6meses Discriminacinentrelalenguamaternayuna
segundalengua.
Discriminacinentredoslenguasnomaternas.
Desdelos6meseshastalos12 Sielbebestexpuestoaunasolalengua,
comienzaaperderlashabilidadesde
discriminacintempranaentrelenguasno
familiares.
Como introdujimos en el Captulo 2, el proceso de prdida de habilidades que se
observa a partir de los 6 meses constituye un proceso adaptativo que permite iniciar el
caminohacialaespecializacinoconvergenciaconlascaractersticasdelalenguama-
terna. Es decir, en un ambiente monolinge lo adecuado es aprender las caractersticas
fonolgicasdelalenguamaterna.
En este sentido, investigaciones ms detalladas (Kuhl, 1991, 1998, 2000) han mos-
tradoquelosbebsalrededordelos5o6mesescomienzanapercibirelsistemavocli-
codesulengua.Esdecir,sibienyanodiferenciancontrastesdesonidosfonemas
100 Bloque I. El desarrollo temprano
quenopertenezcanasulenguamaterna,sempiezanapercibirclaramenteculessonlos
sonidosvoclicosdesta.Despus,entornoalos12meses,losbebsyaparecenhaber
descubiertomuchasdelascaractersticasfonotcticasdesulengua.stasconstituyen
unconjuntodereglasimplcitas,clarosobrequsonidossecombinanconquotros
encadalengua.Porejemplo,enespaolnotenemospalabrasqueempiecenporsba,
peroenrusos.Estetipodeconocimientofonticoesimportanteparapoderaprenderlas
palabras que pueden formar parte del vocabulario de una lengua. Es alrededor de esta
edad,los12meses,cuandocomienzanlosprocesosdesegmentacinyextraccindelas
primeras palabras (vase siguiente epgrafe), procesos que vemos materializados en la
produccindelprimerlxicoinfantil.
Recapitulandohastaaqu,elconjuntodepreferenciasquemuestranlosbebshacia
la voz humana y los sonidos de las lenguas sirven para orientar su atencin hacia los
mismos.Constituyensesgosatencionales,naturalesennuestraespecie,queestncontri-
buyendoainiciarelprocesodeadquisicindelhablaydellenguaje,procesoquecomo
hemosvistotienesuorigenenlaexperienciaintrauterina.
EstetipodesesgossoncoherentesconloqueJusczyk(1997),autorqueharealizado
mltiples investigaciones en percepcin temprana del habla, denomina un proceso de
aprendizaje innatamente guiado. Para l, la adquisicin del lenguaje como proceso
complejopartedelaspreferenciasinnatasquehemossealado,peroconstituyeunproce-
sodeaprendizajeens.Esdecir,elconocimientosobrelavertienteperceptivadellengua-
je, de las lenguas concretas, se construye en interaccin con la experiencia lingstica.
Perolanaturalezaseaseguradequeencondicionesnormalesesteprocesoarranquede
formatemprana,implementandodemanerainnataunconjuntodepreferenciasquease-
gurenlaatencinyanlisisdelainformacinrelevanteparaadquirirellenguaje.Esain-
formacinrelevanteesladelasvoceshumanasquehablanalbebyalrededordelbeb.
En el siguiente apartado nos ocuparemos de forma resumida de los procesos que
conducenalaproduccindelasprimeraspalabrasalrededordelfnaldelprimeraode
vidayalaevolucinposteriordelprimervocabulario.
3.3. Hacia las primeras palabras
Todalaactividaddeanlisisperceptivoquellevanacabolosbebsqueannohablan
duranteelprimeraodevidatieneimportantesrepercusionesdecaraalaidentifcacin
de las primeras palabras y a su produccin. Identifcar las palabras que constituyen el
lenguajeadultonoestareanadafcil.Elprocesodeidentifcacindeloslmitesdelas
palabrasdondeempiezayterminaunapalabraconstituyeeldenominadoproblema
delasegmentacindelhabla.
Para comprender en qu consiste partamos de un ejemplo. Intentemos ponernos en
unasituacinsemejantealadeunnio.Pensemosenunapersonaquehablarusoyse
dirigeanosotrosquenoentendemosabsolutamentenadadeesalengua.Sealaporla
ventana y dice algo: Smatretumashinu. Nosotros miramos por la ventana y vemos
rboles, la calle, gente paseando, coches, etc.Ante esta situacin: cuntas palabras ha
dichoestapersona?Habremosodounasecuenciadesonidos,peroesrealmentedifcil
saber dnde empieza y acaba una palabra, cuntas palabras ha dicho, etc. Es decir, es
difcilsegmentarenunidadesconsentidoporejemplo,palabraslasemisioneslin-
gsticas,yaqueestasconstituyensecuenciasdesonidoscasicontinuas,quenoaparecen
Captulo 3. Los inicios de la comunicacin y el lenguaje 101
separadasporpausasqueindiquendndeempiezayterminacadauna.Podemossegmen-
tar correctamente una emisin cuando ya conocemos previamente las palabras que la
integran;peroasnocomienzanlosnios.
Lasnumerosasinvestigacionesrealizadasentornoalproblemadelasegmentacindel
hablaporbebsindicanquestosutilizanunconjuntodeclavesinformativasoindicios
quelesayudanairidentifcandolaspalabrasenellenguajequeledirigenlosadultos.Los
niosutilizaninformacinperceptiva,primeroprosdicayluegofontica,comobasepara
apoyarseenesteproceso.Perotambin,comosealanKellyyMartin(1994),losbebs
exhibenunasensibilidadmuyfnahacialospatronesprobabilsticosdelambiente.Es
decir,soncapacesdedarsecuentadequestmulosenelcasodellenguaje,qufone-
mas,slabas,etc.tienenmsprobabilidaddeaparecerjuntosy,portanto,extraenregu-
laridades del ambiente lingstico.Aplicando esta sensibilidad al lenguaje, los bebs se
aprovechandelasregularidadesestadsticasdesulenguafonotcticas,entreotraspara
poderhacerprediccionessobredndeempiezayacabaunapalabra.Sinembargo,extraer
las palabras utilizando nicamente informacin fonolgica prosdica y fontica es
posible,perodifcil.Cuandoseanalizanlasprimeraspalabrasdelosniosseconstataque
stassonpalabrasdeusomuyfrecuentequeaparecenreiteradamenteenellenguajeque
se les dirige (vaseTabla 3.9 ms adelante); por tanto, se dan en contextos cotidianos y
signifcativos para estos, cargados de funcionalidad.Y muchas de ellas se producen de
formaaislada,loquefacilitaenormementesusegmentacinyalmacenamiento.
Hastaaquhemosrevisadofundamentalmenteelprocesodeadquisicinperceptivo,
alquesededicanlosbebsdesdemuytemprano.Acontinuacinvamosaadentrarnosen
laproduccindellenguaje.Enestesentido,elhechodequenooigamosdecirlasprime-
ras palabras del beb hasta los 12-15 meses aproximadamente no quiere decir que ste
seaunsersilencioso,lingsticamentehablando.Duranteelprimerao,losbebsnoslo
lloran, sino que emiten diversos tipos de vocalizaciones, y alrededor de los 6-8 meses
comienzanabalbucear.Elbalbuceoevolucionahacindosepocoapocomscomplejoy
seproduceentonceslatransicinhacialasprimeraspalabras.Lasiguientetablarecoge
lasprincipalesproduccionesvocalesdesdeelnacimientohastadichatransicin.
Tabla 3.6. Precedentes evolutivos de las primeras palabras
Edad Producciones vocales del nio
I)0a6semanas
II)6a16semanas
III)16a30semanas
IV)6a10meses
V)10a14meses
VI)14a18meses
VII)18-20meses
Vocalizacionesrefejas;sonidosvegetativos;llanto.
Sonidosdearrullosyrisas.
Juegovoclico;ruidosconsonnticoscon/x
3
/,/g/...(p.ej.,ajo,ago,ag).
Balbuceoreduplicadoocannico(porejemplo:tt,mm).
Balbuceonoreduplicadoovariado(porejemplo:a-ba-t,e-bbi)yjergao
balbuceomodulado(produccindeemisionesininteligiblesperoinsertasen
gruposdeentonacinreconocibles;danlaimpresindeserfrases).
Jerga.Protopalabras.
Transicinalapalabra.
Primervocabularioinfantil.
3
Esteeselsmbolodelfonemaquesecorrespondeconelgrafemag/jenpalabrascomojota,genio.
102 Bloque I. El desarrollo temprano
Enlatablaanteriorseapreciaelprocesoevolutivoqueconducealbebhumanodes-
delaproduccindesonidosdeorigenorgnicohastalaemisindelasprimeraspalabras.
Enesteprocesodestacanfenmenosbienconocidoscomoeldelbalbuceoreduplicado
o cannico que se defne como la produccin de series de slabas con estructura de
consonante-vocal[CV]comoporejemplo,tatatata.
Tabla 3.7. Funciones del balbuceo
Para qu sirve el balbuceo?
Balbucearnoeshablar,perotampocoesunaactividadintil.Repetirunaslabaunayotravez
(ba-ba-ba,ga-ga-ga)tienealmenostresfunciones:
Experimentarconlossonidosquesepuedenhacer.
Practicarmovimientosrelacionadosconelhabla.
Darsecuentadelarelacinentrelosmovimientosquesehacen(articulacin)ylossonidosalos
quedanlugar(informacinauditiva).
Ademsdelbalbuceocannico,entornoalaolosniosempiezanaproducirsus
primerosgestoscomunicativos.Alcomienzo,elbalbuceoylosgestossemantienenin-
dependientes.Algomsadelante,seproducelauninentrevocalizacionesygestos.Las
emisiones orales son ya claramente comunicativas, aunque su contenido segmental
sea ininteligible por estar integrado, por ejemplo, por jerga o balbuceo variado (vase
Tabla3.6enlapginaanterior).
En torno a los 14-18 meses, aunque vara de nio a nio, se produce la transicin
hacialasprimeraspalabras.Seregistrandosnovedades:1) Losgestosreferencialeso
simblicos:produccionesgestualesquerepresentanalreferente.Porejemplo,elniose
sientaenelsueloyconlapalmadelamanogolpeaasuderechaparaquesesienteall
eladulto.2) Lasprotopalabras:expresionesarticuladasqueocurrenencontextosdef-
nidos y que no son imitaciones. Se caracterizan por su funcionamiento referencial a
unasituacincorrespondeunaprotopalabra,susignifcatividadsepuedenreconocer
por cualquier persona relacionada con los nios y su dependencia del contexto y de
gestosacompaantesconlamano,lacaraoelcuerpo.
Tabla 3.8. Ejemplos de protopalabras
Protopalabras son
Unniodiceaba?alavezquemuestraaladultoalgoquequiereabrir:caramelos,unfrasco...
Cuandounnioquierecomersealaendireccinalacocinaydiceaat.
Esdifcildarsecuentacundoproduceelniosuprimerapalabra.Lasprimeraspa-
labrastienenunaestructuramuysimple(CVCV)yaparecenligadasasituacionesycon-
textosmuyconcretos,sereferenapersonasyobjetoscotidianoseincluyenexpresiones
frecuentesytiles,quelessirvenparapedircosas,parapreguntar,etc.Peroantesdeque
produzcasusprimeraspalabrasreconocibleselnioyacomprendemucholenguaje,aun-
Captulo 3. Los inicios de la comunicacin y el lenguaje 103
que tenga que apoyarse tambin en la informacin presente en el contexto en que se
producen las palabras y frases que entiende. Por tanto, la comprensin se adelanta a la
expresindellenguaje.Porejemplo,segndatosobtenidosenespaolmediantelosIn-
ventariosMacArthur(LpezOrnat,Gallego,Gallo,KarousouyMariscal,2005)losnios
de10mesescomprendenunamediade39palabras,perosloproducenunamediade1
palabra.Losde14mesescomprendenunamediade121palabrasyproducen11palabras.
Amedidaqueaumentalaedadeldesequilibrioentrecomprensinyproduccinsehace
mayor.
Tabla 3.9. Ejemplos de primeras palabras
Las primeras palabras de Alberto
LasprimeraspalabrasdeAlberto,unniodeunafamiliaespaola,fueronestas:
papparasealarollamarasupadre.
mamparasealarollamarasumadre.
baparapediraguacuandotienesed.
nneparasealaraotrosniosonias.
yatparaindicarquehaterminadooquierequeterminealgo(comida,veruncuento...).
pineselnombredeunmuecoconelquejuega(Milupn).
Aprenderunasolapalabraimplicamuchosprocesosdistintosysuponeanlisissobre
el lenguaje nada desdeables, aunque las condiciones en que aprende el nio son muy
especiales.Despusdelaproduccindelasprimeraspalabras,elniovaincorporando
nuevosvocablosasuvocabulario.Elvocabulario,especialmenteapartirdelos2aos,
crece rpida y exponencialmente, como veremos en el Captulo 6. Sin embargo, este
componentedellenguajeeselquepermanecemsabiertodurantetodoeldesarrollo;de
hechopodemosestaraprendiendonuevaspalabrasdurantetodanuestravida.
3.4. El inicio del desarrollo gramatical
Adquirirvocabularioyaprenderausarellenguajesonhabilidadesbsicas.Peroelnio
hadeaprendertambinahablardeformamscompleja.Esdecir,tienequeaprendera
utilizarlosdistintoselementosgramaticalesdequeconstadichalenguamorfemasde
gnero, nmero, persona; artculos y otros determinantes, preposiciones, conjunciones,
etctera,ascomodominarlasreglasdecombinacinentreunoscomponentesyotros
porejemplo,hayquesaberqueenmuchasocasionesesobligatorioponerunartculo
delantedelnombreparaformarelSintagmaNominalenfrasescomoenlapiscina,etc.
Endefnitiva,elniotienequeadquirirlagramticadesulengua.
Quizelmejormododevalorarlaenormetareaquesuponeconstruirlagramticade
unalenguaseapensandoennosotrosmismoscomoaprendiceso,almenos,aspirantes
aaprendicesdeunasegundalengua,uobservandoapersonasextranjerasqueintentan
aprenderacomunicarseennuestralengua.Esrealmenteunprocesocostosoyqueexige
unaprcticamuyintensivasiqueremosobtenerresultadospositivos.
Volviendo al desarrollo infantil, podemos decir que aproximadamente aun-
que con importantes variaciones entre nio y nio a los cuatro aos el nio ya ha
104 Bloque I. El desarrollo temprano
adquirido las bases fundamentales de la gramtica de su lengua.A partir de esa edad
anesnecesarioadquirirlasintaxismscomplejaporejemplo:sihubierasvenido
habras comido mejor y las habilidades ligadas a la narracin y a otros tipos de
discurso.
El aprendizaje de los aspectos gramaticales morfosintcticos de las lenguas es
unafacetadeldesarrollolingsticodifcildeestudiarycomprender.Laadquisicinde
lamorfosintaxisdesulenguaconstituyeunodelosaprendizajesmsimportantesycom-
plejosquerealizanlosniosapartirdelaproduccindesusprimeraspalabras.
Tradicionalmente se han diferenciado dos grandes fases en el desarrollo gramatical
temprano.Lafasedeunapalabraoperodoholofrsticoylafasededospalabraso
hablatelegrfca(Braine,1976).Sesostenaqueeliniciodelacombinacindepalabras,
alrededor de los 2 aos, constitua el hito que marcaba el comienzo del desarrollo gra-
matical. No obstante, este planteamiento est muy sesgado por los primeros estudios
realizadosenPsicolingsticaEvolutiva(Brown,1973),quesehicieroneningls,lengua
conmuypocariquezamorfolgicaadiferenciadelaslenguasromnicascomolaespa-
ola.Losnumerossimosestudiosllevadosacabodesdelosaossesentahastahoysobre
losprocesosdeadquisicindediversaslenguashandibujadounpanoramamuydistinto,
aunquemuypolmicodesdeelpuntodevistaexplicativo.Enuncaptulointroductorio
comoestenopodemosentrarenlosdetallesdelprocesodeadquisicinmorfosintctica,
tanslosealaremosquehoyseaceptaquecomienzamuytempranamente,yquenoes
unprocesoaisladodelosdesarrollosfonolgicoylxico,queparecenteneruncomienzo
anterioraldesarrollogramatical.
Engeneralelprocesodeadquisicindellenguajeescomnparatodoslosniosyse
puedendescribirentodosellosfasessimilares.Sinembargo,sehanconstatadotambin
importantesdiferenciasindividualesenniosconundesarrollonormal,loquehacedif-
cilevaluarlosretrasosy/otrastornosdellenguajedeformaprecoz.Sinembargo,enlos
ltimosaoslasnumerossimasinvestigacionesenPsicolingsticaEvolutivahanapor-
tadoinformacinsobreelprocesoens,susdistintasfases,losmecanismosimplicados
enellas,lasdiferenciasentredistintaslenguasylarelacinentrelosdistintoscomponen-
tesdeldesarrollolingstico.Estaevidenciaempricanoesinterpretadadelmismomodo
porlosinvestigadoresprocedentesdedistintaslneastericas.Lapolmicaenrelacina
losfactoresexplicativosesespecialmenteprofundaenestecampocomoveremosenel
Captulo6.
4. Existe continuidad entre la comunicacin
prelingstica y el lenguaje?: se abre la polmica
Enestecaptulohemosrevisadolosiniciosdelacomunicacinyellenguaje,diferen-
ciandounoyotrodominio.Aunquelasrelacionesentrelashabilidadescomunicativas
yellenguajesonevidentes,ellenguajesuponerealmenteunmodonuevodecomuni-
cacin para el nio que ampla enormemente las posibilidades del sistema basado en
gestos, miradas y expresiones emocionales que utilizaba antes de decir las primeras
palabras. En este sentido cabe preguntarse si la comunicacin lingstica supone un
saltocualitativoenrelacinalaprelingsticaysiambosconstituyensistemassepara-
dosono.
Captulo 3. Los inicios de la comunicacin y el lenguaje 105
Los investigadores no se han puesto de acuerdo en las respuestas a las anteriores
preguntas.Quienessostienenlaideadelacontinuidadentreambostiposdecomunica-
cinconsideranque,tantodesdeelpuntodevistafuncionalcomoformal,lasactividades
comunicativasprelingsticasconstituyenunantecedentenecesarioparapoderadquirir
el lenguaje (Reddy, 1999). Para otros investigadores, la relacin entre ambos tipos de
comunicacinserestringeaunarelacinfuncional:tantolosdispositivosprelingsticos
comoellenguajesirvenparalacomunicacinylarelacinsocial,sinembargo,ellen-
guajerequieredeunconjuntodeoperacionesyprocesosmuyespecfcos,demodoque
slo se puede hablar de adquisicin del lenguaje en el momento que el nio ya com-
prende y empieza a producir signos lingsticos. La polmica por el momento sigue
abierta.
Sinembargo,msalldelasdisputastericas,sparecehaberunconsensogeneral
en torno a qu tipo de actividades favorecen el desarrollo de la comunicacin y el len-
guaje.Todasellasnosonsinoextensionesdeloquesedenominaelmodelonaturalde
adquisicin, es decir, del conjunto de estrategias no conscientes, desde luego que
losadultosutilizamosnormalmentealinteractuarconniospequeos.Elsiguientecua-
dro incluye las principales caractersticas del lenguaje dirigido a los nios llamado
tambinmothereseolenguajematernal/paternal,ydeloscontextosysituacionestpi-
casdeinteraccinadulto-nio.Estasestrategiasomodosdeaccinconstituyenlabase
delosprogramasdeestimulacindellenguajequesellevanacaboactualmenteconnios
menoresde3aos.ComorecuerdanJurezyMonfort(2001):
Loscontenidosdelosprogramasdeintervencindebeninspirarseenloqueya
conocemossobreeldesarrollolingsticodelnionormalelmtodo materno
siguesiendoelmejormtodoconocidoparatransmitirunacompetenciamxi-
madelenguaje(p.98).
Qu caractersticas tienen las situaciones tpicas de interaccin adulto-nio?
Situaciones cotidianas (rutinas, actividades ldicas, conversaciones sobre aconte-
cimientos o hechos de la vida cotidiana: visitas, juegos, etc.).
Situaciones de accin y atencin conjunta donde adulto y nio se inuyen mu-
tuamente, participan en la misma accin y atienden al mismo objeto o actividad
importancia para la adquisicin del vocabulario.
Situaciones de comunicacin motivadoras crean la necesidad de comunicarse
y signicativas se ajustan a los intereses y experiencias de los nios.
Cmo es el habla dirigida a los nios? Modicaciones en la forma de hablar:
Entonacin agradable al nio, que capta su atencin: tono ms elevado.
Habla ms lenta y con pronunciacin ms clara.
CON LOS PIES
EN LA TIERRA
El Modelo Natural de Adquisicin: base
de los programas de estimulacin del
lenguaje
106 Bloque I. El desarrollo temprano
Lecturas complementarias
Aguado,G.(2000).Eldesarrollodellenguajede0a3aos.Madrid:CEPE.
Karmiloff,K.yKarmiloff-Smith,A.(2005).Haciaellenguaje.Madrid:Morata.
Vila,I.(1999).Losiniciosdelacomunicacin,larepresentacinyellenguaje.EnJ.Palacios,A.
MarchesiyC.Coll(eds.).Desarrollopsicolgicoyeducacin.VolumenI.PsicologaEvolu-
tiva(pp.133-150).Madrid:AlianzaEditorial.
Jurez,A.yMonfort,M.(2001).Estimulacindellenguajeoral.Madrid:Santillana.
Pausas ms frecuentes.
Habla simplicada desde el punto de vista sintctico y semntico-lxico.
Apoyo gestual y prosdico.
Carcter alegre, exagerado: uso de exclamaciones, risas, onomatopeyas...
Predominio de un estilo de apoyo frente a un estilo correctivo; los errores del nio
tienden a ignorarse (sordera al error) y tienden a reforzarse sus esfuerzos co-
municativos.
Aplicaciones del Modelo Natural a la estimulacin del lenguaje: diseo de
formatos o situaciones similares a las que se dan en el ambiente natural.
Actividades
1. Preguntas
Las conductas expresivas que emiten los bebs de menos de 6 meses:
a) Son ya claramente comunicativas, como demuestra la evidencia emprica.
b) Pueden ser comunicativas dependiendo del contexto concreto de emisin.
c) No pueden ser an conductas comunicativas intencionales.
El uso del lenguaje constituye una habilidad muy compleja que implica muchos tipos de
conocimientos distintos. Desde este punto de vista, el nio comienza a adquirir el len-
guaje cuando:
a) Produce sus primeras palabras, en torno al ao.
b) Da muestras de atencin y preferencia hacia la lengua materna
c) Empieza a comprender el lenguaje alrededor de los 8-10 meses.
Un nio de 9-10 meses comprende adecuadamente y responde con gestos ante las si-
guientes emisiones cotidianas: dnde est pap?, quieres papilla?. Estas conduc-
tas ponen de maniesto el siguiente fenmeno:
a) El adelantamiento de la comprensin del lenguaje frente a la expresin o
produccin del mismo.
b) Se trata de un nio con un retraso del lenguaje incipiente al que habra que
atender.
c) Se trata de un nio que muestra claras preferencias por la comunicacin
gestual.
Captulo 3. Los inicios de la comunicacin y el lenguaje 107
2. Lea atentamente la situacin descrita en el siguiente prrafo y decida si la
conducta del gorila implicado es o no una conducta comunicativa. Razone
adecuadamente su respuesta.
Gmez(2004)comentaelcasodeunagorilade10meses,Muni,que
quera abrir una puerta. Como no alcanzaba al picaporte, general-
mentesesubaauntabureteparalograrsuobjetivo.Sinembargo,un
dasorprendialosinvestigadoresrealizandolasiguientesecuencia
deacciones:Segirhaciaunodelosinvestigadoresqueestabatomandonotas,tir
desubatayleempujendireccinalapuerta.Elinvestigadordecidimoverseen
dichadireccinenrespuestaalosempujonesdeMundi.Unavezall,lagorilatre-
pliteralmenteporencimadelinvestigador,mirandoalternativamentealpicaporte
yalcuerpodelapersonasobrelaqueseestabaencaramando.Sinembargo,niuna
solavezdirigisumiradaalosojosdedichapersona.AlfnalMundilogralcan-
zarelpicaporteyabrirlapuerta.
3. Establezca las correspondencias adecuadas entre las conductas descritas en
la columna de la izquierda y los descriptores que aparecen en la columna de
la derecha.
1. Unniosealaconeldedoparapedirunjuguete,alavez
queemitevocalizaciones.
A. Balbuceo cannico o re-
duplicado.
2. Unniode14mesesaprietaloslabioshaciendoelsonido
aummmcuandocomealgoquelegusta.
B. Conducta de bsqueda
dereferenciasocial.
3. Unaniade15mesessealaporlaventanaparamostrara
sucuidadoraungloboquellevaotronioenlacalle.
C. Conducta o gesto proto-
imperativo.
4. Aveceslosniosrepitenunaslabavariasomuchasveces.
Son slabas con una estructura de consonante-vocal (CV)
emitidasgeneralmenteencadena.
D. Gestoprotodeclarativo.
5. Una nia de 9 meses mira a su padre cuando la toma en
brazosunapersonaqueelladesconoce.
E. Gesto comunicativo de
tiposimblicooreferen-
cial.
4. Lea la siguiente descripcin y reexione sobre qu implicaciones, ventajas e
inconvenientes tendra la situacin plateada en relacin al aprendizaje de
una segunda lengua.
ImagineunaparejaqueresideenEspaayqueestmuypreocupada
porquesuhijarecinnacidaaprendaloantesposibleunalenguaex-
tranjera.Comoningunodelosdosesbilinge,decidenconectaruna
emisoraderadioenlenguainglesaduranteunperododetiempova-
riable;empiezanconmediahoracuandolaniatiene4mesesypiensanaumentar
eltiempodeexposicinamedidaquestacrezca.
108 Bloque I. El desarrollo temprano
Soluciones a las actividades
1. Preguntas
La respuesta correcta a la primera pregunta es c). Como se explica en el Epgrafe 2.1.
las conductas expresivas propias de los bebs menores de 6 meses, como por ejemplo
el llanto o la sonrisa, an no son conductas intencionales, puesto que no estn dirigidas
a transmitir ni a compartir informacin acerca de algo de un modo intencionado o a
propsito. En este sentido el llanto o la sonrisa son conductas que posee el beb como
medio de expresin de sus estados; al producir dichas conductas no media ningn tipo
de intencin o propsito de comunicarse con el otro.
La respuesta correcta a la segunda pregunta es la expresada en la alternativa b).
Como se expone en el Epgrafe 3 del captulo, dada la complejidad inherente al uso del
lenguaje, su proceso de adquisicin se desglosa en multitud de tareas y comienza
muy pronto en la vida del beb. Los procesos de atencin temprana a la lengua ma-
terna constituyen la base sobre la que se asienta el aprendizaje posterior. La preferencia
por la lengua materna es una consecuencia de dichos procesos atencionales tan tem-
pranos y una muestra de que el beb ha creado representaciones sobre la informacin
lingstica asociada a dicha lengua (por ejemplo, la reconoce porque ha extrado y al-
macenado ciertas caractersticas fonolgicas). Las conductas de comprensin (alternati-
va c) y de produccin (alternativa a) tempranas constituyen logros posteriores en el
desarrollo del lenguaje, no sus comienzos.
La respuesta correcta a la tercera pregunta es a). Los ejemplos dados en la pregunta
constituyen una muestra del bien conocido desfase entre la comprensin y la produccin
del lenguaje, que se observan en el proceso de desarrollo normal (vase Epgrafe 3.3).
En este sentido, este desfase no es un signo de retraso del lenguaje (alternativa b), sino
de la ms absoluta normalidad. Por otra parte, la utilizacin simultnea de gestos y
lenguaje es comn no slo en los procesos de comunicacin infantil, sino tambin en
los adultos.
2. Conducta comunicativa
La conducta exhibida por Mundi no puede considerarse una conducta genuinamente
comunicativa. La gorila tiene un objetivo claro y realiza una serie de acciones encami-
nadas a conseguir su meta. Para ello utiliza a otra persona, el investigador, pero lo hace
de un modo instrumental. Es decir, el investigador es slo el medio para conseguir lo
que quiere, alcanzar el picaporte. Si la conducta hubiera sido comunicativa, el gorila
habra dirigido su mirada al investigador para transmitirle su intencin de alcanzar el
picaporte de la puerta. Y es justamente este compartir la atencin mediante la mirada
el proceso que est ausente en la situacin descrita por Gmez.
3. Correspondencias
1-C; 2-E; 3-D; 4-A; 5-B.
4. Reexione
Es positivo exponer a los bebs a una segunda lengua (L2) tempranamente. Dadas las
habilidades perceptivas y de anlisis de la seal lingstica que poseen los bebs huma-
nos, se puede predecir que la nia discriminara su lengua materna (L1) de la L2 sin
dicultades. Es obvio que la exposicin temprana a una segunda lengua no perjudica,
sino que fomenta el aprendizaje y la diferenciacin L1/L2. Sin embargo, el aprendizaje
Captulo 3. Los inicios de la comunicacin y el lenguaje 109
de las lenguas, ms all de los procesos de discriminacin fonolgica, requiere de con-
diciones bien distintas a las de la mera exposicin auditiva. La adquisicin del lenguaje,
de cualquier lengua, necesita de un contexto interactivo en el que haya interlocutores
activos, interesados en la comunicacin y en la asignacin de signicado a las emisiones
verbales. Poner a un nio a escuchar la radio en un idioma extranjero no es suciente
para poder aprender una lengua (el vocabulario, su morfosintaxis, sus distintos usos
comunicativos) si no se acompaa de otras condiciones, como las que se sintetizan en
el cuadro Con los pies en la tierra (p. 153).
Desarrollo afectivo,
emocional y social
111
4
BEGOA DELGADO EGIDO
Esquema-resumen
Objetivos
Introduccin
1. Aproximacin histrica al estudio del apego
1.1. La investigacin con animales y la deprivacin afectiva
2. Formacin del apego
2.1. La orientacin social y emocional del beb en el momento del nacimiento
2.1.1. Las primeras expresiones emocionales del beb
La produccin de emociones en el beb
La comprensin de emociones en el beb
3. Desarrollo del apego
4. Tipos de apego
5. Factores que afectan a la formacin del vnculo de apego
6. Los elementos del vnculo de apego
7. Estabilidad del vnculo de apego
Lecturas complementarias
Actividades
Soluciones a las actividades
112 Bloque I. El desarrollo temprano
Esquema-resumen
1. Aproximacin histrica al estudio del apego
La ntima relacin que se establece entre el beb y la madre ha interesado siempre a los
estudiosos del comportamiento humano. Inicialmente se crey que el vnculo que une
a padres e hijos se basaba en un proceso de aprendizaje simple: la asociacin de los
padres con la satisfaccin de necesidades bsicas (hiptesis de la madre-despensa). En
cambio, hoy sabemos que este vnculo responde a una necesidad afectiva inherente al
ser humano. Los estudios etolgicos han favorecido este enfoque al mostrarnos que la
bsqueda de afecto y proteccin tiene componentes de ndole logentica.
2. Formacin del apego
En este epgrafe se recuerdan algunas de las principales pre-adaptaciones sociales del
beb. Posteriormente, se ahonda en la capacidad de expresin emocional del beb,
enfatizando la existencia de unas primeras emociones bsicas cuya expresin y compren-
sin es universal y no requiere del aprendizaje. El objetivo nal es ahondar en los fun-
damentos de la comunicacin nio-adulto.
3. Desarrollo del apego
Este epgrafe detalla la secuencia evolutiva que sigue la formacin del vnculo de apego
en circunstancias normales. Se trata de cuatro etapas que se extienden desde el naci-
miento hasta el segundo ao de vida.
4. Tipos de apego
Cada persona y cada circunstancia de crianza son nicas, por ello, al nal del segundo
ao habr notables diferencias en el grado de seguridad que los bebs depositan en los
adultos. Las variaciones pueden ir desde la seguridad total en la proteccin del padre o
la madre hasta una completa desconanza en los adultos.
5. Factores que afectan a la formacin del vnculo de apego
La calidad del vnculo de apego depende tanto de las caractersticas del nio como de
la personalidad del adulto. Ahora bien, pese a la idiosincrasia de ambos, se atribuye a
los adultos un mayor peso en la construccin de un tipo especco de relacin con el
beb. Esto se debe a sus mayores recursos para interpretar y guiar la conducta del beb
en una u otra direccin.
6. Los elementos del vnculo de apego
El vnculo de apego asienta en el nio sentimientos de seguridad o inseguridad, que se
relacionan con el tipo de cuidados recibidos. En su cara ms externa, el vnculo de ape-
go se traduce en conductas que reejan la relacin con las guras de apego (abrazos,
seguimiento ocular o, al contrario, rechazo o indiferencia, etc.). Finalmente, la relacin
vinculante se representa a un nivel mental, mediante lo que se conoce como modelos
internos de trabajo (MIT). Esto implica que, partiendo de las primeras experiencias de
cuidado, el nio genera expectativas sobre los modos de relacin entre las personas y
el grado de ayuda que puede esperar de ellas.
7. Estabilidad del vnculo de apego
La preocupacin por el grado de determinismo de las experiencias tempranas es un
tema candente en la investigacin del apego. En general, se asume que los modelos
Captulo 4. Desarrollo afectivo, emocional y social 113
Objetivos
Conocer el devenir histrico en el estudio del apego: las inuencias etolgicas,
conductistas y psicodinmicas.
Detectar ciertas analogas entre el comportamiento humano y el de otros animales.
Conocer los fundamentos de la teora de Bowlby.
Ahondar en los mecanismos que facilitan la comunicacin nio-adulto: la expre-
sin y comprensin de emociones bsicas.
Conocer el curso evolutivo del primer vnculo afectivo: desde el nacimiento a los
24 meses.
Describir los tres niveles del vnculo de apego: afectivo, conductual y mental.
Acercarse a los aspectos fundamentales que inuyen en la formacin del vnculo
de apego: la personalidad del nio y del cuidador.
Discriminar los diferentes tipos de apego segn la situacin extraa de Ainsworth:
apego seguro, apego evitativo, apego resistente y apego desorganizado.
Estimar de modo crtico la inuencia de las experiencias tempranas: factores que
promueven la continuidad y factores que promueven el cambio.
Introduccin
Enestecaptulovamosaprofundizarenalgunosaspectosdelavidaemocionaldelbeb
y,enespecial,enelvnculoafectivoquecaracterizaalasrelacioneshumanas.Paraello,
convienerepararenunhechofundamentaleinherenteanuestraespecie,sumarcadacon-
dicinsocial.ComosealVygotski,essorprendentequealfnaldelacadenaevolutiva
encontremos un ejemplar que nace altamente indefenso y cuyos sentidos distan mucho
deestarmadurosyoperantes.Paramuchos,estacircunstanciaesunaseaindudablede
que la riqueza de nuestra especie no reside en las capacidades individuales sino en la
facultaddecooperarytrabajarengrupo(Tomasello,1999;VygotskiyLuria,1930/1993).
Lainmadurezdelneonatoylanecesidaddetransmitirunaculturasetraducenenuna
infanciaprolongada,enlaquelasupervivenciadelbebdependedelasatencionesycui-
dadosdesusprogenitores.Porfortuna,losbebscorrespondenprontamentealasemocio-
nesdelosadultosyexhibenotrastantasexpresionesreconociblesporstos.Estaafnidad
emocional,unidaaotrosdispositivostempranosyalapropiasensibilidaddeloscuidado-
res,permitequeentreambosseestablezcaunvnculoafectivoconocidocomoapego.
La funcin esencial de dicho vnculo es procurar la supervivencia y cuidados del
beb.Enestesentido,cuandoelvnculoestbienestablecidosemanifestaenconductas
orientadasamantenerlacercanayelcontactoconlasfgurasdeapego,enespecial,en
aquellassituacionesquesonpercibidascomoamenazantes.
de relacin generados en la infancia pueden ser modicados ms tarde. No obstante,
tambin hay evidencias de continuidad y de dicultad para cambiar modelos de rela-
cin muy asentados. Por tanto, si bien no puede hablarse de determinismo, tampoco
puede minimizarse la importancia que tradicionalmente se ha dado a las experiencias
tempranas.
114 Bloque I. El desarrollo temprano
Finalmente,laposibilidaddemanipularinternamentelarealidadpermitealniogene-
rarunarepresentacindelarelacinvinculantequeseconocecomomodelointernode
trabajo(MIT).Estosmodelos,ademsdeordenarlasexperienciasvividas,permitende-
sarrollarexpectativassobreladisponibilidadyseguridadqueofrecenlasfgurasdeapego
ypodranafectartambinalmodoenqueseafrontanotrasrelaciones.Deestemodo,un
modeloderelacinnegativopodraentorpecerlasposibilidadesdeestablecerenelfuturo
relacionesntimasybasadasenlaconfanza.Enestesentido,losexpertosadviertenqueel
apegoesalgomsqueunaadaptacininfantil;cadavezms,esteprimervnculoescon-
sideradounlogrofundamentalennuestrodesarrollopsicolgicoposterior(Moreno,2006).
1. Aproximacin histrica al estudio del apego
La estrecha relacin que se establece entre el lactante y la madre
1
ha interesado desde
siempreapsiclogosypsicoanalistas.Amediadosdelpasadosiglosepodandistinguir
hastacuatroposicionestericasdiferentessobrelosmotivosdeestarelacin,queabar-
cabandesdeelpsicoanlisisalconductismo.Sibien,lateoraconductistadelareduccin
del impulso ha sido una de las que mayor inters ha despertado. Segn esta teora, el
afectosurgeporlaasociacinsistemticaentrelamadreylareduccindenecesidades
primarias,entreellas,ladelhambre.Talcontingenciaacabaraporconvertiraladultoen
unestmuloplacenteroyagradable.Portanto,elvnculodeapegoseraelfrutodeuna
asociacinaprendida.
Sinembargo,numerososejemploscontravienenestaidea.Spitzobservelcompor-
tamientodeniosinstitucionalizados.Segnl,bastanseismesesdebuenarelacincon
la madre para que su separacin repercuta negativamente en el nio, sumindolo en lo
queldenomindepresinanacltica(Spitz,1946).Igualmente,Spitzinvestiglasano-
malas que presentaban los nios criados en instituciones cuya nota defnitoria era la
carenciatotaldeafecto.Lospequeospadecanelsndromedelhospitalismoylosdes-
cribacomoniospostradosencamas,inexpresivosypasivos(Spitz,1945).Estosdatos
revelanqueunoscuidadosbsicos,orientadosaqueelnionomueradeinanicin,no
garantizanunvnculoafectivo,niundesarrolloadecuado.
Informescomolosanterioresiransentandolasbasesnecesariasparaunestudiori-
gurosodelasrelacionestempranas.Noobstante,elambienteadecuadoparaelsurgimien-
todeunapotenteteorasobreelapegoseproducetrasunosinteresantesdescubrimientos
enelmbitodelaetologa.
1.1. La investigacin con animales y la deprivacin afectiva
Desdeunenfoqueetolgicosesostienequelaconductasocialestanbenefciosaparala
supervivenciaque,sibienpuedehaberaspectosaprendidos,haysiemprealgunosinnatos
(Hess,1970)
2
/
3
.KonrazLorenz(1952)legitimestaideaaldescubrirquecrasdepollos
1
Convienesealarque,enadelante,hablaremosdelafguradelamadreodeloscuidadosmaternospara
referirnosdemanerageneralalapersonaque,demodoprincipal,seocupadelcuidadodelbeb.
2
LatraduccinalcastellanodeestaobrasepuedeencontrarenellibroLecturasdepsicologadelnio
(V.1)deJ.Delval(1978).
3
Hessaclaraquelaconductasocialdebeentenderseenunsentidoamplio,incluyendonoslolasrela-
cionesflialessinotambinotras,comolasconductasdeemparejamientoodecortejo.
Captulo 4. Desarrollo afectivo, emocional y social 115
y patos siguen a sus madres, casi desde el nacimiento. Este comportamiento, conocido
como troquelado social, garantiza que las cras estn protegidas de los predadores y
sigandesdetempranoalprimerobjetoquevenyque,conmuchasprobabilidades,essu
progenitor.
Adiferenciadelosaprendizajesporasociacin,eltroqueladotienealgunascaracte-
rsticasespeciales.Porejemplo,hayunperodocrtico,enelqueelseguimientoesfcil
de establecer. De hecho, el propio Lorenz sufri sus efectos, ya que una bandada de
patossilvestres,criadosporl,instantesdespusdelnacimiento,leseguainsistentemen-
te, dejando incluso de lado el contacto con otros patos
4
. Durante el perodo crtico, ni
siquiera el castigo materno inhibe o disuade a los polluelos en su tendencia a seguirla.
Tal empeo no hace sino subrayar la importancia que tiene para las cras estar, pese a
todo,cercadeunadulto.Ahorabien,pasadoelperodocrticoestimadoen24horas
tras el nacimiento los polluelos difcilmente desarrollarn conductas de seguimiento
haciaobjetopaternalalguno
5
.
Lasconductasdefliacintambinhansidoestudiadasenprimates.Acomienzosde
los aos cincuenta, los Harlow investigaban la capacidad de aprendizaje en los monos
rehsus,loqueaccidentalmentelesllevainstruiralascrasenausenciadesusmadres
6
.
Deformaimprevistalaseparacintuvoconsecuenciasfatalesparalasprimeras,queco-
menzaronamostrarepisodiosdeterroryconductasautocentradasodepresivas.Sorpren-
didosporlosresultados,losHarlownocesarondeestudiaryprofundizarenlosefectos
deloscuidadosmaternos.
En una ocasin, estos investigadores aislaron a las cras en jaulas donde slo haba
dos tipos de madres sustitutas: una madre de alambre y una madre de felpa, ambas
diseadasparasostenerunbibern.Aunqueenalgunoscasoslacomidaeradispensada
porlamadredealambreyenotrosporlamadredefelpa,todaslascrasmostraronuna
clarapreferenciaporlamadredefelpa,ysiempreeraaellaalaquetendancuandose
sentanatemorizadas(HarlowyHarlow,1962).Conestosdatos,losHarlowconcluyeron
quesiexistealgunaconductainstintivaenlosmonos,stasedirigehacialabsquedade
afectoyproteccinynodecomida.
Sussiguientestrabajosmostraronqueenlosmonosexistencomplejaspautasdeflia-
cin.Alnacer,lascrasmuestransuorientacinsocialenconductascomoelabrazo,la
elevacindelacabezaolaprensinrefejademanosypies.Alapar,lasmadresexhiben
patronesmaternales,ofreciendoasuscrasproteccinycuidados.Finalmente,cuandolas
cras se muestran ms independientes, las madres les retiran su ayuda, a fn de que
lascras,yamaduras,serelacionenconotrosmonosjvenes(HarlowyHarlow,1966)
7
.
Porltimo,hayquedecirquelainvestigacindeloscomportamientossocialesen
los monos ha estado ligada a la utilizacin de una variante experimental que trata de
4
Laampliacindeestetipodetrabajos,incluyendoobservacionesensituacionesdelaboratorio,hapues-
todemanifestoquemuchascrasdeavessiguenacasicualquierestmuloquesemueva,incluidosalgunos
tanincreblescomounaparedenformadetablerodeajedrez(Hess,1972).
5
Paramuchosetlogostallimitacintienesentidoyaque,encondicionesnaturales,lascrasqueen24
horasnohubiesenestadoalamparodesuprogenitorposiblementehabranmuertoya.
6
Conestamedidasepretendacontrolarelefectocontaminadordelosrefuerzosocastigosquelamadre
pudieradispensaralascrasyquenoerancontroladosporlosinvestigadores.
7
LatraduccinalcastellanodeestaobraseencuentraenellibroLecturasdepsicologadelnio(V.1)
deJ.Delval(1978).
116 Bloque I. El desarrollo temprano
explorarlasdesventajasdeladeprivacinafectiva.Esascomosabemosqueunao
de total aislamiento social tiene consecuencias prcticamente irreversibles (Harlow y
Harlow,1966).Enelfuturo,estosanimalespuedenmostrarsemiedososoindiferentes
a las relaciones sociales prcticamente de forma perpetua. Por su parte, aislamientos
menosprolongadospuedenpotenciarconductasagresivasenlaadultez.Algunosanima-
lessometidosaestacondicintuvieronmstardeconductasdeagresinsuicidaamonos
adultosofuerondainosconlascras,conductamuyextraaenlasmonasadolescentes.
Afortunadamente,cuandolarealidadesmenosadversacomoenelcasodecrascui-
dadasporotrasodeperodosdeaislamientonomayoresdetresmeseslasposibili-
dadesdeuncomportamientosocialadecuadoydeunamaternidadopaternidadnope-
ligrosasaumentansignifcativamente.
Estoshallazgosmuestranquehaypautasdefliacinendistintasespeciesyquelas
experiencias tempranas tienen una importancia crucial para el futuro desempeo de las
cras.Lgicamente,lasiguientepreguntaesqusucedeenelcasodelserhumano.
2. Formacin del apego
LacasualidadquisoquemientraslosHarlowrealizabansusinvestigaciones,mdicosy
psicoanalistas recogiesen datos similares sobre nios criados en situaciones desfavora-
bles. Esta confuencia fue aprovechada por el mdico y psicoanalista ingls Bowlby
quien,trasaosdeintensotrabajo,reneambasinfuenciasenunapotenteteorasobre
elapego.
Traslasegundaguerramundial,Bowlbyrecibeelencargodetrabajarconniosafec-
tadosporgravesproblemasemocionales,cuyonicoatributocomneranunosmalos,o
inexistentes, vnculos familiares. Igualmente, hasta el 40% de los jvenes delincuentes
que trat tenan historias de cuidados maternos negligentes. Su posicin de mdico le
permiti,adems,examinarlaprogresindemuchosnioshospitalizadosquenopodan
verasuspadres.Estospequeos,queyahabanconstruidounvnculodeapegoconuno
oambosdesusprogenitores,llegabanaatravesarhastacuatrofasesquepodanculminar
en una completa desvinculacin emocional. Una primera fase de protesta, una segunda
Figura 4.1. John Bowlby.
Captulo 4. Desarrollo afectivo, emocional y social 117
de fase de inapetencia o indefensin, y fnalmente una tercera fase que llam de desa-
pego.
En1951BowlbyelaborauninformeparalaOrganizacinMundialdelaSalud(OMS)
donde rene sus observaciones y pone especial nfasis en la necesidad de que el nio
pequeo pueda tener una relacin ntima y continuada con la madre. Poco despus, en
1958,exponesuprimerateorasobreelapego,alejndosenotablementedelospresupues-
tosdelaprendizajeyelpsicoanlisis.Ensulugarelautorsedecantaporunaexplicacin
decorteetolgico,sosteniendoqueelvnculoafectivorespondeaunhechoprimarioque
tiene,adems,unaimportantefuncinadaptativa.Deestemodo,Bowlbydescartaqueel
vnculo derive de asociaciones previas; para l, la necesidad de afecto es tan primaria
comoelhambre.
Msadelante,en1969,reformulasuprimeraversinparasostenerquelasconductas
de apego no son el resultado literal de una pauta biolgica e instintiva. En realidad, el
vnculosurgedesdelaactivacininicialdediversossistemasconductualesmuybsicos
comolaorientacinvisualhacialosrostros,olapreferenciaporlavozhumanaque
se desarrollan a lo largo del primer ao y que, en el segundo, dan como resultado las
conductasprototpicasdeapegoentreellaslabsquedadelamadreensituacionesde
riesgo.Esdecir,habraunasensibilidadbiolgicahaciaelotroque,mstardeyantesu
respuestapositiva,permitequesefjenunosparmetrosdeaccinquesonlosqueenten-
demoscomoconductasdeapego.Setrata,portanto,deunsistemaqueseretroalimen-
ta,yquereaccionaoseautorregulaenfuncindeculesseanlascircunstanciasalasque
seenfrenta.
Optemos por la versin del instinto o por la de la autorregulacin as es como
Bowlbydenominaasusdosposicionestericassurazonamientoconcuerdaestrecha-
menteconlospresupuestosetolgicos.Enestesentido,esnotabletantoladefensaque
hacedelafuncinadaptativadelapegocomoelreconocimiento,cuantomenos,deunos
primerossistemasdeactuacinqueyadesdelabiologanospredisponenarelacionarnos
conlosotros.
Acontinuacin,nosalejaremosmomentneamentedelapegoparadetenernosenal-
gunosdeestosmecanismostempranos.
2.1. La orientacin social y emocional del beb en el momento
del nacimiento
Laorientacininterpersonaldelbebescrucialenlaconstruccindeunpuentecomuni-
cativoyafectivoconeladulto.Comosabemos,alcomienzodelavida,elbebdispone
deciertasinclinacionesbiolgicasqueaseguransucondicinsocial.Porejemplo,como
vimosenlosCaptulos2y3,conslominutosdevidalosbebsimitanlosmovimientos
labialesdelosadultos(MehleryDupoux,1990).Igualmente,desdetempranopreferen
mirarlosrostroshumanosantesquecualquierotroestmuloy,peseanoentenderloque
decimos,seorientanycalmanconnuestrasvoces.
Aloanteriorsesumanotrostantosmecanismosorientadostambinalainteraccin
socialcomoelllanto,lasonrisarefejaolaspausasenlasuccin
8
.Endefnitiva,prc-
8
Enelcaptuloanterior,dedicadoalacomunicacintemprana,seexplicaquelosbebshumanosrealizan
pausasenlasuccinquenoparecenobservarseenotrosmamferosyquesoncontestadassistemticamente
118 Bloque I. El desarrollo temprano
ticamentedesdeelmomentodelnacimiento,elbebexhibeciertosmecanismosqueslo
tienensentidosihayotroquelosinterpreta.
Enesteconjunto,lafacultadexpresivadelbebesunelementoclaveparalacreacin
de un marco comunicativo y afectivo con el adulto. Por su especial relevancia, en los
siguientesepgrafesnoscentraremosenesteaspecto.
2.1.1. Las primeras expresiones emocionales del beb
9
EnsulibroLaexpresindelasemocionesenlosanimalesyenelhombre,Darwin(1872)
plantequelaexpresindesentimientosbsicoscomolaira,laalegra,elmiedo,elen-
fadoolasorpresa,mantieneunvnculobiolgicocondichosestadosemocionales.Segn
Darwin,estauninsehabraforjadoalolargodelaevolucinyexplicaraporqucul-
turasmuydiferentesproduceneinterpretandichasexpresionesdeformasimilar
10
.
Todosestndeacuerdoenquelasprincipalesaccionesexpresivasqueexhiben
loshombresylosanimalesinferioressonahorainnatasoheredadas,esdecir,
quenohansidoaprendidasporelindividuo.Muchasdeellastienentanpoco
queverconelaprendizajeylaimitacinqueestnporcompletofueradelal-
cance de nuestro control desde los primeros das y a lo largo de toda la vida. (Darwin,
1872/1984,p.351.)
EstudiosmodernoscorroboranlassemejanzasdetectadasporDarwinenculturasmuy
distintas. El clebre estudio de Ekman y Friesen (1971), realizado con adultos fore de
Nueva Guinea, arroj resultados muy ntidos. La tarea consista en escuchar diversas
porlamadre,quienrespondeaestaspausashablandoy/otocandoalbeb,hastaquestereinicialasuccin.
Dado que dichas pausas no responden a ninguna funcin fsiolgica, se cree que su misin es fomentar la
interaccinporturnosmadre-hijo.Esdecir,sucometidoseraimplantarenelbeblosritmosdeunacomu-
nicacinregularysimilarensuformaaundilogoadulto.
9
EllectorquelodeseepuedeacudiraPardoyMartndelCampo(1997)paraunarevisindidcticade
losestudiosclsicossobreemocionesenbebsoaNavarro,EnescoyGuerrero(2003)paraunarevisinms
actualizada.
10
Lasimilitudconquediferentesculturasexpresansusemocionestambinsirvideargumentoparala
defensadeuntroncocomnenelhombre.
Figura 4.2. Charles Darwin.
Captulo 4. Desarrollo afectivo, emocional y social 119
historiasquetenanunaimportantecargaemocional,trasellodebanseleccionardeentre
variasfotografaslaexpresinquemsseadecuasealahistoriaoda.Peseaquelasfo-
tografascorrespondanaadultoseuropeos,conlosquenohabantenidocontactoprevio,
losforerealizaronlatareadeemparejamientoconunaltoniveldexito.Curiosamente,
lapruebatuvoidnticosresultadoscuandofueronloseuropeosquienestuvieronquein-
terpretarlasexpresionesfotografadasdelosfore(Ekman,1973)
11
.
LasideasuniversalistasdeDarwintambinconcuerdanconlaexpresividadobserva-
da en los bebs, quienes no tardan en experimentar emociones bsicas como la ira, el
asco, el miedo, la alegra, la tristeza o la sorpresa, que expresan de modo similar a los
adultos.Igualmente,tambindesdetempranolosbebsreaccionandeformaadecuadaa
talesexpresionesemocionales.
Laproduccindeemocionesenelbeb
Desdetempranoesposibleidentifcarenelbebexpresionesfacialesquesonsimilares
alasdelosadultos.Porejemplo,comovimosenelCaptulo2,lamuecadeunbebque
saboreaunlquidoamargoesmuydistintaaladeotroquepruebaunsabordulce.Ms
an,quienesestudiaronestadiferenciaadvirtieronquelosobservadoresnoslolasiden-
tifcaban,sinoquedetectabaninclusosiloslquidostenanmuchaopocaconcentracin.
Asimismo, los bebs expresan su inters mirando fjamente tal y como hara cualquier
adulto(FogelyHannan,1985;FogelyThelen,1987).
Noobstante,sesostienequesonpocaslasexpresionesdiscriminadasquepodemos
observarenelrecinnacido.Anivelmuscularelneonatopuederealizartodoslosmovi-
mientosfacialesimplicadosenlaexpresinemocional,peroparaexteriorizarunaemo-
cinnobastacontenerlafacultadmuscularparaesbozarunasonrisaofruncirlascejas.
Esnecesario,adems,estarendisposicindeexperimentarverdaderasemocionescomo
laalegraolairayestonoocurredesdeelnacimiento.Porestemotivo,muchasexpre-
sionesemocionalesaparecerndeformaprogresiva.
Siguiendo el modelo evolutivo de Lewis (2000), en el momento del nacimiento el
bebmostraraunavidaemocionalbipolar,talycomopropusoBridges(1932).Segn
esto,elbebdenotasuangustiaatravsdelllantoylairritabilidad,ysuregocijoyplacer
conmuestrasgeneralesdesatisfaccinyatencin
12
.
Yahaciaeltercermeselbebdespliegaemocionesmsdiscriminadasydecarcter
mssocial.Porejemplo,lasonrisabrotaahoraenrespuestaaestmulossocialesocono-
cidos,dejandodeserunamuecaoriginadaporestadosdebienestarinternos
13
.Igualmen-
te,lainterrupcinbruscadelainteraccinconlamadresuscitalatristezadelbeb,que
esdistinguibledelaexpresingeneraldemalestar.Alapar,elllantopuedeempezara
serunaformadereclamarlaatencindelotro.
Tambin a los tres meses podemos observar los primeros sntomas de indignacin,
aunquelaexpresindecleraoenfadoemergedeformamsntidaentreelcuartoyel
11
Enambaspoblacionesladiscriminacinentrelasexpresionesdemiedoysorpresafuelamscostosa.
12
Lewis,matizaqueestemodelopodrallegarasertripolarsiconsidersemosladivisinentrminosde
(i)satisfaccin,(ii)sufrimientoy(iii)inters;estoltimocomounacategoraaparte.
13
Posiblemente,lamisindeestaprimeramueca,aligualqueladelaimitacinrefeja,seapuramente
adaptativa,procurandolassimpatasylaidentifcacinentreelbebysucuidadorenunmomentocompro-
metidoparalasupervivencia.
120 Bloque I. El desarrollo temprano
sextomesdevida.Enestemomento,bastarpresionarhaciaabajolosbrazosdelbeb
parafrustrarloyobservarsuexpresindeira
14
.
Por ltimo, la expresin de sorpresa no suele aparecer antes de los seis meses y
requierecomprenderquesehavioladounaexpectativa,oquesecumpleenladireccin
deundescubrimientotipoAja!.Deigualforma,laexpresindemiedoespropia
delossietemeses,yaque,aligualquelasorpresa,estaemocinsurgetrasconfrmarque
uneventodiscrepasignifcativamentedetodoslosconocidos
15
.
Comoresultado,hacialosochoonuevemesespodemosobservarenelbebunam-
pliorepertoriodeexpresionesemocionalescomoelasco,laalegra,latristeza,laira,la
sorpresayelmiedo,cuyaconexinconlaemocinvividaparecetenerunabaseinnata.
Peroeldesarrolloemocionalantieneotrospeldaosquesubiry,hacialosdieciocho
meses,emergernnuevasemocionesrelacionadasconlaautoconciencia.Aestaedad,los
niosempiezanareconocerseenelespejoysefortalecesusentidodelaidentidad,di-
bujndosecomonicaydistintaaladelosotros.Semejantedescubrimientoincitaemo-
cionesalgomscomplejascomolavergenza,laenvidiaolaempataquesonespecf-
camentehumanasysedistinguendelasanterioresporquenosiemprerespondenauna
expresinfacialdeterminada,loquehacemscostosasuidentifcacin.Finalmente,el
modelodeLewisrecogealgunasotrasemocionesdeaparicinmstardaqueserntra-
tadasenelCaptulo7.
Lacomprensindeemocionesenelbeb
Los datos sobre compresin emocional tambin refuerzan la posicin innatista de
Darwin. Estudios basados en el paradigma de la habituacin prueban que el tiempo de
fjacinvisualdelosbebsaumentatraspresentarlesunaexpresinemocionalnueva.Es
decir,apuntanaquelosbebsdistinguenlosrasgosdelasdiferentesexpresionesemo-
cionales.
Noobstante,comosealanPardoyMartndelCampo(1997),losestudiosqueutili-
zanestosmtodosnoaseguranqueelnioconozcaelsignifcadodedichasemociones.
Encambio,esteconocimientossepusodemanifestoenelestudiodeHavilandyLe-
lwica(1987)realizadoconniosdetanslo10semanas.Enlsepedaaungrupode
madresqueadoptaranlaexpresinyeltonodevozadecuadoatresemocionesconcretas:
alegra,tristezayenfado,grabndoselasreaccionesinmediatasdesusbebs.Puesbien,
entodosloscasos,losniosrespondierondeformacongruente.Antelaalegrasemos-
traronalegres,antelatristezasuccionabanomovanloslabiosyanteelenfadoseenfa-
dabanosequedabaninmviles.Curiosamente,laestabilidaddeestefenmenopermite
14
Merece la pena sealar que, segn Darwin (1872), la ira es una respuesta diseada para superar un
obstculo.Enconsecuencia,Lewissospechaquealgnconocimientomuyprecozsobrelasmetasdelaaccin
olarelacinmedios-fnespodrasubyaceralaemocindeira.
15
Debesealarseque,sincontradecirloanterior,hayquienessostienenquepuedenobservarseexpresio-
nesdemiedoenbebsdepocassemanas.Algunosestmulos,porejemplounruidofuerte,podrandesenca-
denarexpresionesdemiedoquenosonfrutodeunaevaluacindelasituacin.Lacuestinessiestaemocin
demiedoesidnticaonoalaprovocada,mesesmstarde,porelenjuiciamientoovaloracindeunasituacin.
Igualmente,Navarro,EnescoyGuerrero(2003)indicanquelaexpresindesorpresaqueapareceaestaseda-
desnoescomparablealaexpresindeintersosorpresaqueseregistraenmuchosestudiosbasadosenel
paradigma de la habituacin y que se limitan, por lo general, a medir la sorpresa por el tiempo de fjacin
visual.Portanto,convienesaberquehaydiferentesformasdeentenderymedirlaemocin.
Captulo 4. Desarrollo afectivo, emocional y social 121
que las observaciones de Haviland y Lelwica sean muy similares a las que en su da
efectuaseDarwinsobresuhijo:
Cuando tena cinco meses pareci entender una expresin y tono de voz com-
pungidos.Alospocosdasdehabercumplidoseismeses,sunierasimulque
llorabayvicmosurostroadquiraalinstanteunaexpresinmelanclica,con
losngulosdelabocamuydirigidoshaciaabajo.Ahorabien,esdifcilqueeste
nio hubiera visto llorar a otro nio, y nunca vio llorar a ninguna persona adulta. Dudo
ademsdequeaunaedadtantempranahubierapodidorazonarsobrelacuestin.Mepa-
recepuesqueunsentimientoinnatodebehaberledichoqueelllantosimuladodesuniera
expresaba pena, lo cual provoc su propia pena a travs del instinto de simpata. (Darwin,
1872/1984,p.358.)
Enconclusin,podemospensarquemsalldelasdiferenciasculturalesodeedad,
hayunconjuntodeexpresionesbsicasqueserefejanenelrostroyquesoncompartidas
por todos, incluidos los nios afectados de ceguera congnita (Eibl-Eibesfeldt, 1973;
1979).Asimismo,cuandolosbebsobservanestasemocionesenlosotrosreaccionande
formacongruenteyrespondenconaccionesquenosonunameracopiadelgestoadulto.
Anteestosdatos,laopiningeneralesquenilaproduccinynilacomprensininiciales
deexpresionesemocionalesbsicasparecendependerdelaprendizaje.
3. Desarrollo del apego
Trasesterepasoaladotacinemocionaldelbeb,veremoscmoestesistemainfantilse
adaptaeinteractaconelcomplejomundodelcuidador.Comoespredecible,larespues-
tacontingenteyadecuadadeladultoeslaotrapiezaesencialparaqueelsistemadein-
teraccinsedespliegueconvenientemente.
ElmodeloevolutivodeBowlby(1969)contemplacuatrofasesqueacompaadeunas
edadesaproximadas(vaseTabla4.1).Enellaspodemosapreciarcmoelvnculoafec-
tivosedesarrollaparejoalacomprensinqueelniovateniendodesmismoydelotro
16
.
Aunqueesarriesgadoprecisarcundounnioyaestapegadoalosadultos,Bowlby
(1969) crea que esto sucede en algn punto entre la tercera y la cuarta fase, es decir,
entreelprimeraoyelsegundoaodevida.
Tambinconvienesealarqueelapegononecesariamenteseestablececonunani-
capersona.Alfnaldelprimeraoelbebpodrsentirseapegadoadiferentespersonas
comosupadre,madre,familiarescercanosyotroscuidadores.Esos,losdistintosvn-
culossuelenorganizarseenunajerarquadeapegosordenadosenfuncindesurele-
vanciaparaelnio,ysuelenresponderaunestilodeapego,esdecir,aunatendencia
acomportarsedeunmododeterminadoquesobresaleporencimadeadaptacionesparti-
culares.Porltimo,convienesealarquelostrabajosdelosaoscincuenta,enespecial
16
Espertinenterecordarqueelbebnonaceconunaideaclaradequinessonlosotrosodequinesl
mismo.Suidentidadsevadibujandoalmismotiempoqueseaclaraladelrestodepersonasquelerodeane,
incluso,altiempoquelosobjetosfsicosvansiendoobjetivadoscomorealidadesindependientesdesusac-
ciones(WerneryKaplan,1963;Piaget,1936;1937).
122 Bloque I. El desarrollo temprano
eldelpropioBowlby,tendanaidentifcarlafguraprincipaldeapegoconlamadrebio-
lgica,sinembargo,laactitudactualesbastantemslaxayadmitequecualquieraque
atiendaaunbebdeformaprolongadaysolcitaessusceptibledeconvertirseensuf-
guradeapego.
Tabla 4.1. Fases en el desarrollo del vnculo afectivo segn Bowlby
Fase 1: Orientacin y seales sin discriminacin de fgura (desde el nacimiento hasta las ocho/doce
semanas).
Elbebmuestrasupreferenciaporestmulossocialesyreaccionaantelasvocesmsfamiliares,pero
nohayevidenciasdequepuedareconoceralaspersonasencuantoatales.Elajustesocialvienefavo-
recidoporciertaspre-adaptacionescomoelllanto,laimitacinylasonrisarefeja,lapreferenciapor
rostros,etc.,quetiendenaincrementareltiempoqueelnioestenlaproximidaddeuncompaero.
Setratadesistemasderelacinmuybsicosysuevolucindependerdelareaccindeladulto
17
.
Fase2:Orientacinysealesdirigidashaciaunaomsfgurasdiscriminadas(entrelosdos/tresmeses
ylosseis/siete).
La sensibilidad del adulto favorece el inicio de las primeras seales verdaderamente sociales, como
sonreroimitarenrespuestaainvitacionesyaccionesdeladulto.Escaractersticoqueelbebcomien-
ce a manifestar su inclinacin por algunas personas, con las que se producen reacciones mucho ms
intensas.Noobstante,ansedejacuidarpordesconocidosynomuestramuchasdiferenciasalseparar-
sedelamadreodeotraspersonas.
Fase3:Mantenimientodelaproximidadhaciaunafgurapormediotantodelalocomocincomode
seales(desdelosseis/sietemesesalosveinticuatro).
Estaeslafasedeapegopropiamentedicha.Lasrespuestasamistosasindiscriminadassereducenyla
bsquedadelaproximidaddelamadresehacepatente.As,elseguimientodelamadre,elsaludoasu
vueltaysuutilizacincomobaseseguraparaexplorar,sonconductaspropiasdeestaetapa
18
.Asimismo,
escomnqueelbebseleccioneaunaspocaspersonasqueseconviertenenfgurasdeapegosubsidia-
riasalamadre.Porltimo,estapredileccinsocialseexpresamedianteelrechazoalosextraos.Pre-
cisamente, la crisis de separacin o angustia

de separacin
,
subraya lo difcil que es en esta etapa
separaralbebdesusfgurasdecrianza.Endefnitiva,elbebquieremantenerlaproximidadconla
fguradeapegoyladistanciaconlosextraos.
Fase4:Formacindeunaasociacinconadaptacinalobjetivo(desdelosveinticuatromesesenadelante).
Las mayores posibilidades lingsticas del nio y su facultad de concebir a la madre como un objeto
persistenteeneltiempo(nocindepermanenciadelobjeto)relajansutendenciaaseguirla.Enadelan-
te,podrsaberdelosmotivosquelainducenaausentarse,altiempoqueimaginarlayrepresentarlaen
sumente
19
.Asimismo,hayquesealarqueenelsegundoaotambinseiniciarnlasprimerasestrate-
giasparatratardeinfuirenlaconductamaterna(vaseCaptulo7).
Finalmente, aunque la posibilidad de crear vnculos afectivos permanece a lo largo
detodalavida(Lpez,1999),elprimervnculosientaunprecedenteparalossiguientes.
Precisamente,muchasdelasinvestigacionesydiscrepanciasactualessobreelapegose
centranenlaestimacindesuinfuenciaenlasrelacionesafectivasfuturas
20
.
17
Recursosinteractivosmuybsicos,comoeldelaimitacinrefeja,puedenprolongarseeneltiempo,o
inclusorecuperarse,sielambientequerodeaalnioesmuydesfavorable.
18
Escomnquelasmiradasalamadreseagudicenenelcasodequeelnioseenfrenteaalgunanove-
dad. Este patrn, conocido como referencia social (vase Captulo 3), indica que para el beb la expresin
emocional del otro es una informacin muy valiosa de cara a esclarecer el peligro de la novedad (Source,
Emde,CamposyKlinnert,1985).
19
Herranz(2002)informadequeenestemomentolasmadresqueexplicanasushijoslasrazonesdesu
separacinyeltiempoquestavaadurarobtienenreaccionesmsserenas.
20
Entrelosvnculosafectivosadultosunomuyimportanteeselqueseestablececonlapareja.
Captulo 4. Desarrollo afectivo, emocional y social 123
4. Tipos de apego
Aunquelasrelacionesdeapegosedefnenporlaconfanza,laintimidadyladuracinen
eltiempo,yaenelprimervnculoafectivoseaprecianimportantesdiferenciasenfuncin
del grado de confanza que el nio deposita en sus fguras de apego. Este aspecto fue
desarrolladoporMaryAinsworth,cuyasindagacionescontribuyeronaldescubrimientoy
clasifcacindetalesvariaciones.
Sus avatares, personales y profesionales, llevaron a Ainsworth a realizar notables
cambiosderesidenciaque,encontrapartida,lepermitieronestudiarlasrelacionestem-
pranasendistintasculturasyenfuncindediferentescomportamientosmaternos.Como
resultado,Ainsworth(1967)proponeque,sibienentodaslasculturaslosniosmuestran
algntipodeapegohaciasuspadreshay,noobstante,diferenciasnotablesenelcarcter
queadopta.Finalmente,yaenBaltimore,Ainsworthycolaboradores(1978)diseanun
procedimientodeobservacinparaevaluarelgradodeseguridadqueelniodepositaen
lamadre.Esteprotocolodeobservacinseconocecomolasituacinextraaypermite
estudiarlasreaccionesdelosniosantediferentessituacionesamenazantes.Ensudise-
osejuegaconlosdosmotivosantagnicosque,paraAinsworth,eranelejedelapego:
labsquedadeproteccinylanecesidaddeexploracindelmedio.
Lapruebadelasituacinextraaconstadeochoepisodios,deunostresminutosde
duracin,enlosquemadreehijosonobservadosendiferentessituaciones.Laevaluacin
comienzaconlaentradadelaparejaenunasaladejuegosconfortableybienequipada.
Una vez all, se suceden diferentes episodios en los que, entre otros sucesos, la madre
dejasoloalnio,olodejaencompaadeunextrao.Estassituacionesdeseparaciones
yposterioresreencuentrosconlamadreoconunextraosonvaloradasdedistintama-
neraporcadabeb,enfuncindelacalidadysolidezdelvnculoconlamadre.
Tabla 4.2. Episodios en la situacin extraa de Ainsworth
Episodio Personas presentes Duracin Acontecimiento
Uno Madreynio 30segundos El experimentador introduce a la madre y al
nioenlasalayseva.
Dos Madreynio 3minutos Lamadresesientamientraselniojuegacon
losjuguetes.
Tres Madre,nioyextrao 3minutos Elextraoentra,sesientayhablaconla madre.
Cuatro Extraoynio 3minutosomenos Lamadresevadelasala.Elextraoresponde
alasiniciativasdelbebytratadecalmarloen
elcasodequesteseenfade.
Cinco Madreynio 3minutosoms Lamadrevuelve,saludaalnioysiesnece-
sarioleconsuela.
Seis Niosolo 3minutosomenos Lamadresevadelasala.
Siete Extraoynio 3minutosomenos El extrao entra en la sala e intenta consolar
alnio.
Ocho Madreynio 3minutos Lamadrevuelve,siesnecesarioloconsuelay
trata de que el nio vuelva a interesarse por
losjuguetes.
124 Bloque I. El desarrollo temprano
Seconsideraqueunniotieneunapegosegurocuandodisfrutadelosjuguetesen
presenciadesumadre,perodetienesuexploracincuandoellaabandonalasala.Esfcil
observar que estos nios se alegran de la proximidad de la madre y que recuperan la
tranquilidadylaexploracincuandoellaregresa.Paramuchosestepatrnindicaquela
madreespercibidacomounabaseseguradesdelaqueexplorarelmundo.
Encambio,otrosniostienenactuacionessignifcativamentediferentesquerevelan
inseguridadenelvnculoafectivo.Entrelosapegosinsegurossesuelendistinguirdos
tipos
21
:apegoevasivoyapegoresistente.
Elapegoevasivooevitanteprcticamentesuponeelpatrninversoalapegoseguro.
A estos nios no parece causarles ansiedad la salida de la madre y tampoco tienden a
saludarlacuandoregresa.Portanto,sureaccinnoesmuydistintaalaquemuestranante
elextraoylosnicossignosexternosdeansiedadsurgencuandoselesdejasolos.
Finalmente,enelapegoresistentetambinconocidocomoambivalentelosni-
osexhibenunaltoniveldeansiedadinclusoencompaadelamadre.Suabandonode
lasalaescontestadocongritosyprotestas,ycuandoellavuelvesemuestranmuyenfa-
dados. Para los especialistas este comportamiento revela cierta ambivalencia entre una
tendenciaabuscarsuproximidadyotraopuestaarechazarla.
Tabla 4.3. Distribucin de los tipos de apego segn los estudios de Ainsworth realizados con
nios de clase media norteamericana
Tipo de apego Proporcin de nios
Reaccin ante la vuelta
de la madre
Seguro Seguro(0,65) Tiendeasaludarla
Inseguro Evitativo(0,20) Tiendeaignorarlaoevitarla
Resistente(0,15) Seenfadaconella
Durante ms de dos dcadas esta tipologa fue sufciente, pero la acumulacin de
datosllevaMainySolomon(1986,1990)adescribiruncuartotipodeapego,conocido
comoapegodesorganizadoodesorientado.Losniosqueseincluyenaqutienenuna
conductadifcildedescribir.Sucomportamientoesinestableycontradictorioynopare-
ceresponderaningunaorganizacinlgica.Estepatrnatpicoesmsfrecuenteennios
quehansufridoalgunaexperienciademaltrato.Secreequeeltemorylafaltadecohe-
renciaqueexpresanestosniosrespondealasreaccionesimprevisiblesyatemorizantes
deladulto.Detodoslosvnculosdeapego,pareceinnegablequeeltiposeguroeselque
expresa con mayor claridad un equilibrio ptimo entre la exploracin del entorno y la
bsquedadeseguridad.Asuvez,eselvnculoquemejorrefejalaconfanzadelnioen
eladultoyelquepresentamayoresprobabilidadesdeasociarseconunaadecuadacom-
petenciasocialenelfuturo(Soufre,1997).
21
Convienematizarqueladistincinexpuestanoestlibrededebate.Algunospsiclogosopinanquela
nicadistincinverdaderamenterelevanteyntidaeslaqueseestableceentretenerunvnculodeapegose-
guroonotenerlo.Lasrestantesmatizacionesnoseranparaestosautoresunasuntodeterminante.
Captulo 4. Desarrollo afectivo, emocional y social 125
Noobstante,elsignifcadodelosdiferentestiposdeapegoylaformaenqueafectan
anuestroedifciopsicolgicosonasuntosencontinuainvestigacin.Porejemplo,Chis-
holm (1996) puntualiza que todos los tipos de apego podran interpretarse como res-
puestasadaptativas.Entendiendoquepodraestarjustifcadomantenersecercadel adulto
o,alcontrario,alejarsedel.Esdecir,ensegnqusituacioneslosapegosresistenteso
evitantespodranserlosmsadaptativos.
Igualmente,hayciertasdiscrepanciasenlainterpretacindelcomportamientoevitan-
te.Razonablemente,sehaplanteadoqueesteperflpodrarefejarciertacostumbrecon
lassituacionesdeencuentrosydesencuentrosynonecesariamenteunafaltadeconfan-
za(Clarke-Steward,1989;Thompson,1988).Recientementesehacuestionado,adems,
la impasibilidad inherente al tipo evitante, destacndose, por ejemplo, que estos nios
respondenalamarchadelamadreconunaelevacincardiacasimilaralaqueobserva
enniosconapegoseguro(SpangleryGrossmann,1993)
22
.
Finalmente,hayquemencionarquelostiposdeapegoguardanrelacinconlasdis-
tintas culturas en que tiene lugar la crianza.As, por ejemplo, los bebs de sociedades
tradicionales,comosucedeenalgunasculturasasiticas,suelentenderaunapegosegu-
ro. En cambio, en algunas sociedades occidentales se promueve en mayor medida los
apegos evitantes, posiblemente en un intento de fomentar, desde temprano, la indepen-
denciadelosmspequeos.Todoellopuedeserunbuenejemplodecmoelmacrosis-
tema (por ejemplo, el sistema socio-econmico o cultural) puede infuir en el mbito
familiar.
5. Factores que afectan a la formacin del vnculo
de apego
Losfactoresqueincidenenlarelacinmadre-hijoenlosdosprimerosaosdevidahan
sidootrorecurrentetemadeinvestigacin.Engeneral,sueleadmitirsequeelperfldel
bebinfuyeensucrianza,enespecial,cuandostepresentaalgnrasgoparticularein-
frecuente; por ejemplo, los bebs excepcionalmente apticos o los excepcionalmente
excitablessuelentenermayoresprobabilidadesdequesucuidadortiendaaignorarloso
aresponderconexasperacin.

Sinembargo,suelesostenersequeloscuidadoresdesem-
peanunpapelmuchomsdecisivo
23
.
Bowlby (1969) explicaba que, si bien madre e hijo aportan a la relacin variables
biolgicasytemperamentales,slolaprimeraincorporaelementosdesuhistoriaprevia,
sus valores culturales y sus expectativas sobre la crianza, atributos que hacen que su
comportamientoresultemsvariadoeimpredecible.ParailustrarestepuntoBowlbycita
elestudiodeMoss(1967)quienencontrqueelmodoenquelasmadresrespondenal
llantodelhijocorrelacionaconeltipodeideasysentimientossobrelacrianzaexpresados
tresaosantes.Igualmente,destacaelestudiodeDavidyAppell(1966),dondesedetec-
22
Estas discusiones ocurren porque no todos los signifcados de nuestra conducta son explcitos, y es
comnquealgunoscomportamientosseanmsfcilmentedescifrablesqueotros.Enestecaso,elapegose-
guro,ysusopuestosresistenteydesorganizado,parecenmsfcilesdeinterpretarqueelapegoevitante.
23
AunqueBowlbysiempreserefrialamadrebiolgica,hoysesostienequeestoesigualmentevlido
paracualquierpersonaqueasumalacrianzadelbebdeformaprincipal.
126 Bloque I. El desarrollo temprano
taquelosniossiemprerespondenalasiniciativasdesusmadresmientrasstascorres-
pondenonoalasprovocacionesenfuncindesupropiaidiosincrasia.
De forma notable los autores convienen en que son las relaciones marcadas por la
sensibilidaddeladultolasqueconducen,conmayorprobabilidad,aunvnculodeapego
frme(Ainsworthycols.1978;Bowlby,1969;Isabela,1995).Dichasensibilidadsere-
ferealahabilidaddeladultopararesponderdeformacontingenteyconlaintensidady
cualidadadecuadasalassealesydemandasdelbeb
24
.Trasmuchosestudios,estapa-
receserlamejorfrmulaparaqueelniopercibaasualrededorunambienteseguroy
acogedor.MarioMarrone(2001)sealabadeestaformalasrelacionesentreelvnculo
afectivoyelcomportamientodeladadamadre-hijo.
Cadapatrndeconductatienepatronesdefnidosenlainteraccindiariama-
dre-hijo.[...]Larespuestasensiblequelamadreofrecedeunmodocontinuo
durante el primer ao de vida del nio es el mejor predictor de la seguridad
del apego del nio en ese primer ao (Betherton, 1985; Smith y Pederson,
1988).Porotraparte,laactituddistanteylaconductaderechazoporpartedelcuidador
(particularmenteencuantoalcontactocorporalconelnio)predicenunpatrndeconduc-
taevitativo.(Ainsworthycols.1978;MainyStadtamn,1981.)Pareceexistirevidenciaclara
dequelosniosambivalentestienenmadresinconstantesquetambintiendenadesalentar
laautonomaylaindependencia.[...]Todacuestindelosestilosparentalesdisfuncionales,
comodeterminantesdelapegoinseguroydelapsicopatologa,mereceunestudio cuidadoso.
(Marrone,2001,p.56.)
Aunqueahoranospuedaparecertrivial,estaaportacincontribuyasacudirlaim-
portanciadealgunosmitoscomoeltipodealimentacinpechofrenteabiberno
laedaddeldestete.Segnloanterior,todaopcinesbuenasiemprequenosedescuide
lasensibilidadhacialassealesdelbeb.
Finalmente,merecesealarsequecadadasonmslosestudiosqueseinteresanpor
la relacin de los bebs con sus padres, as como con otras fguras de crianza. En este
sentido,lasensibilidadesunarecomendacingeneralparacualquieraquesealafgura
principaldeapego.
6. Los elementos del vnculo de apego
El vnculo afectivo posee un marcado carcter emocional que despierta en nosotros
sentimientosdeconfanzaodesconfanza,deestimaodesestima,enfuncindecmo
hayamos percibido la relacin con las fguras de apego. Igualmente, la reaccin a la
prdida de la madre o a su vuelta en la situacin extraa deAinsworth son ejemplos
delasdistintasmanifestacionesconductualesdelapego.Peroelvnculotambintiene
24
Loanteriornoimplicaquenohayaerroresodesajustesenlainteraccin,msan,estospuedenfo-
mentarlahabilidaddelpequeoparareorganizarsuinteraccinyafrontarciertaincertidumbreofrustracin.
En este sentido, el objetivo fnal es que el beb, como balance, estime que sus iniciativas sociales llevan a
resultadosprevisiblesypositivos.
Captulo 4. Desarrollo afectivo, emocional y social 127
uncomponentementalyquizporellomenosevidente.stesereferealaconstruccin
deunmodelointernoquerepresentalarelacinvinculanteyquerecoge,conespecial
importancia, el grado de confanza y disponibilidad que el beb ha percibido en los
otros.Bowlbydenominaestarepresentacinmodelointernodetrabajo(MIT).
Una caracterstica inherente a los modelos mentales es su capacidad para generar
expectativas sobre el futuro, as como para fltrar e integrar la informacin nueva. En
defnitiva,losmodelosmentalesayudanalnioadotardesignifcadoalarealidad.De
este modo, un modelo de apego seguro har creer al nio que la persona amada estar
siempreaccesibleyquesuayudaserincondicional.Encambio,enelpeordeloscasos,
unniopuedecreerquenomereceseramadoynotenerexpectativasdeayudasajenas
encasodenecesidad;porejemplo,GarcaTorres(2003)destacalamayorincidenciaen
nios maltratados o abandonados de modelos mentales errneos que incitan al nio a
culparsedeloscastigosmaternosodelosconfictosparentales.
Porfortuna,casitodoscoincidenenquelosmodelosinternossondinmicosyestnen
continuocrecimientoenfuncindelasrelacionesafectivasquesetengan,loquepermite
ciertafexibilidad.Noobstante,larepresentacinoriginaldelarelacinvinculantepuede
actuardebaseparafuturasinterpretacionesysutransformacinabsolutanoserunasunto
banal.Laraznfundamentalesquelosmodelosmentalestiendenaoperardemodoincons-
ciente,loquesuponequelasinterpretacionesresultantespuedenestarsesgadas,tendiendo
aperpetuarunmodeloderelacindelqueelsujetonisiquieraescompletamenteconscien-
te.Portanto,nopodemoshablardeundeterminismoabsolutodelasexperienciastempra-
nas,peroquizsdeunprimersesgoenlaformadepercibirlasrelacionesconlosotros.
Eltrabajoconniosmaltratadosesunbuenejemplodeloquedecimos.Expertosen
eltemacoincidenenquelasnuevasexperienciasdefamilia,comoenelcasodelaadop-
cindeniosquehansidopreviamentemaltratados,nosustituyendeformainmediataa
las pasadas (Moreno, 2006). Con frecuencia el modelo generado sobre el rechazo del
otro,einclusosobreelabuso,estpresenteenelnioquien,enmuchoscasos,desafay
poneallmiteasunuevafamilia,afndeconfrmarelmodeloderelacinqueleresulta
msfamiliar.Elxitodelaadopcindependerenbuenamedidadelaantigedadycua-
lidaddelosmodelosiniciales
25
.
7. Estabilidad del vnculo de apego
Lapreguntasobreeldeterminismodelasexperienciastempranasnotieneunarespuesta
sencilla.Haynumerosasevidenciassobrelaestabilidaddelapegoenelsegundoaode
vida,ytambinseconfrmaqueenpoblacionesnormaleselapegosegurotiendeenma-
yor medida a la estabilidad que el apego inseguro.Ahora bien, ms all de esto, poco
puededecirsesinnecesidaddemuchasmatizaciones.
Para algunos, el primer apego suscita un modelo interno capaz de condicionar las
restantessituaciones.Enconsecuencia,esdifcilescaparaunmodoparticulardeentender
lasrelacionesyquebuscaeternamentesupropiaperpetuacin.Alternativamente,elape-
25
Enestemomentoseestllevandoacabounambiciosoestudiosobrelainfuenciadelasexperiencias
tempranasenlosmodelosinternosdeniosenacogimientoresidencialydeniosenadopcininternacional
(vaseRomnyPalacios,2006).
128 Bloque I. El desarrollo temprano
goesconsideradounsistemafexibleyadaptativo,capazdeacomodarsealasdiferentes
situaciones.Segnesto,losmodelosinternosderelacinsonmltiplesysonrevisados
continuamentedebidoalanecesidaddeadaptacinaunarealidadcambiante.
Curiosamente,ambasposturasencuentransulugarenlosdatos.As,aunque,como
mediael72%delosadultosmantieneelestilodeapegoqueconstruyenlainfancia,el
28% restante lo modifca en funcin de cambios signifcativos en sus vidas (Waters y
cols.2000).Portanto,lacontinuidadencontradapuedeatribuirsealanaturalezaestable
delvnculocasitantocomoaladelambiente.
Enestebailedefuerzas,Soufrehasidounodelosdefensoresdelmodelodeconti-
nuidad.Segnl,losniosconapegosinsegurostienenagenerarhostilidadenlosdems
lo que, con mucha probabilidad, incita a los otros a reaccionar con agresividad, confr-
mandoaselmodelooriginaldelnio.Alapar,losniosconapegosegurosuelenesco-
ger como compaeros a quienes confrman sus expectativas de apoyo mutuo, lo que
igualmenteperpetasumodeloderelacin(Soufre,1997).
El macroestudio longitudinal de Mineapolis (Soufre y Egeland, 1991) aport datos
querespaldabanestemodelo.Segnesteestudio,lospequeosquemanifestabanunape-
goseguroalosdoceodieciochomeseseran,aosmstarde,descritosporsusprofesores
comomsempticos,socialmentemscompetentesyconmsamigosqueaquellosque
tiempoatrsfueronclasifcadoscomoinseguros.Msan,elseguimientodealgunosde
estosniosmostrquelasdiferenciasseseguandandoenlapreadolescencia.
Enrealidadlosindiciosdecontinuidadenlosmodosderelacinsonmuchos,llegan-
doadarsecorrelacionesentreelapegoenlosprimerosaosyelestilodeapegoenlas
relacionesamorosas(vaseLpez,2006).Laacumulacindedatosqueaboganporcier-
to continuismo ha fomentado la teora de que los nios con apego evitante sern en el
futuroadultosdecontactofro,mientrasquelosniosambivalentessernconmayor
probabilidadadultosemocionalmenteinestables.Sinembargo,seraincorrectoquedarse
sloconestosdatosynoconsiderarotros.Sonmuchoslosestudiosqueencuentranque
lostiposdeapegocambianenfuncindeexperienciassignifcativas.
Lambysuscolaboradoresfguranenlalistadequienesenfatizanquecualquiercam-
bio que afecte de forma severa y constante a las formas de relacin podra dar lugar a
cambios en el apego de los hijos. De hecho, Thompson (1998) confrmaba que en las
clasessocialesmsbajashaymayoresprobabilidadesdequeelapegoseguromudehacia
formasinseguras,loqueseexplicaporlosmayoresriesgossocialesalosqueseenfren-
taestapoblacin.
Desdeestaposicintambinsedestacanlasevidenciassobrecambioseneltipode
apegotrasacontecimientosqueafectanalascondicionesdecuidadodelosnios,como
eldivorciodelospadres,elcambioderesidencia,lallegadadeunnuevohermano,etc.
A su vez, se da importancia al vnculo de apego que se establece con la pareja. Parece
probableque,sistaofreceunascondicionesdeconfanzaestables,unestiloderelacin
inseguro acabe mudando en favor de otro ms basado en la autoestima y la confanza.
Ante estos hechos, quiz la posicin ms sensata sea mantener cierto eclecticismo que
permita decantarse por un modelo u otro en funcin de variables como la intensidad y
duracindeunascondicionesadversas,laidiosincrasiadelapersonaolaestabilidadde
lascondicionesfuturas.Deestemodo,serposibleconsiderarqueelapegotiendeaser
establepero,alavez,queessusceptibledecambiarsilascondicionesaslodemandan
(Lpez,2006).
Captulo 4. Desarrollo afectivo, emocional y social 129
En cualquier caso, debemos concluir que las experiencias de fexibilidad no deben
servirpararebajarlaimportanciacrucialdelasvivenciastempranas.Aunquelosmodelos
afectivossedesarrollanyserposiblecrearnuevosmodosderelacinenelfuturo,todo
apuntaalaindudableimportanciadelprimervnculoafectivo.Estaevidencianosinvita
a refexionar de un modo crtico sobre la cualidad de las pautas de crianza y sobre la
posibilidaddefomentarmodelosdeactuacinbasadosenlasensibilidad.
Lecturas complementarias
Delval,J.(1978)(Comp.)Elapegocomoprimerarelacinsocial.EnLecturasdepsicologadel
nio(Vol.1)(pp.317-386).Madrid:Alianza.
Enesco, I. (2003) (Coord.) El desarrollo del beb: cognicin, emocin y afectividad. Madrid:
Alianza.
Herranz,P.(2002).Eldesarrollodelapego.EnP.HerranzyP.Sierra(Eds.).PsicologaevolutivaI
(Vol.II).Madrid:UNED.
Marrone,M.(2001).Lateoradelapego:unenfoqueactual.Madrid:EditorialPsimtica.
Actividades
1. Conteste a la siguiente pregunta
Segn Bowlby, la calidad de la relacin afectiva entre madre y nio depende:
a) De la cantidad de horas que el beb pase con la madre: a mayor nmero de
horas, mayor posibilidad de un vnculo de apego seguro.
b) Tanto de la capacidad de ajuste de la madre a las necesidades del nio, como
de las caractersticas de ste.
c) Bsicamente del temperamento del beb, que hace ms o menos difcil el
establecimiento del vnculo afectivo.
2. Relacionando sistemas en desarrollo
Tomando como eje el desarrollo el vnculo de apego, le pedimos que reexione sobre
los avances motores, perceptivos, comunicativos y afectivos. Es decir, partiendo del de-
sarrollo del apego, le pedimos que observe y extraiga alguna relacin entre los diferen-
tes sistemas en desarrollo.
3. Las fases del apego
Desde su conocimiento sobre el apego, intente estimar la fase o el tipo de apego que
se maniesta en cada uno de los siguientes ejemplos:
Caso 1. Una familia nos indica que su beb, de muy corta edad, se deja cuidar
por cualquier adulto que se muestre afable con l. Tambin nos dicen que se en-
cuentra ms cmodo en el saln de casa, donde se desarrolla la vida familiar, que
en el ambiente ms recogido y clido de su habitacin.
Caso 2. Una madre nos comenta que, segn su experiencia, dejar a su beb al-
guna ropa suya ayuda a que se sienta ms tranquilo en la cuna.
130 Bloque I. El desarrollo temprano
Caso 3. Una nia de tres aos de edad, acostumbra a bajar al parque con su pa-
dre, all se relaciona bien con otros nios, y slo busca a su padre en momentos de
riesgo o ante la necesidad de que su padre intervenga para darle explicaciones sobre
alguno de sus muchos descubrimientos.
Caso 4. Manuel y Alicia son una pareja consolidada que acostumbran a pasar
mucho tiempo juntos. Esta vez Manuel tiene que salir de viaje y Alicia lleva noches
desvelada e inquieta ante la posibilidad de que Manuel pueda conocer a alguien
ms atractivo que ella. Le cost mucho despedirse de l en el coche y continuamen-
te le llama al mvil. Pese a que Manuel nunca ha irteado con otras chicas, Alicia
est viviendo la separacin realmente mal.
Soluciones a las actividades
1. Pregunta
La opcin B es la correcta. Este enunciado recoge un aspecto subrayado por Bowlby. La
opcin A no es correcta por tratarse de un argumento meramente cuantitativo. El ma-
yor o menor tiempo pasado con el beb no asegura que la interaccin con el adulto sea
adecuada. Es decir, esta opcin no informa de cmo se articula la relacin ni de si el
adulto es sensible a las seales del beb. Por ltimo, la alternativa C no es correcta por
incidir en el peso otorgado al beb cuando, an reconociendo la responsabilidad de
ambos, se atribuye ms inuencia al adulto.
2. Relacionando sistemas en desarrollo
Conviene sealar que la formacin del vnculo de apego sucede pareja y armnicamen-
te en relacin a los desarrollos de otros sistemas, como el motor o el perceptivo. En este
sentido se advierte una relacin inversa entre la edad del beb y la aceptacin del cui-
dado de otras personas. Es decir, en los momentos ms comprometidos para la super-
vivencia el beb acepta los cuidados de prcticamente cualquier adulto. De forma dis-
tinta, para cuando se inician los primeros desplazamientos autnomos (por ejemplo, el
nio comienza a andar), los sistemas comunicativos y afectivos se han perfeccionado lo
suciente como para que la comunicacin ya sea intencional y tridica y para que ya
haya una persona que se considera una base segura desde la que explorar el mundo.
En denitiva, diferentes sistemas avanzan de una forma ordenada y conjunta, que bus-
ca en todo momento una adaptacin ptima a las circunstancias externas.
3. Las fases del apego
Caso 1. La informacin proporcionada indica que el nio podra encontrarse en las
fases uno o dos de la formacin del apego. El pequeo an no tiene una preferencia
social muy marcada y simplemente disfruta de los entornos donde no se encuentra solo.
Caso 2. El ejemplo pone de maniesto un fenmeno comn en el vnculo afectivo:
el reconocimiento privilegiado de los rasgos ntimos de la gura de apego como
su olor o el sonido de sus pisadas. Si alguno de estos rasgos ya puede apaciguar al
nio en una situacin extraa, posiblemente el vnculo que se est formando sea
de tipo seguro.
Captulo 4. Desarrollo afectivo, emocional y social 131
Caso 3. Es un ejemplo prototpico de un comportamiento de apego seguro. La nia
se siente conada para explorar y slo cesa en su labor cuando necesita consejo.
Caso 4. Los apegos en los adultos tienen caractersticas particulares. No obstante,
en muchos aspectos el vnculo con la pareja recuerda al vnculo con los progenitores
y, en este caso, a un vnculo inseguro resistente.
EL DESARROLLO
DURANTE LA
PRIMERA INFANCIA II
BLOQUE
En este bloque vamos a abordar la primera infancia, que comprende el actual segundo ciclo
de Educacin Infantil y abarca el desarrollo entre los 3 y los 6 aos. Comenzaremos tratando
de explicar los avances que se producen en el pensamiento infantil en estas edades y para
ello nos apoyaremos en la descripcin del perodo preoperatorio realizada por Piaget. A con-
tinuacin dedicaremos un captulo exclusivamente a la adquisicin de una herramienta fun-
damental para el desarrollo del ser humano: el lenguaje. Ya hemos visto los inicios de la
adquisicin de esta capacidad pero es en esta etapa cuando realmente se produce el despe-
gue y la gran evolucin del lenguaje. Por ltimo, abordaremos los aspectos relacionados con
el mundo social, es decir, todos aquellos mbitos de la vida del nio en los que los otros
son parte fundamental. As pues, aspectos como las relaciones con los dems, las emociones
o el razonamiento moral sern tratados en este ltimo captulo del bloque.
SUMARIO
CAPTULO 5. El desarrollo del pensamiento
1. El nio pequeo en la teora de Piaget
2. El nio pequeo en la teora de Vygotski
3. La teora de la mente
4. Conclusiones
CAPTULO 6. El desarrollo del lenguaje oral
1. El desarrollo de la forma del lenguaje durante la primera infancia
2. El desarrollo pragmtico y las habilidades para narrar
134 Bloque II. El desarrollo durante la primera infancia
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva evolutiva
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas y
explicaciones constructivistas
5. Aprender el lenguaje en contextos bilinges
CAPTULO 7. El mundo social de 3 a 6 aos
1. El desarrollo del yo
2. El mundo emocional y afectivo
3. Las relaciones con los dems
4. El juego
5. La identidad de gnero
6. El pensamiento moral
El desarrollo
del pensamiento
135
5
BEGOA DELGADO EGIDO
M. NGELES GARCA NOGALES
Esquema-resumen
Objetivos
Introduccin
1. El nio pequeo en la teora de Piaget
1.1. Los rasgos del pensamiento preoperatorio
1.2. Algunas limitaciones de la teora de Piaget
2. El nio pequeo en la teora de Vygotski
3. La teora de la mente
3.1. La atribucin de creencias falsas
3.2. Habilidades mentalistas anteriores a la comprensin de creencias falsas
4. Conclusiones
Lecturas complementarias
Actividades
Soluciones a las actividades
136 Bloque II. El desarrollo durante la primera infancia
Esquema-resumen
1. El nio pequeo en la teora de Piaget
La teora de Piaget describe el perodo de dos a seis aos como una etapa marcada por
el uso de la funcin simblica y la carencia de un pensamiento lgico y reversible. En
consecuencia, la infancia aparece como un perodo cualitativamente diferente al pero-
do sensoriomotor o al siguiente, marcado este ltimo por la posibilidad de realizar ope-
raciones mentales.
Segn Piaget, el nio pequeo es un ser inteligente y constructivo, pero
en su intento de comprender la realidad acabar por imponer sus esquemas de
modo supercial, sin organizar sus pensamientos conforme a las leyes de la
lgica.
2. El nio pequeo en la teora de Vygotski
El trabajo de este autor es un perfecto contrapunto al de Piaget. Es notable la elegancia
con la que Vygtoski nos indica cmo, por medio del lenguaje egocntrico, el nio se
hace consciente de sus procesos mentales y adquiere un mayor control de su conducta.
El aspecto ms destacado de este trabajo es la claridad con la que nos muestra la in-
uencia decisiva de la cultura y de los instrumentos de comunicacin en el desarrollo
de nuestras formas de conciencia.
El vnculo que Vygotski establece entre el lenguaje y la emergencia en el nio de
una conciencia verbal es de profunda actualidad y, sin duda, la autorregulacin por
medio del lenguaje es uno de los logros ms importantes del perodo que nos ocupa.
3. La teora de la mente
El perodo de los 3 a los 6 aos se ha identicado con una creciente comprensin de la
naturaleza de las personas como seres que mantenemos estados mentales sobre la rea-
lidad, como son los deseos, las creencias..., cuya atribucin a uno mismo y a los dems
permite dar sentido a la accin humana.
Hacia los 4-5 aos, las habilidades mentalistas del nio incluyen la comprensin de
las creencias falsas, momento que se ha considerado como crtico en el desarrollo de
su teora de la mente. Hacia los 6-7 aos, adems de comprender que nuestros estados
mentales pueden representar de manera falsa la realidad y que son representaciones las
que guan nuestra conducta, van a entender que los estados mentales pueden repre-
sentar a su vez otros estados mentales.
Con anterioridad a estos desarrollos, entre los 3 y 4 aos, se ponen de maniesto
habilidades relacionadas con la comprensin de otros estados mentales, como son los
de deseo.
Objetivos
Conocer la teora de Piaget sobre el desarrollo intelectual entre los 2 y los 6
aos, con especial atencin a los logros y limitaciones lgicas que propuso
este autor.
Reexionar sobre la fragilidad de los procesos intelectuales y la necesidad de
adecuar al mximo los instrumentos de medicin al objeto de estudio.
Conocer el papel del lenguaje en la autorregulacin segn la teora de Vygotski.
Captulo 5. El desarrollo del pensamiento 137
Introduccin
Losniospequeostiendenasorprendernosconunagranvariedadderespuestasyrazo-
namientos.Aveces,tratanlosacontecimientosdesdesupropiopuntodevistaresultndo-
nosalgosimplistasyexcesivamentepersonalesensusexplicaciones.Pero,enocasiones,
tambinsoncapacesdesorprendernosconargumentosdeunaenormelucidez,oconre-
cuerdosquenoesperbamosquepudiesenrecuperar.Naturalmente,paracomprendereste
amplioabanicodecomportamientosesnecesariorecurriramsdeunaaproximacinte-
rica.Nosotrosempezaremosconlateoraquemsinvestigacinydatoshagenerado;nos
referimoslgicamentealateoradeJeanPiaget.Suingenteobranospermitiracercarnos
deunmodoamplioalpensamientoinfantil,sibien,debemosadvertirqueestaaproxima-
cintiendeaminimizarloslogrosintelectualesdelosniosdeentredosyseisaos.
ParaPiaget,laetapaquenosocupavienemarcadaporelconfictoentrelastendencias
msindividualesysimblicasdelpensamientoinfantilyaquellasotrasmssocializadas
ylgicasqueapenasseestnestableciendo.Enconsecuencia,elautordefneelrazona-
mientoinfantilporelusodelossmbolosylafjacindelnioensupuntodevistasub-
jetivoyparticular.Deestemodo,elllamadoegocentrismointelectualimpregnartoda
lamentalidadinfantil,afectandodemodoesencialalrazonamientoyalacomunicacin
hastalossieteuochoaos.
LaperspicazmiradadePiagetnoimpidequealgunosvacoslgicosimputadosalos
niosresultenatenuadoscuandolastareasycontextosdeevaluacinsepresentandeun
modoatractivoyrelevante.Elretratopiagetianodelainfanciaes,enestesentido,con-
secuenciadirectadelaexigenciaconlaquePiagettratlashabilidadesquesepropuso
investigar; un estilo severo y concienzudo, que arrastr tanto en las tareas como en el
anlisis de las respuestas. En cualquier caso, las limitaciones atribuidas a la teora de
Piagetnolainvalidancomomarcoineludibleparacualquieraqueseacerquealestudio
deldesarrollohumano.
Un segundo bloque del captulo abordar el desarrollo infantil desde la perspectiva
deLevVygotski.Supticasitalainfanciaenelmarcodeunentornosocialycomuni-
cativo,delqueelnioextraelosconocimientoseinstrumentos,enespecialellenguaje,
queharnposiblesupropiaregulacin.Laetapadedosaseisaosesclaveenestepro-
cesodecrecimientoindividual.
Finalmente,dedicamosunltimoapartadoaldesarrollodelacomprensinmentalis-
ta.Lacapacidadparatratarconentidadesmentales,comopensamientosoactitudes,su-
pone un problema intelectual de indudable calado. Los estudios de teora de la mente
Reexionar sobre las diferentes maneras de enfocar el desarrollo humano, repa-
rando en los aspectos que se ponen de maniesto segn la perspectiva de traba-
jo que se adopte.
Entender la teora de la mente como una capacidad que se adquiere de manera
progresiva.
Conocer las principales habilidades mentalistas que se desarrollan durante la eta-
pa de 3 a 6 aos.
Conocer los procedimientos de evaluacin paradigmticos en la investigacin
sobre la adquisicin de la teora de la mente.
138 Bloque II. El desarrollo durante la primera infancia
pondrndemanifestoque,sibienlacomprensindelosestadosmentalessealargaen
eltiempo(veremostareasmentalistasdedistintadifcultad),entrelos4y5aossesu-
peraunaimportantebarreraevolutivaqueimpidealnioentenderquecadapersonatie-
nesusrepresentacionesdelarealidadyconfaenellastantocomolenlassuyas.
Ensuma,enestecaptulo,trataremosalgunosdelosprincipalesaspectosquesehan
estudiado en el nio como su capacidad lgica, su uso del lenguaje egocntrico y su
comprensin de s mismo y de los otros. Nos limitamos a presentar estos mbitos sin
pretenderserexhaustivos,nienlosejemplosnienlostrabajosreseados.Nuestroobje-
tivo,simplemente,eseldeacercarallectoralgunosdelostrabajosmsclsicosorepre-
sentativosdeestastreslneasdeinvestigacinque,porsupuesto,noagotannilaspregun-
tas ni los procedimientos que continuamente se desarrollan en torno a la inteligencia
infantil.
1. El nio pequeo en la teora de Piaget
EnlateoradePiagettodaformadeinteligenciasurgedesdelasaccionesprcticasdel
beb quien, segn el autor, es capaz de gestionar su adaptacin al entorno ayudado de
dosmecanismosfundamentales:laacomodacinylaasimilacin(vasecaptulo1).En
consecuencia,lafuncinsimblicaquecaracterizaralosniosdeentredosyseisaos,
tambinprovienedelaaccin,enestecaso,delaaccinimitativa
1
.Siguiendolaspalabras
deMandler(1983),conelnacimientodelasimgenesseconseguiraqueunnio,adems
depodercaminarsobreunalnearectapuedaimaginarla
2
.Enpocaspalabras,latrascen-
denciadeestanuevaetaparesideenlacapacidadparanegociarnosloconlosaspectos
percibidos,sinotambinconlosimaginados.
Laconquistadelafuncinsimblicahacequeseanposiblesnuevoscomportamientos
comoeljuegodefccin,laimitacindiferida,eldibujooellenguaje,quemarcanun
modocualitativamentedistintodeentenderyrelacionarseconlarealidad.Ahora,elnio
puede entender que un objeto sigue existiendo aunque no lo perciba ni vea (nocin de
permanenciadelobjeto
3
)oqueesposibleutilizarunobjetorealconlaspropiedadesde
otroquesloexisteenlamentedelnio(porejemplo,jugaraqueunpltanoesunte-
lfonojuegodefccin).Esdecir,esposiblejugarconlossignifcados,alterandolas
propiedades de lo real. Igualmente, el dibujo ser otro ejemplo notorio del simbolismo
deestaetapa.
Encontrapartida,Piagetdestacaqueelnioqueacabadeaccederalafuncinsim-
blicaestaprisionadoenunarefexincentradaenelyodondelospuntosdevistade
los otros no se entienden, donde es difcil separar lo objetivo de lo subjetivo, y donde
dominaelprincipiodelplacersobreelderealidad.Esteaspectolimitadorycentristafue
1
Segn Piaget, las primeras representaciones mentales son imitaciones interiorizadas. Esto supone que
laimitacinseharitualizadotantoquehaconseguidoquelosmovimientosexternosserealicenenunplano
interno,enunarepresentacinquenorequieredelaaccin.
2
Al igual que otros autores, Mandler crea que la funcin simblica tena que emerger necesariamente
antesdeloprevistoporPiaget.
3
Recordemosqueestanocincomienzaadesarrollarsemuytempranamente,peroessloalos24meses
cuando,segnPiaget,podemosasegurarqueparaelniolaexistenciaopermanenciadelosobjetosestotal-
menteindependientedesuacciones.
Captulo 5. El desarrollo del pensamiento 139
abordadoporPiagetenvariasdesusobrascomoEljuicioyelrazonamientoenelnio
(1924/72),Larepresentacindelmundoenelnio(1926/84)oLacausalidadfsicaen
elnio(1927/84)
4
.
EllargoperodoquenosocupaesdivididoporPiagetendossubperodos:laetapa
preconceptual (de los dos a los cuatro aos) y la etapa intuitiva o transicional (que se
inicia hacia los cinco aos). La primera se caracteriza por un creciente empleo de los
signos,sibien,elnioanestmuylejosdepoderoperardemodolgico.SegnPiaget,
elnioestmuycentradoensupuntodevistaydemuestraunanotabletendenciaade-
formar la realidad. Prueba de ello son sus explicaciones sobre la realidad, que apenas
denotandistincinentrelofsico,lomentalolosocial
5
.Demododistinto,enlasegunda
etapaelniocomienzaaentenderotrospuntosdevistaaunqueannocompletamen-
teyadquiereunamejorcomprensindelasleyesquerigenenlosdiferentesdominios
delarealidad,porejemplo,entenderquelasleyesfsicassonindependientesdelasleyes
moralesoquenoesposibleatribuirconcienciaeintencionesaobjetosinanimados.Sin
embargo,nisiquieraenestaetapaelniosercapazderealizaroperacionesmentales
bsicas (vase Captulo 1); aunque se aprecia un avance importante hacia el siguiente
perodo(delasoperacionesconcretas)(vaseCaptulo8).
1.1. Los rasgos del pensamiento preoperatorio
ComoyahicieseRousseau,Piagetdefendiqueelnionoesunadultoenpequeo.Se-
gnl,elniodeentredosyseisaosnobuscalaverdadsinoelplacer,oloqueeslo
mismounaexplicacinquelesatisfagadeformainmediata.Estacaractersticaseagrava,
anms,porlaseguridadqueelniodepositaensusjuicios.Comosealaelautor,lo
primeroqueimpresionaenunniomenordesieteuochoaosessuseguridadextrema
entodo.Cuandomostramosaunsujetode4-5aos,[...]doscajitasdelmismovolumen,
ylepreguntamosculesmspesada?,elniorespondedeentradaesa,sinhaber
siquierasopesadolascajas!Ylomismoparatodo.(Piaget,1924/1972,p.155).
Piagetopinabaquelaexperiencia,porsmisma,nodesengaaalosnios,quienes
compensanconlaimaginacinlascontradiccionesolagunasenqueincurrensusexpli-
caciones.Debidoaesto,unarealidadquedesafasecontinuamentesusexplicacionesno
harasinopotenciarsuimaginacinhastaeldelirio.Comoalternativa,Piagetcreaque
esunanecesidadsocialloqueimpulsaalnioaverifcarsupensamiento.Enconcreto,
queeseldeseodecompartirunargumentoloquegeneraenelnioladudaylanecesi-
daddecomprobacin.Dehecho,Piagetllegadefnirelrazonamientolgicocomouna
discusinconnosotrosmismosquereproduceinteriormentelosaspectosdeunadiscu-
sinreal.
4
EsteplanteamientoeracongruenteconlastesispsicoanalticasalasquePiageteramuysensible.Segn
stas,lasprimerasformasdepensamientoestaraninclinadashacialaintrospeccinyelprincipiodeplacer
para,mstarde,acercarsealalgicayelprincipioderealidad.Engeneral,laideadequeelsujetoesprime-
ramenteunserbiolgicoeindividualy,slomsadelante,unsercultural,hasidomuyaceptadaenpsicologa,
sibien,desdehaceunasdcadasestsiendoseriamenterevisada.
5
SegnPiaget,elpensamientodelnioenestaetapaseparecemuchoaldelsensoriomotor.As,aunque
el nio preoperatorio es capaz de representar sus acciones, an no realiza operaciones mentales por lo que,
comoelniosensoriomotor,actaabasedeensayoyerror.
140 Bloque II. El desarrollo durante la primera infancia
Eslanecesidadsocialdecompartirelpensamientodelosdems,decomunicar
elnuestroydeconvencer,loqueestenelorigendenuestranecesidaddeve-
rifcacin:Lapruebahanacidodeladiscusin.(Piaget,1924/1972,p.156.)
Perodichadiscusinylaconsiguientebsquedadelaverdadencuentranenelego-
centrismoinfantilunfuerteescollo.SegnPiaget,elniotieneimportantesdifcultades
para ponerse en el punto de vista del otro, por lo que comprender a un interlocutor o
transmitir una idea de forma adecuada, se convierten en tareas casi imposibles (vase
Figura5.1)
6
.
El egocentrismo al que se refere Piaget seguir manifestndose hasta el fnal de la
primerainfancia.Pruebadeelloesladifcultadquemanifestanlosmenoresdesieteaos
para establecer una comunicacin en la que se expliquen y entiendan las opiniones de
todos los interlocutores. Asimismo, las difcultades para entender y hacerse entender,
acarrean,segnPiaget,unaleveconcienciadelospropiosprocesosmentales,yaque:En
lamedidaenquepiensaparasmismo,elnionotiene,enefecto,ningunanecesidadde
cobrarconcienciadelosmecanismosdesurazonamiento(Piaget,1924/1972,p.162).
Lafuertetendenciadelnioaasimilarlarealidadalpropiopuntodevista,erapara
Piagetunacaractersticatansobresalienteque,prcticamente,explicabatodoslosdems
rasgosdelainteligenciainfantildesdelos2alos6aos.
Hemostratadoderemitiralegocentrismoinfantillamayoradeloscaracteres
delalgicadelnio.(Piaget,1924/1972,p.155.)
Enrelacinconloanterior,losniosdeestaetapapresentandifcultadesparaenten-
dernocionesrelativas,esdecir,conceptosquerequierenconsiderardospuntosdevista
alternativos.Porejemplo,aunqueelniopuedadecirnoscuntoshermanostiene,quiz
nopuedadecirnoscuntoshermanosyhermanastienensushermanos,yaqueelhecho
dequelseahermanodesushermanosnoimplicalocontrario
7
.
Igualmente,Piagetdefneelpensamientoinfantilcomocentrado,loquesignifcaque
elniodifcilmentepuedeconsiderarvariosaspectosdeformasimultnea.Porejemplo,
aunniolecostarentenderquesusabuelosson,adems,loshermanos,tosopadres
deotraspersonas
8
.Muchasdeestasdifcultadesseponendemanifestoenlasconocidas
6
ElegocentrismoalquesereferePiagetesdetipointelectualynotienelasconnotacionesdevolunta-
riedadoegosmoquerecibeenlaterminologapopular.
7
Segn Piaget, las difcultades para invertir un proceso tambin se relacionan con un modo de operar
excesivamente inclinado a la asimilacin. Segn esto, el nio tiende a deformar toda informacin a la que
aplicaunesquemaantiguo,llegandoadestruir,incluso,elpropioesquemaaplicado.Estaasimilacindefor-
mantehaceimposiblevolversobrelospasosdadosy,sinlareversibilidad,elpensamientodelnioesincapaz
deoperacioneslgicas.
8
Como veremos en los ejemplos de yuxtaposicin, al nio tambin le costar entender que un objeto
puedeformarpartedevariascategoras;esdecir,lainclusindeclases.
Captulo 5. El desarrollo del pensamiento 141
tareaspiagetianasdelaconservacin,cuyaprincipaldifcultadresideendistinguirun
cambio aparente de uno estructural. Por ejemplo, si mostramos a un nio pequeo dos
vasosidnticosyconlamismacantidaddelquidoy,delantedel,vertemoselconteni-
dodeunodeellosenuntercerrecipientemsestrecho,probablementeelniocreerque
hacambiadolacantidad;porejemplo,dirquehaymsliquidoenelvasomsestrecho,
porqueahelnivelsubems.Esdecir,aunqueesevidentequenosehaaadidoniseha
La tarea de las tres montaas
Piaget estudi la toma de perspectiva mediante la prueba de las tres montaas. En esta
tarea se sienta al nio frente a una maqueta en la que hay varias montaas y se le
muestran diversas fotografas tomadas desde distintos ngulos. Su labor consiste en
discriminar qu fotografas muestran lo que l ve y qu otras lo que vera una persona
sentada en frente. Por lo general, los nios de esta etapa tienen problemas para distin-
guir su punto de vista del de los dems. No obstante, algunos estudios muestran que
cuando la tarea resulta ms relevante, la perspectiva visual del otro se adopta antes de
lo previsto por Piaget (ver Epgrafe 1.2)
Figura 5.1.
Tareas de las tres monta-
as (tomada de Dickinson
1984/1991) en A. Corral
y P. Pardo (2001).
142 Bloque II. El desarrollo durante la primera infancia
quitadonada,elniopensarquelacantidadhavariadoguiadoporlaaparienciadelos
elementosquecompara.
Latareadescritaseconocecomolaconservacindellquidoodelacantidadcontinua
yladisePiagetprecisamenteparainvestigarlacapacidadlgicadelosnios.Como
sealaelautor,antesdelosseisaoslosniossuelencentrarsuatencinsloenelnivel
dellquido,sinconsiderarlaformadelosrecipientes(centracin).Igualmente,suactua-
cinrevelalairreversibilidaddesupensamiento,yaqueelnionoinfereque,devuel-
to el lquido al recipiente original, el nivel volver a igualarse. Es decir, es incapaz de
invertirunprocesoorealizarunaoperacinlgica(vaseFigura5.2).
Nmero Cantidad continua Longitud Masa Peso
Igualdad inicial
Transformacin
Estado final
Pregunta de
conservacin
Peticin de
explicacin
Tienen las dos
filas el mismo
nmero de bolas
o una fila tiene
ms bolas que
la otra?
Tienen los dos
vasos la misma
cantidad de agua
o un vaso tiene
ms agua que
el otro?
Son los dos
palos igual de
largos, o un
paso es ms
largo que
el otro?
Tienen los
dos objetos la
misma cantidad
de arcilla, o
uno tiene ms
que el otro?
Pesan igual
los dos objetos,
o uno pesa ms
que el otro
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Por qu
piensas eso?
Figura 5.2. Ejemplos de tareas de la conservacin (tomado de Vasta y cols. 1992/96, p. 314),
en A. Corral y P. Pardo (2001).
Las difcultades lgicas del pensamiento preoperatorio se refejan tambin en las
explicaciones infantiles. Segn Piaget muchas de ellas denotan una yuxtaposicin de
argumentos, en detrimento de un razonamiento genuinamente deductivo.Veamos este
aspectoconunsilogismoquefuepresentadoaniosdedistintasedades.Algunosha-
bitantesdelaciudaddeSaint-Marceleranbretones.Todoslosbretonesdelaciudadde
Saint-Marcel murieron en la guerra. Quedan habitantes en Saint-Marcel? (Piaget,
1924/1972,p.169).SegnlosdatosdePiaget,unabuenapartedelosniosde10y11
aosconcluanqueyanoquedabanhabitantesenSaint-Marcel,esdecir,norealizaban
unaintegracindelosdosargumentosque,enestecaso,serelacionanentrminosdel
Captulo 5. El desarrollo del pensamiento 143
todoylaparte.ParaPiagetlayuxtaposicinesunatributocomnamuchosyvariados
comportamientos.Porejemplo,lamismaseravisibleenellenguajedonde,segnl,se
produce un abuso de la conjuncin y en detrimento de conectores que explicitan la
relacin jerrquica entre las premisas como porque o despus. Igualmente, este
rasgotambinestarapresenteeneldibujo.As,creyquemientraslosniosnocono-
ciesenlarelacincorrectaentrediversosaspectosdelarealidad,eldibujodelosmismos
sera inconexo; por ejemplo, con independencia de la pericia tcnica no sera posible
dibujarcorrectamenteunabicicletasinconocerantessumecanismo.SegnPiaget,de-
tallescomoelpin,lacadenaolospedalespodrannoaparecerohacerlosincontacto
entres.
Enparalelo,Piagetdescribeelpensamientodelniocomosincrtico,oloqueeslo
mismo,inclinadoaconcebirlarealidaddeformaexcesivamenteinterconectadayglobal.
Esterasgodisponealnioaexplicarunosacontecimientosenfuncindeotrosquesim-
plementeco-ocurren,comosiloshechosquesucedenjuntosseimplicasenrecprocamen-
te.Porejemplo,unniopuedeexplicarqueelsolnosecaeporqueesamarilloycalien-
tao,preguntadoporqusubeelniveldelaguaalponerunapiedraenelvaso,puedecreer
queelloesdebidoaquelapiedraesdura.Endefnitiva,susexplicacionesremitenaunos
caracteresdelfenmeno(porejemplo,elcolordelsol)larazndeserdeotros(porejem-
plo, la suspensin del astro). Segn Piaget, la yuxtaposicin no es incompatible con el
sincretismo ya que, en ambos casos, la clave est en la ausencia de una comprensin
profunda y lgica de la realidad.Asimismo, aadi que el sincretismo era un producto
ms del egocentrismo intelectual; sosteniendo que la tendencia egocntrica del nio le
conduceapercibirlarealidaddeestapeculiarformaenlaquetodoestindefectiblemen-
teconectado.Elegocentrismoinclinaraalnioa:
...ignorarlosenlacesobjetivosenprovechodelossubjetivos,imponeresquemas
arbitrariosalascosas,asimilarincesantementelasexperienciasnuevasaesque-
mas antiguos, en suma a reemplazar la adaptacin al mundo exterior por la
asimilacinalyo.Elsincretismoeslaexpresindeesaasimilacinperpetuade
todaslascosasaesquemassubjetivosyesquemasglobaleseinadaptados.(Piaget,1924/1972,
p.172.)
Las insufciencias lgicas del nio han llevado a describir su pensamiento como f-
gurativo,esdecir,basadoenlosrasgossuperfcialesycambiantesdelarealidad.Lgi-
camente,estacaractersticaeselorigendemltiplesconfusionesascomoderepresen-
tacionesdelarealidadcualitativamentedistintasalasdeladulto.Piagetanalizalgunas
deestasconstruccionesatravsdeconcienzudaspreguntasquepusieronenevidencialas
confusionesquetienenlosniossobrelosdistintoshechosdelanaturaleza.Porejemplo,
consultadosporlasdiferenciasentrelointernoyloexterno,mediantecuestionescomo:
sepuedetocarelpensamiento?,dndeestnlossueos?,odndeseencuentra
loquesueas?,muchosniosmenoresdesieteaoscontestabanatribuyendoaloin-
terno lo psquico las mismas propiedades visibles y tangibles de los fenmenos
externos.Deestemodo,notenanproblemasenubicarelpensamientoenlabocaolos
sueosenlahabitacin,otorgandoasidentidadmaterialafenmenosquenolatienen.
144 Bloque II. El desarrollo durante la primera infancia
Estaconfusininfantilseconocecomorealismoysemanifestatambinenlafaltade
distincinentrelossignifcantesylossignifcados.Porejemplo,muchosnioscreenque
losnombresdelascosas(lossignifcantes)provienendelascosasmismas,esdecir,son
intrnsecosaellas.Porejemplo,antelapregunta:cmolagentepudosaberquesolse
llamabadeestamanera?,algunosdelosniosentrevistadoscontestaronporquepodan
verqueeraredondoycalienteopreguntadossobreelnombredelasnubescontestaron:
porquepodanverqueerangrises;ensuma,losniosactuabancomosielnombrede
lascosas(unatributoexternoyarbitrario)fueseunapropiedadmsdelasmismas.
Tambinsehaobservadoquelosniosatribuyenpropiedadesbiolgico-psicolgicas
comointenciones,conciencia,sensacionesysentimientosalarealidadinanimada.
Enestesentido,algunosniosconfesaronaPiagetqueelsolsabaquesellamabasolo
queelvientosabaquesoplaba.Engeneral,lasrespuestasqueobtuvoindicabanqueel
niotiendeahumanizartodoaquelloquetienemovimiento,comolasombraounahoja
mecidaporelviento.Estatendenciaaextenderlosrasgosdelavidahumanaaobjetosy
hechosfsicosseconocecomoanimismo.
La tendencia animista no es incompatible con otra de las caractersticas que Piaget
atribuye al pensamiento infantil: la inclinacin a concebir los hechos de la naturaleza
comoproductosdelaaccinhumana;msconocidacomoartifcialismo.Deestemodo,
el nio puede creer que el sol o la luna han sido hechos por alguien, o que alguien ha
hecholoslagosexcavandoorifciosyrellenndolosconagua.Curiosamente,todoellono
esincompatibleconquemstardelosastrosuotrosfenmenosfsicostenganconciencia
yvidapropia.
Porltimo,debemosinsistirenquemuchosdeestosrasgosinfantiles,tienensucla-
vedesalidaenlacomunicacinconlosotros.Hayquerecodarque,segnPiaget,slo
elconfictoconlospuntosdevistaajenosliberaralniodesuegocentrismo.Sinem-
bargo,susobservacionesenlaescuelainfantilLacasadelospequeosrefejabanlas
graves limitaciones interpersonales de los nios. Concretamente, entre los tres y cinco
aos(cercanosalperodopreconceptual)lasmanifestacionesegocntricas,estoes,inti-
lesdesdeunpuntodevistainteractivosesituabanentreel54%yel60%deltotaldelas
registradas.Aunqueesteporcentajedisminuaentrelos5y7aos(perodointuitivo),en
dichas edades el habla egocntrica an capturaba entre el 44% y el 47% del habla del
nio.Lallamadahablaegocntricacorrespondamayoritariamenteasoliloquiosoa
monlogos colectivos donde los nios hablan en voz alta pero sin prestarse atencin
niatenderseentres.SegnPiaget,suegocentrismolesllevaasentirsecomprendidospor
losdemscasideformaautomtica,porloqueprescindendetodoesfuerzoporhacerse
entender.
Noslolosnioscreenquesehablanlosunosalosotrosyqueseescuchan
efectivamente, sino que tienen una tendencia a admitir que cada uno de sus
pensamientosescomnatodos,quetodospuedenleerloycomprenderlosinque
seasiquieranecesarioexpresarlodistintamente.(Piaget,1924/1972,p.158.)
Para el autor ginebrino, el egocentrismo oculta al nio la necesidad de entender y
hacerse entender, generndole la ilusin comunicativa de ser automticamente com-
Captulo 5. El desarrollo del pensamiento 145
prendido.Sinembargo,enelplanoreal,elnioestfuertementeaisladodelosotrosy
muylejosandeungenuinointercambiodeopiniones.
Bstenosrecordarquelaincomprensinentreniossedebetantoaunainca-
pacidaddeexpresinporpartedelexplicador,quiensiguesiendoegocntrico
ensulenguajemismo,comoaunadifcultaddeadaptacinporpartedelinter-
locutor,quenoescuchaporquecreehabercomprendidotododeentrada,yque
incorporatodoloqueoyeasupuntodevistaegocntrico.(Piaget,1924/1972,p.159.)
Segnelautor,lascomunicacionesdonde,porprimeravez,seescuchanyentienden
lospuntosdevistadelosotrosnoaparecenantesdelossieteuochoaos.Tambin,a
partirdeestaedad,elnioalcanzarlapropiedaddelareversibilidadyladescentracin
y,engeneral,serentoncescuandosesuperenmuchosdelosrasgosquehanimpreg-
nadoelpensamientoinfantil.Mientrastanto,loslogrosdelniopreoperatorioseguirn
estando ms en la posibilidad de usar smbolos (juego de fccin, imitacin diferida,
adquisicin del lenguaje, inicio del dibujo, etc.) que en la de hacerlo de modo lgico
entareasquerequierandelareversibilidadyladescentracin.
1.2. Algunas limitaciones de la teora de Piaget
LaobradePiagetcontinasiendounarmazndereferenciaparaestudiarnuestrode-
sarrollointelectual.Superspicaciaenlaspreguntas,sutenacidadenlaobservaciny
su lucidez en el anlisis de las tareas hacen que, pese a algunos desaciertos en sus
planteamientosoprocedimientos,sulegadosigateniendounincalculablevalorparala
investigacin. Dicho esto, veremos a continuacin algunas de las limitaciones de su
teora.
Deformalcita,Piagetseinteresporelnacimientodelpensamientolgico-matem-
tico, pero su empeo quiso que su forma de proceder acabase. Por ejemplo, es difcil
imaginarculeslarespuestaesperableapreguntascomo:Dndeestelnombredel
sol?, o De dnde vienen los sueos?. Estas cuestiones indican cierta falta de ade-
cuacinalamentalidadquesequeraestudiar.Dehecho,siguiendounametodologams
ecolgica,hayquienesencuentranenlosniosunamejorcomprensindeladistincin
entrelofsicoylopsquicodeloquesupusiesePiaget(vaseEpgrafe3).
Por otro lado, algunos se plantean si las flosofas infantiles, como el animismo,
debensertratadasslocomounfenmenoevolutivo.Unestilodepensamientoanimista
puede ser el resultado de un aprendizaje adecuado en un determinado entorno socio-
cultural,sinqueellosignifquequeelpensamientoensutotalidadrespondaapatrones
preoperatorios(SarriyQuintanilla,2003).
Las crticas anteriores nos dejan entrever el principal problema que se atribuye al
trabajo de Piaget: su notable descuido por el contexto y el contenido de las tareas. Por
ejemplo,esindiscutiblequesedebeaprenderaadoptarlasperspectivasajenas,perono
es cierto que el nio de entre dos y seis aos sea tan egocntrico como lo dibuja este
autor.Dehecho,tareasparalelasaladelastresmontaas,perodondeelcontextohace
relevantelalabordeocultarsedelalcancevisualdeunotro,sonmuchomejorresueltas
146 Bloque II. El desarrollo durante la primera infancia
porlosnios.Enconcreto,MargaretDonaldsonmostrqueimplicadosenunjuegoque
consisteenesconderaunniodeunpolica,losnioseranmspropensosaadoptarlas
perspectivas visuales de la otra persona (Donaldson, 1978). Igualmente, en tareas que
reproducenproblemascotidianos,elniomuestraunamejorcomprensindelarelacin
entreeltodoylaspartes(Donaldson,1978).Porende,podradecirsequeloqueverda-
deramente los nios no entienden son los problemas de perspectiva o de inclusin de
clasesplanteadosentrminosmuyabstractosomuydescontextualizados(msadelante
seexplicarestacuestincondetenimiento.VaseCaptulo8);encambio,elrendimien-
to mejora a medida que acercamos la representacin del problema a la representacin
infantildelarealidad(vaseCuadro5.1).
Cuadro 5.1. Ejemplo de una de las tareas usadas por Margaret Donaldson
Medianteunsencilloestudio,MargaretDonaldsonmostrlainfuenciaquetienelainterpretacindela
tareaenelrendimiento.Elestudioconsistaenintroducirunnmerovariabledecochesenunnmero
variabledegarajes.Seguidamentesepreguntabaalosniossitodosloscochesestabanguardadosen
losgarajes.
Curiosamente,cuandoquedabaungarajelibrelosniosrespondanquetodosloscochesNOesta-
ban en un garaje. La investigacin posterior revel que los nios suponan que an deba llegar otro
coche,puestoquenohayraznparaquealguientengaungarajevaco.Esteresultadoponedemani-
festolanecesidaddeconsiderarlarepresentacinqueelniosehacedelatarea,ysistaeslamisma
quetieneelinvestigador.
Finalmente,esciertalatendenciadelniopequeoadeformarlarealidadasuan-
tojo,comodemuestrasupredileccinporeljuegodefccin,perohayquedestacarque
notodoenelnioesasimilacin;tambinintentaadaptarsealospuntosdevistadelos
otrosyesmsconscientedesuspropiosprocesosmentalesdeloquesupusiesePiaget.
Un ejemplo de esto ltimo se encuentra en los estudios sobre memoria donde incluso
losmspequeosseafananpornoolvidar.ElCuadro5.2recogeunamuestradeestos
trabajos.
En conclusin, podemos resumir que muchas de las tareas de Piaget marcan los
lmites de lo que el nio puede hacer desde el punto de vista lgico. Sin embargo, el
panoramadelainteligenciainfantilcambiacuandolastareasseformulanentrminos
realmente relevantes para el nio o con elementos que le son familiares. Cuando ha-
cemosesto,suegocentrismoysusinsufcienciaslgicasresultan,cuandomenos,ate-
nuados.
Captulo 5. El desarrollo del pensamiento 147
Cuadro 5.2. Estrategas a los dos aos
Sehaobservadoqueniosdeentre18y24mesesseimplicanyaenaparentesestrategiasmnemotcni-
cas.As,envueltosenunanimadojuegoqueimplicaesconderunjugueteparamstarderecuperarlo,los
pequeospasansutiempodedemorapaseandocercadelescondite,mirandoosealandohaciaeselugar,
yhablandosobreelesconditeoelmueco.
Lapruebadequetalesactividadesestnencaminadasarecordarprovienededistintosargumentos,
fundamentalmentedequedichasconductasocurrenmsenlassituacionesmsdesafantesparalame-
moria.Porejemplo,haymsconductascomolasindicadascuandoeljuegosedesarrollaenambientes
nofamiliarescomoellaboratorio(DeloacheyBrown,1983),ocuandoconsideramoslosprimerosen-
sayos,dondeelnioestpocofamiliarizadoconlatarea(Deloache,CassidyyBrown,1985).Perosin
dudaelmejorindicadordelaintencindetalesconductasessuaumentoodisminucinenfuncinde
aquinseleatribuyalaresponsabilidadderecordar.Siduranteelperododedemoraelniocreeque
tendrquerecuperarelmuecoaumentarnsusconductasmnemotcnicas.Sicreequeloharunadul-
todejardemostrarlas(Deloache,CassidyyBrown,1985).
Encontrapartida,losprimerosindiciosdeefcacia,esdecir,derelacinentrelaestrategiautilizada
yelxitoenelrecuerdo,seencuentranenniosalgomayores,entrelos3ylos4aos(Wellman,Ritter
yFlavell,1975;Delgado,GmezySarri,2002).Esdecir,sloapartirdeestasedadeslosniosejecu-
tanaccionesquerealmentesonefcacesparaelrecuerdo.Noobstante,ypesealafaltadeefcienciade
susprimerasacciones,esevidentequeciertaconcienciadequeesnecesariohaceralgoparamantener
lainformacinenlamenteestyadesdelosdosaos.
A continuacin presentamos una segunda aproximacin a la infancia radicalmente
distinta.Segnsta,eldesarrollonoseexplicadesdeelpropioindividuo,seexplicacon
relacinalcontextosocialyculturalyalacomunicacinconlosotros.
2. El nio pequeo en la teora de Vygotski
El contrapunto al retrato piagetiano de la infancia lo encontramos enVygotski. Para el
autorbielorruso,lainfancianopuededefnirseporelegocentrismo,yaque,asujuicio,
ningn ser inmaduro y encerrado en s mismo superara la prueba de la supervivencia.
Porello,elniodebe,cuantoantes,guiarseporelprincipioderealidadynoporeldel
placer,loquesignifcaquedebeadaptarsealasdemandasrealesyadecuarsealasnormas
queimperanensucomunidad.Endefnitivatienequeactuarcomounsersocialcompe-
tente.
Elejemplomsclarodeestaposicin,ancladaenlosocial,apareceenlainterpreta-
cinqueVygotskihizodelhablaegocntrica(Vygotski,1934/1973)
9
.Comosabemos,el
habla egocntrica haba sido identifcada por Piaget como un tipo de lenguaje que no
sirvealacomunicacinporqueelnionoseadecuaalpuntodevistadelinterlocutory
slohabladesmismo.Porende,paraelautor,estelenguajeeraslounsignomsdel
egocentrismo infantil y su disminucin, hacia los ocho aos, contribua a reafrmar su
inoperancia.Vygotski,porelcontrario,interpretestefenmenodesdelaposicinopues-
ta,defendiendoqueelhablaegocntricanoesunsntomadelafaltadesocializacinde
9
Puesto que este fenmeno es a la vez intelectual y lingstico volver a ser tratado con detenimiento
(vaseCaptulo6).
148 Bloque II. El desarrollo durante la primera infancia
lamenteinfantilmsbiendesufaltadeindividualizacin!,atribuyndole,adems,
unaimportantefuncinintelectual.
Vygotskipartiradelaideadequeellenguajeesuninstrumentosocialquesurge
porque hay un otro con el que compartir y cooperar. En este sentido, la funcin pri-
meradelhablaeslacomunicacinynotienesentido,segnl,queelnioadquiera
el lenguaje para usarlo con fnes de ensoamiento o egocntricos en el sentido de
Piaget.Ahorabien,alolargodeldesarrollolosadultosintentancontrolarlaaccin
delniomedianteinstruccionesverbales(porejemplo,nocomaseso,sultalo!,
ponmsarena,etc.).Estainiciativaverbalpermiteque,msadelante,seaelpropio
nioquienseenveasmismomensajessimilaresconelpropsitoderegularsuac-
cin.Porejemplo,noesextraoobservaraniospequeosnarrandocadaunadesus
accionesmientrasjuegansolitariamente,omientrasabordansustareasescolares.Con
ello,losniosnobuscanqueunotroexternolesentiendaylesconteste,setratadeun
lenguaje dirigido a s mismos con el fn de tomar mayor conciencia de las propias
acciones.
Portanto,siPiagetacertaldiferenciarestelenguajedelquesirvealacomunicacin
conunotro,Vygotskiharalopropioaldemostrarqueentreestehablaylaaccinha-
baunarelacinmuchomsprofundaqueelmeroacompaamientoolaco-ocurrencia.
Enconcreto,elautorbielorrusodifcultlasactividadescotidianasdelosnios,enten-
diendo que esto incrementara su lenguaje egocntrico en un intento de cobrar mayor
concienciadesusprocesosmentalesporejemplo,hizoquealahoradeemprenderuna
accinlospequeosnocontasenconlasherramientasadecuadas.ComoVygotskiha-
baprevisto,losobstculosinterpuestosprovocaronunnotableincrementodeemisiones
egocntricas,loquerefrendabaqueellenguajeegocntricoformabapartedeunesfuerzo
delniopordarsecuentadeladifcultaddelproblema,dehallarunasalidaodeplanear
laprximaaccin.
Nuestros nios han mostrado un incremento del lenguaje egocntrico cuando,
en cualquier situacin, tropezaban con difcultades. Frente a una difcultad el
niotratabadeentenderyremediarlasituacinhablandoyrazonandoconsigo
mismo: Dnde est el lpiz?; ahora necesito uno azul; no importa, pintar
con el rojo y lo mojar con agua, se pondr oscuro y parecer azul. (Vygotski, 1934/1973,
p.50.)
Posiblemente,ellectorestarpensandoque,enrealidad,todaslaspersonas,niosy
mayores, hablan consigo mismas. Efectivamente, la diferencia est en que slo los se-
gundospuedenhablarseenlaintimidaddesuconciencia,sinemitirlossonidosdelhabla.
Estoesdebidoaque,sibienellenguajeegocntricoprocededellenguajecomunicativo
yensusiniciosesaudible,amedidaqueseadaptaasufuncinreguladora,ellenguaje
egocntricovatransformandosuformaparaadecuarsealacomunicacinconunomismo.
Deestemodo,elhablaegocntricaseabreviaprogresivamenteycadavezesmenosau-
dible, hasta no ser siquiera perceptible. SegnVygotski, la interiorizacin del lenguaje
egocntricoprovocalaimpresinerrneadeunaextincin,sinembargo,lafuncinau-
torreguladoradelhablanodesaparecesinoquesubsisteenunaformanueva:ellenguaje
Captulo 5. El desarrollo del pensamiento 149
interno
10
.Esdecir,laautorregulacinverbalcontina,perolalaborserealizaahoraen
el plano interno, sin necesidad de vocalizaciones. En apoyo a este proceso, Vygotski
aludialasimilitudentreelhablaegocntricadelospreescolaresyellenguajeinterno
delosadultosodelosniosmsmayores.Ensustrabajoshabaobservadoque,alrea-
lizarunaactividad,losescolaresnomostrabanhablaegocntrica.Trasobservardeteni-
damente la tarea, estos nios actuaban directamente, sin mediacin aparente del habla.
Ahorabien,siselespreguntabaporloquehabanpensado,losmayoresdabanexplica-
cionesmuyparecidasaloexpresadoenelhablaaudibledelospreescolares.Paraelautor,
estosdatosnodejabandudasdequelaautorregulacinverbalseefectuabaenlosmayo-
resenunplanointernoynoaudible.
Finalmente,elhechoestablecidoporPiagetdelarpidadesaparicindellen-
guaje egocntrico en la edad escolar permite suponer, dadas las similitudes
funcionalesyestructuralesmencionadas,quelaabreviacinprogresivanocon-
ducealaatrofayaladesaparicindellenguajeegocntrico,sinoasutrans-
formacinenlenguajeinterno,asuinteriorizacin.(Vygotski,1934/1973,p.53.)
Conformealasinvestigacionesclsicas,losnuevosestudiosencuentranqueelhabla
egocntricaalcanzasucotamximahacialoscuatroaos,momentoenqueseiniciasu
transformacin hacia formas ms abreviadas, hasta ser interiorizada cerca de los seis
(Beaudichon, 1973; Berk, 1986, 1992; Bivens y Berk, 1990; Girbau, 1993; Kohlberg,
YaegeryHjertholm,1968;Winsler,CarltonyBarry,2000;Winsler,DeLen,Wallace,
CarltonyWillson-Quayle.2003).Lainteriorizacindelhablaegocntricanosignifcano
volver a hablar en alto; el proceso puede volver a ser audible si la tarea que queremos
controlarrequieredetodanuestraatencin.Porejemplo,noesextraoobservarnosha-
blandoenaltocuando,minutosantesdesalirdeviaje,revisamoselcontenidodenuestra
maleta.Precisamente,elrecursoahablarenvozaltahallevadoaalgunosareplantearel
habla egocntrica como una herramienta de solucin de problemas y no slo como un
fenmenoevolutivo.
Finalmente, merece destacar la lucidez con queVygotski sita el origen de la con-
cienciaenlavidasocial.As,mientrasPiagetdescribaalniocomounseregocntrico,
quedebeavanzarhacialacomprensindeotrospuntosdevista,Vygtoskicreaqueera,
precisamente,elpensamientoindividualelplanoqueestabaanporsurgir,ylaapropia-
cinprogresivadellenguajeparafnesprivadoseraunaclarademostracindeestaidea.
Esevidenteque,segnlateoradeVygotski,elperodoquenosocupaesdeexcep-
cionalimportanciaparaeldesarrollodelautocontrolylaconstruccindeunaconciencia
verbal. Por ello, algunos autores recomiendan no prohibir a los nios hablar en alto ya
que,mientraslohacen,estncontrolandosupropioaprendizaje.Dehecho,losnioscon
dfcitatencionalretrasanlainternalizacindelhablaegocntricaposiblementedebidoa
susdifcultadesparacontrolarsuatencin(BerkyLandau,1993;Winsler,Daz,Atencio,
10
Vygotskidescribedetalladamentelaspropiedadesdeestelenguajementalolenguajedepensamien-
toperodebidoalacomplejidaddelasmismasprescindiremosdeahondarenellas.Noobstante,ellectorin-
teresadopuedeacudiralabibliografarecomendada.
150 Bloque II. El desarrollo durante la primera infancia
McCarthyyChabay,2000).Porelcontrario,lainteriorizacintempranadelhablaego-
cntricaes,paraalgunos,unindicadordemadurez.
3. La teora de la mente
Laltimapartedeestecaptuloestdedicadaaunodelostemasdeestudioquehasus-
citado un gran inters entre los psiclogos evolutivos durante las ltimas dcadas: la
adquisicin de la teora de la mente; temtica que ha recibido grandes aportaciones de
otros campos de la psicologa y de disciplinas afnes como la etologa comparada o la
flosofa de la mente.Antes de comentar algunas de las habilidades mentalistas que el
niodesarrollaentrelos3y6aos,veamosaqunosreferimosconestaexpresinde
teoradelamente.
Sinesfuerzoaparenteydemaneracasiconstante,ennuestrasrelacionesinterperso-
nalesatribuimostodounmundointernodedeseos,creencias,recuerdos,conocimiento,
intenciones,etc.;estadosmentalesqueempleamosparaexplicar,anticiparyentenderel
comportamiento propio y ajeno. Podemos presentar aqu un extracto de cualquier obra
literaria,unanovelapolicaca,porejemplo,opedirallectorquetomelaquetengams
amanoyqueanoteaquellasocasionesenlasquesuautorhacereferenciaexplcitaalos
estadosmentalesdelospersonajessobrelosqueseconstruyelahistoria,oaquellasotras
enlasque,cuandonosehacenexplcitos,somosnosotroslosqueselosatribuimos.Pa-
sandodelafccinalavidareal,tambinpodemospedirlequehagaunesfuerzodeme-
moriayrecuerdelaltimavezquesevioenvueltoenunmalentendidooquefueobjeto
deunengao.Ahora,tratedereconstruircmoseprodujoaquelmalentendidooporqu
cayenelengao.Inevitablemente,tendrquerecurriratodounentramado,msome-
nos complejo, de intenciones, deseos, creencias, conocimientos, ignorancia, recuerdos,
suposiciones...
Alrealizarestasactividadeshabrechadomanodesucapacidaddeteoradelamen-
te,expresinconlaqueentrminosgeneralessehacereferenciaalacapacidaddeatribuir
estadosmentalesalosdemsyaunomismo.Estacapacidaddeveralotroyaunomis-
mocomoseresquetenemosmenteconstituyeunapotenteherramientaparalarelacin
interpersonal,quepermitedarsentidoalcomportamientohumano,elcual,comoseala
Rivire(1996),nolointerpretamosdeformanaturalaludiendoacausasdetipofsiol-
gicoopuramenteconductuales,sinoentrminosdeestadosmentalesquemedianentre
lassituacionesynuestrasacciones.
Laexpresindeteoradelamentetienesuorigenenelcampodelestudiodelacon-
ductaanimalyfueacuadaporlosetlogosPremackyWoodruf(1978).Considerando
la funcin de adaptacin social de la inteligencia (Humphrey, 1976) y en el marco del
debate sobre la continuidad-discontinuidad evolutiva de algunos procesos psicolgicos
enprimateshumanosynohumanos,estosautoresenfrentaronaunachimpanc,Sarah,
adiversosproblemasquetenaunapersona.Porejemplo,selepresentabaunvdeoenel
quesucuidadorintentabacogerunracimodepltanosquecolgabadeltechodeunajau-
la en la que tambin haba una caja. Despus se enseaban a Sarah unas fotografas y
tenaqueelegirlaquemostrabalasolucindelproblema.Segnlosautores,parallegar
aunasolucinSarahdeberacomprenderqueunpersonajetenaunproblema,atribuirle
eldeseodesolucionarloypredecirqudebahacerelpersonajepararesolverlasituacin.
Captulo 5. El desarrollo del pensamiento 151
SiSarahlohaca,entoncestendraunaespeciedeteoradelamente.SegnPremacky
Woodruf un individuo tendra una teora de la mente si atribuye estados mentales a
otrosyasmismo.Dadalanaturalezanodirectamenteobservabledelosestadosmenta-
lesyelusoquetienesuatribucinparahacerprediccionesydarsentidoalaconducta
deaquelalqueselosatribuimos,losautoresutilizaneltrminoteoraparahacerre-
ferenciaaestacapacidad.
3.1. La atribucin de creencias falsas
Enelmbitodelapsicologaevolutiva,WimmeryPerner(1983)llevaronacaboelpri-
mertrabajoespecfcamentedirigidoaponerapruebacundolosnioshabranadquiri-
dounateoradelamente
11
.Tomandocomoreferenciaunampliodebateinterdisciplinar
alquediolugarelestudiodePremackyWoodruf,sobresiSarahverdaderamenteatribua
losestadosmentalesquetenasucuidadoro,porelcontrario,podasolucionarlatarea
haciendo una interpretacin de la situacin ms simple, disearon una exigente prueba
que pudiera ofrecer datos objetivos de que los nios, al resolverla, estaran llevando a
cabounrazonamientomentalista.Lapruebaalaquenosreferimosesconocidacomola
prueba de creencia falsa del cambio inesperado. En lugar de presentarla tal cul fue
empleadaeneltrabajoinicialdeestosautores,vamosaejemplifcarestetipodepruebas
describiendolatareaquemsfrecuentementehasidoempleadaenestembito.Esuna
prueba que respetando la estructura bsica de la original, constituye una versin ms
simpleyfuediseadaporBaron-Cohen,LeslieyFrith(1985)paraevaluarlateorade
lamenteenpersonasconautismo.EsconocidacomolatareadeSally,Annylacanica,
delacanica,osimplemente,latareaclsicadecreenciafalsa.
En la tarea de la canica se cuenta al nio y se escenifca mediante miniaturas una
historiaquediscurrealolargodecuatroepisodiosyenlaqueintervienendospersonajes
(vaseFigura5.3).
Figura 5.3. Representacin grca de la tarea de creencia falsa de la canica.
11
Algunos antecedentes sobre el inters en el estudio de la comprensin de los fenmenos mentales lo
encontramosenlapropiaobradePiaget,cuandoabordaelconocimientoquetienenlosniosdelasentidades
mentalescomoelpensamientoolossueos.Noobstante,esconeltrabajodeWimmeryPernercuandose
introduceelestudiodeldesarrollodelascompetenciasmentalistascomocampodeestudioespecfco.
152 Bloque II. El desarrollo durante la primera infancia
Antes de comenzar la narracin se describe el escenario inicial y se presentan los
personajes: Sally, que tiene una cestita y una canica, yAnn, que tiene un bolsito y no
tienecanica.
Unavezqueelevaluadorcompruebaqueelnioreconocealospersonajesporsus
nombres,comienzalanarracindelahistoria:Sally,dejasucanicaenlacestita(episodio
1:situacininicial).Acontinuacin,elexperimentador,bajoelpretextodequeSallyva
asaliradarunpaseo,sacaalamuecadelaescena(episodio2:desaparicindelaes-
cenadelpersonajeprotagonista).UnavezqueSallyestfuera,Anncogelacanicadela
cestitaylaguardaenelbolsito(episodio3:cambiodelocalizacindelobjeto).Lahis-
toriafnalizacuandoSallyvuelvedesupaseo(episodio4:reaparicindelprotagonista).
Acontinuacinserealizalapreguntadeprueba,querecaesobrelaprediccindelacon-
ductadeSally,dndevaairSallyabuscarsucanica?.Porltimoserealizandos
preguntasdecontrol:unadememoria(dndeestabaalprincipiolacanica?)yotra
de realidad (dnde est ahora la canica?), que aseguran que el nio ha tenido en
cuentaelcambiodelocalizacindelobjeto.
Comovemos,alosniosselespreguntaporlaprediccindelaconducta,ynoex-
plcitamente sobre la creencia del personaje. Esto es as porque,Wimmer y Perner en-
tiendenque,desdeunpuntodevistalgico,parapredecircorrectamentelaconductaes
necesariohaberinferidopreviamente,apartirdelaccesodelainformacinquehatenido
el personaje, su creencia. La idea de que la actividad mentalista requiere llevar a cabo
procesosdeinferenciaesunadelasquehadominadoelpanoramatericoenestecampo.
Enestesentido,otrodelostrminosconquesehacereferenciaenlaliteraturaalateora
delamenteeseldecapacidadesdeinferenciamentalista.
Porqunodisearunapruebamssimpleenlaquesepresenteunpersonajeque
guarda un objeto en uno de dos contenedores y se pregunte por dnde va a ir luego a
buscarlo,osielpersonajesabedndeestelobjeto?Enestoscasosnosquedaramossin
lascaractersticasque,aefectosmetodolgicosdeinvestigacin,hizodelassituaciones
decreenciafalsabuenosindicadoresobjetivosdequeelnioalresolverlaestarate-
niendo en cuenta el estado mental del personaje. Nos referimos a la caracterstica que
tienen los estados mentales de creencia de que pueden representar de manera falsa la
realidadyenestesentido,permitendistinguirentrerespuestasalapreguntadepredic-
cindelaconductaenlasqueelnioserepresentaelestadomentaldelprotagonista,de
respuestas basadas en el estado mental del propio nio o en una representacin de la
localizacinrealdelacanica.Fjeseellectorquesielniopredicelaconductadelper-
sonajebasndoseensupropioestadomentalsobrelalocalizacindelacanica(elnio
sabedndeest)oenlalocacinrealdelacanica,estolellevaraapredecirquelamu-
ecairaabuscarlacanicaallugarcontrarioalqueiraelpersonaje,yaquestetiene
unacreenciasobresulocalizacinqueresultaserfalsa.Enestesentido,latareadecreen-
ciafalsaexigiraunrazonamientodescentradodelpropioestadomentaldelnioycon-
trafctico.Desdeelpuntodevistadelosrequisitoscognitivosderepresentacin,latarea
seharelacionadoconlacapacidaddemetarrepresentacin(Phylyshyn,1978;Perner,
1991). Esta capacidad, que va ms all de la de poder formar representaciones menta-
lessobrelassituaciones,implicarepresentarserepresentacionesmentalessobrelassitua-
ciones.
EltrabajodeWimmeryPernerhatenidoungranimpactoenelestudiodelateora
delamente,dandolugaranumerosasinvestigaciones.Losprimerosestudiosestuvieron
Captulo 5. El desarrollo del pensamiento 153
centradosenlarealizacindelasprimerasrplicasdelestudiooriginal,elcontrolexpe-
rimentaldediversasvariablesquepudieranestardifcultandoofacilitandoelrendimien-
to, as como el diseo de nuevas pruebas de creencia falsa (CF) que, junto a esta del
cambioinesperado,sehanconvertidoenprocedimientosparadigmticosdeevaluacin.
Este es el caso de la prueba de CF del recipiente engaoso, que permite abordar la
habilidaddeatribucindeCFaunomismo(Hogrefe,WimmeryPerner,1986;Perner,
LeekamyWimmer,1987;entreotros).Estetipodetareaspresentalapeculiaridaddeque
losniosevaluadossufrenensupropiapielunengao,lacreenciafalsa,quemstar-
detendrnquetenerencuenta.Entrminosgenerales,estetipodetareassedesarrolla
delasiguientemanera(vaseFigura5.4).Semuestraalosniosunrecipientefcilmen-
te identifcable al que atribuyen su contenido habitual, pero que, en realidad, contiene
otrosobjetos(ej.untubodecaramelosdeSmartiesquetienelpices).Deestemodo,
Figura 5.4. Representacin grca de la tarea de creencia falsa de los Smarties (Frith, 1989).
154 Bloque II. El desarrollo durante la primera infancia
elexperimentadorcreaenelniolacreenciafalsadequeelrecipientecontieneaquello
queeshabitual.Despusdecomprobarquelosniospiensanquehaycaramelos(qu
crees que hay dentro?), se deja que abran el tubo y vean y cojan lo que hay dentro,
constatandoelengao.Finalmentesevuelveaponerelobjetodentro(loslpices,por
ejemplo),secierraeltuboyserealizanlaspreguntasdeprueba.Esteesquemadeprueba
permitehacerpreguntastantodeautoatribucindecreenciasfalsascomodeheteroatri-
bucin:porejemplo:alprincipio,cuandoteheenseadoeltubo,qucreasqueha-
ba?/qumehasdichoquehabadentro?paralaautoatribucin,ycundoen-
seemos a otro nio el tubo as, cerrado, qu va a creer que hay dentro? / qu va a
decir que hay? en el caso de la heteroatribucin. Finalmente se concluye con una
preguntadecontrolsobreloquecontienerealmenteeltubo.
Wellman,CrossyWatson(2001)recopilaronlosdatosbrutosde187estudiosinde-
pendientesrealizadosentre1983y1998enlosqueseaplicabantareasdecreenciafalsa
comolasquehemosvisto,ascomootrasversionesdeellas.Utilizandolatcnicaesta-
dsticademeta-anlisiscontrastaronelefectodediversasvariablessobreelrendimiento:
edadmediadelosparticipantes,tipodetareadecreenciafalsa(decambioinesperadoo
derecipienteengaoso),naturalezadelprotagonista(ej.sieranmuecos,personasreales
o si se utilizaban dibujos en lugar de escenifcar la historia), presencia o ausencia del
objetoenelmomentodehacerlapreguntadeprueba(ej.unachocolatinaqueescomida
frenteaunachocolatinaquesecambiadesitio),lanotoriedaddelacreenciadelprota-
gonista(ej.enlahistorianosehacereferenciaalgunaalestadomental,osehaceverbal-
menteexplcitalacreenciaantesdepreguntarporlaconductadelpersonaje),eltipode
pregunta(preguntarporlacreenciadelpersonajeopordndeirabuscarelobjeto),etc.
Losresultadosdeestetrabajocorroboranlaexistenciadeunaprogresinenelrendimien-
to entre los 3 y 6 aos, siendo entre los 4 y 5 aos cuando se podra hablar de claros
porcentajesdexito.Porotraparte,entrelas14variablesestudiadas,unaminoradeellas
facilitabanelrendimiento,comoporejemplolaintencindeengaarquetieneelperso-
naje que realiza el cambio de lugar del objeto (vase a este respecto, Nez y Rivire,
1994)oantesdepreguntardndevaairelpersonajeabuscarlacanica,hacerexplcito
questecreequeestenlacestita.
Engeneral,aunquelainvestigacincentradaenlaevaluacindelateoradelamen-
teatravsdesituacionesdecreenciafalsaindicaquealgunasmodifcacionesdelproce-
dimientodeaplicacinpuedenfacilitarenniosdeedadcercanaalos4aossuresolu-
cin, se acepta la edad de entre 4 y 5 aos como edad crtica para la resolucin de
situacionesmentalistasenlasqueestnimplicadosestadosmentalesdecreenciafalsas.
Estaedadconstituyeunmomentodeavanceimportanteeneldesarrollodelashabilidades
mentalistas, al poner en evidencia la comprensin de que las representaciones que las
personasnospodemoshacerdelassituacionesnotienenporqucoincidirconlarealidad
dedichassituaciones,ydequesonnuestrasrepresentacioneslasqueguannuestrasac-
cionesynoloshechosensmismos.
Pocodespus,apartirdelos6-7aos,adems,losniossoncapacesdesolucionar
pruebasquerequierenciertacomprensindelcarcterrecursivodelosestadosmentales
(Perner yWimmer, 1985; Nez, 1993); esto es, entender que el referente de nuestros
estadosmentalespuedeserotroestadomental;oenotraspalabras,quenuestrosestados
mentalesnoslorepresentansituacionesohechosdelarealidad,sinoquetambinpue-
densersobreotrosestadosmentales.Laestructuraformaldelastareasdecreenciafalsa,
Captulo 5. El desarrollo del pensamiento 155
denominadas de segundo orden de intencionalidad es el siguiente: el personaje (A), al
quehayqueatribuirelestadomental,tieneunacreenciafalsasobrelacreenciaqueun
segundo personaje (B) tiene sobre un determinado estado de hechos (X). La creencia
falsa deA viene provocada porque el personaje no tiene informacin de que B ha sido
informadodequehahabidouncambioenelestadodeloshechos.Porejemplo,toman-
dounatareadiseadaporNez(1993)sobrelapruebadecreenciafalsadelacanica,
pensemosqueelpersonajequesehaidoveatravsdeunaventanaquelaotraniacam-
biadelugarlacanica.Cuandovuelvelamuecapreguntamosalnioevaluadodnde
creeAnnqueSallyvaairabuscarsucanica?DadoqueAnnnohavistoqueSallylave
cambiardelugarlacanica,AnntendrunacreenciafalsasobrelacreenciaquetieneSa-
llysobrelalocalizacindelacanica.
3.2. Habilidades mentalistas anteriores a la comprensin
de creencias falsas
Aunque como hemos sealado los nios hasta los 4-5 aos tienen problemas con las
creenciasfalsas,estonoquieredecirqueenmomentosanterioresdeldesarrolloelnio
permanezcaajenoalmundomentaldelaspersonasyelpapelquedesempeanlosesta-
dosmentalessobrelaconducta.
Sinpretenderserexhaustivosycentrndonosenelperododeedadquetratamosen
estecaptulo,vamosaexponeralgnejemplodelashabilidadesmentalistasquemuestran
losniosentrelos3y4aos.
WellmanyEstes(1986),enunestudioclsico,plantearonaniosdetresaosuna
seriedesituacionesenquedospersonajesqueranunobjeto,peromientrasqueunode
ellossolamentepensaba,soaba,simulabaorecordabaelobjeto(estoes,elobjetoera
un contenido propio del mundo de lo mental), el otro lo consegua (y por tanto era un
fenmenopropiodelmundodelofsico).Porejemplo,losautoresdecanalosniosque
aSamyaKatelesgustanlasgalletas,lamadredeSamledaunagalleta,mientrasque
Kateestpensandoenlagalleta.Acontinuacinlesformulabanunaseriedepreguntas
paraexplorarsilosniosdistinguanalgunascaractersticaspropiasdelosobjetosen
cuantofenmenosmentalesofsicos.Losniosaestaedaderancapacesdeapreciarque
elpersonajequetenalagalletapodacomerla,oqueelquetenaunabicipodamontar
enellaperonoelquelarecordaba,mostrandoasciertacomprensindequelosfen-
menosfsicos,ynolarealidadmental,ofrecenevidenciasensorio-comportamentalde
suexistencia:sonperceptiblesypodemosactuarsobreellos.
Otrostrabajosindicanqueaestaedad,losniosavanzanenlacomprensindeesta-
dosmentalesmssimplesquelascreencias,comoporejemplolosdedeseo(vaseWe-
llmanyLiu,2004paraunarevisin).
En ciertas situaciones simples de evaluacin, los nios de 3 aos parecen entender
los deseos como elementos que dirigen la accin, y que los otros pueden tener deseos
diferentesalospropios.Porejemplo,dirnqueunpersonajeseguirbuscandoalgoque
quieresinoloencuentra,mientrasquesiloencuentradejardebuscarlo;siselesdice
queelprotagonistadeunahistoriapuedejugaraXoaY,sepresentandosdibujosdel
protagonista, uno para cada una de las posibles situaciones de juego, y se les pide que
elijanquharelprotagonista,eligeneldibujoquerepresentaalpersonajejugandoalo
que se ha especifcado que quiere jugar, aunque ellos mismos haban preferido el otro
156 Bloque II. El desarrollo durante la primera infancia
juego.Adems,soncapacesderelacionarlasatisfaccin/insatisfaccindelosdeseoscon
emociones simples de alegra/tristeza. Durante este perodo tambin se ha sealado un
progreso en la comprensin de que algo que en un determinado momento es deseado
puededejardeserloenotro,odequelaspersonaspodemostenerdeseosdiferentessobre
unmismoaspectodelarealidad(unamismacosapuedeserdeseadaporunapersonapero
noporotra)(Yuill,1984;Harris,Johnson,Hutton,AndrewsyCooke,1989;Flavell,Fla-
vell,GreenyMoses,1990;WellmanyWoolley,1990;HadwinyPerner,1991;Wellman
yBanerjee,1991;BartschyWellman,1995,entreotros).
Porsuparte,trabajosquehanevaluadolaatribucindeconocimiento/ignoranciaindi-
canqueaestaedadlosniosentiendenunaspectotancentralcomoquequiennovealgo,
nolosabe,yquequienlovelosabe.Estoes,relacionanelaccesoquelaspersonastienen
alainformacincomofuentedelcontenidodelosestadosmentales(Hogrefe,Wimmery
Perner,1986;PerneryOgden,1988;Pillow,1989;PrattyBryant,1990,entreotros).
4. Conclusiones
Alolargodelcaptulosehanmostradotresdiferenteslneasquecoincidenenexplorar
algunas de las aptitudes y limitaciones del nio entre los dos y los seis aos. Desde la
teorapiagetianaseincideenlacapacidadsimblicadelniocomovaluartedenuevas
acciones,impensablesenelperodosensorimotor,comoeldibujo,laimitacindiferida
oeljuegodefccin(vaseCaptulo7).Asimismo,hemosmostradolascarenciaslgicas
delnio,segnestateora.Porotrolado,hemosconocidolainterpretacinvygotskiana
dellenguajeegocntrico,olosestudiosmodernosdeteoradelamente,quecoinciden
enresaltarimportantesdesarrollosenlosniosdeentre2y6aos.Pero,seraerrneo
ignorarqueenesteperodohayotrosmuchosdominiosqueestnavanzandodeunmodo
sutil.Porejemplo,entrelosdosylosseisaossegestanimportanteshabilidadesnum-
ricasodesolucindeproblemasqueresultarnevidentesenlasegundainfanciaentre
los6ylos11aos(vaseCaptulo8).Conocerestasdiferenteslneasdeinvestigacin
ycomprendersusdiferenciaspuededarnoslaimpresin,correcta,dequeelestudiodel
desarrollohumanoestanpolidricocomoelpropiodesarrollo.
Todasestasposicionestericas,aligualqueotrasquepodramoshabermencionado,
tienen su lugar en el desarrollo, su parcela de verdad. No obstante, para descubrir los
aciertosdecadaunadeellasesprecisoconsiderarconqupropsitos,situaciones,tareas
y nivel de exigencia se mide el comportamiento infantil. Muchas habilidades no son
cuestin de todo o nada. En esta etapa, muchas de las capacidades intelectuales de los
niossonanmuyfrgilesyporellomuysensiblesalmodoenqueseevalan.
Lecturas complementarias
Piaget,J.(1924/1972).Eljuicioyelrazonamientoenelnio,vol.II.BuenosAires:EditorialGua-
dalupe.
Rivire,A.yNez,M.(1996).Lamiradamental.BuenosAires:AIQUE.
Vygotski,L.S.(1982).Pensamientoylenguaje.Obrasescogidasvol.II.Mosc:EditorialPeda-
ggica.
Captulo 5. El desarrollo del pensamiento 157
Actividades
1. Conteste a las siguientes preguntas abiertas
1.1. Piense en diferentes ejemplos de egocentrismo infantil.
1.2. Piense en algn ejemplo de habla egocntrica externa o audible en per-
sonas adultas.
1.3. Qu dos aspectos de la capacidad de atribucin de estados mentales se en-
cuentran en la base de que fuera denominada teora de la mente?
1.4. En cul de ellos se fundamenta la idea de que la teora de la mente es una
actividad de carcter inferencial?
1.5. En la siguiente tabla se recogen algunos enunciados relacionadas con el de-
sarrollo de la teora de mente en el nio. A partir de la lectura de los Epgra-
fes 3.1 y 3.2, seale la edad a la que prototpicamente los nios dan muestras
de su comprensin.
Edad
3-4 4-5 6-7
Una situacin puede provocar en una persona tristeza y en
otraalegra.
Losestadosmentales,inclusocuandorepresentandemanera
equivocadalarealidad,dirigennuestraconducta.
Laspersonaspodemostenerdiferentesestadosmentalesso-
breunamismasituacin.
Losestadosmentalespuedenrepresentarasuvezotrosesta-
dosmentalesquelaspersonastienensobreelmundo.
Elaccesoalainformacindeterminaelcontenidodeloses-
tadosmentales.
2. Indique si las siguientes armaciones son verdaderas o falsas
2.1. Para Piaget el habla egocntrica ayuda al nio a organizar su accin (V/F).
2.2. Segn Vygotski, en el ejercicio de su funcin privada, el habla egocntrica iba
atrondose hasta hacerse incomprensible y nalmente no ser siquiera per-
ceptible (V/F).
2.3. Slo los nios pequeos y los adultos que padecen enfermedades psiquitri-
cas hablan para s en voz alta (V/F).
2.4. Segn Piaget, los nios hablan en alto con mucha frecuencia porque an no
han interiorizado su lenguaje egocntrico (V/F).
158 Bloque II. El desarrollo durante la primera infancia
Soluciones a las actividades
1. Preguntas abiertas
1.1. El egocentrismo infantil queda patente en muchos comportamientos cotidia-
nos, por ejemplo cuando los nios nos invitan a ver sus juguetes a travs del
telfono, o cuando se ocultan tras el lateral de un silln dejando a la vista sus
pies. Todo ello son ejemplos de que lo que ve o no ve el nio es tomado de
forma universal: es lo que ve o no ve todo el mundo.
1.2. Los adultos acostumbramos a pensar de forma dialogada, pero en silencio. El
dilogo con nosotros mismos se efecta en un plano interno y slo en con-
tadas ocasiones lo necesitamos exteriorizar. Un ejemplo de estas situa ciones
es cuando afrontamos tareas que desafan nuestra atencin, por ejemplo, al
revisar una maleta minutos antes de salir de viaje o al repasar nuestras res-
puestas antes una prueba de evaluacin. Estas situaciones que requieren toda
nuestra atencin pueden llevarnos a hablar en voz alta en un intento de con-
trolar de forma ms precisa e intensa nuestros procesos mentales.
1.3. Uno de los aspectos que dan sentido al trmino de teora de la mente
sera el carcter no directamente observable de los estados mentales que
atribuimos en nuestra actividad mentalista. Otro tiene que ver con la fun-
cin que tiene dicha atribucin a la hora de hacer predicciones e intentar
explicar el comportamiento de las personas que son objeto de dicha atri-
bucin.
1.4. La idea de que la teora de la mente requiere de procesos de inferencia es-
tara relacionada con el primer aspecto que hemos mencionado al resolver
la actividad 1.4: que los estados mentales no son directamente observables.
Estos tendran que ser inferidos a partir del acceso que la persona ha tenido
a la informacin sobre las situaciones, como en el caso de la tarea de creen-
cia falsa. Lo que decimos verbalmente ante situaciones concretas, aunque no
hagamos referencia explicita a nuestros estados mentales, nuestras expre-
siones faciales o, por ejemplo, tambin cmo nos comportamos ante una
determinada situacin seran otros elementos que las personas empleamos
para hacer inferencias mentalistas. Por ejemplo, si vemos que nuestro com-
paero de piso abre y cierra uno de los cajones del aparador, a continuacin se
dirige con cara de extraeza hacia otro de los cajones, vuelve a realizar esta
misma operacin y saca del cajn su MP3 con la misma cara de extraeza,
probablemente inramos que quiere encontrar algo que cree que dej en el
primero de los cajones, pero que resulta que no es as, y es ms, no recuer-
da haberlo dejado en el cajn en el que nalmente lo en contr.
1.5. La solucin a la actividad 3 se muestra en la siguiente tabla:
Edad
3-4 4-5 6-7
Una situacin puede provocar en una persona tristeza y en
otraalegra.
X
Losestadosmentales,inclusocuandorepresentandemanera
equivocadalarealidad,dirigennuestraconducta.
X
Captulo 5. El desarrollo del pensamiento 159
Edad
3-4 4-5 6-7
Laspersonaspodemostenerdiferentesestadosmentalesso-
breunamismasituacin
X
Losestadosmentalespuedenrepresentarasuvezotrosesta-
dosmentalesquelaspersonastienensobreelmundo.
X
Elaccesoalainformacindeterminaelcontenidodeloses-
tadosmentales.
X
2. Verdadero o falso
2.1. F. Piaget no atribuy al habla egocntrica ninguna funcin relevante. Este
fenmeno era slo una demostracin de la incapacidad infantil para ma-
nejar el punto de vista del interlocutor.
2.2. V.
2.3. F. Hablar en voz alta es un recurso que nos permite controlar mejor nuestra
conducta y nuestros procesos de pensamiento. Por consiguiente, muchas
situaciones desaantes pueden desencadenar el habla egocntrica en los
adultos. Por ejemplo, en situaciones de evaluacin muchos alumnos ha-
blan para s o eso esperamos! mientras repasan sus respuestas.
2.4. F. Efectivamente, los nios pequeos suelen pensar en voz alta en ms oca-
siones que los adultos, ya que puede que an no hayan completado su
proceso de interiorizacin del habla egocntrica. Pero esto no lo dijo Pia-
get, sino Vygotski.
El desarrollo
del lenguaje oral
161
6
SONIA MARISCAL ALTARES
Esquema-resumen
Objetivos
Introduccin
1. El desarrollo de la forma del lenguaje durante la primera infancia
1.1. Desarrollo fonolgico: cmo se va completando la adquisicin del sistema
de fonemas
1.2. Desarrollo del vocabulario y desarrollo gramatical
2. El desarrollo pragmtico y las habilidades para narrar
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva evolutiva
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas y
explicaciones constructivistas
5. Aprender el lenguaje en contextos bilinges
5.1. La importancia de los perodos crticos: por qu es mejor aprender las
lenguas desde pequeos?
5.2. Ventajas del bilingismo: en qu condiciones tiene consecuencias positivas
para el desarrollo general?
Lecturas complementarias
Actividades
Soluciones a las actividades
162 Bloque II. El desarrollo durante la primera infancia
Esquema-resumen
1. El desarrollo de la forma del lenguaje durante la primera infancia
Los aos de Educacin Infantil son un importante perodo de desarrollo para los aspec-
tos formales del lenguaje: fonolgicos y gramaticales.
Las habilidades fonolgicas de los nios experimentan un crecimiento importante,
aunque pueden persistir para algunos nios las dicultades de pronunciacin.
El vocabulario experimenta un importante crecimiento en trminos cuantitativos,
pero tambin se producen cambios cualitativos en cuanto a la organizacin del lxico.
El desarrollo gramatical avanza hacia la comprensin y produccin de emisiones
complejas, que se concatenan entre s. Desde el punto de vista morfolgico se
observan errores de sobregeneralizacin.
2. El desarrollo pragmtico y las habilidades para narrar
El uso del lenguaje en contextos reales constituye una habilidad compleja que exige la
coordinacin de distintos tipos de conocimiento (lingstico y extra-lingstico).
El perodo de 3 a 6 aos es un espacio temporal privilegiado en relacin al desa-
rrollo de las habilidades pragmticas.
La funcin narrativa del lenguaje constituye una interfaz entre los distintos niveles
del lenguaje: formales (lxico y gramatical) y funcionales (semntico y pragmtico).
Durante los aos preescolares se produce un desarrollo importante de las habili-
dades narrativas.
La produccin de narraciones constituye una faceta del desarrollo que se relacio-
na tambin con la construccin de recuerdos personales y el desarrollo de la me-
moria autobiogrca, aspectos relacionados con la identidad personal.
3. Las relaciones entre el pensamiento y el lenguaje desde la perspectiva
evolutiva
Piaget y Vygotski abordaron la relacin entre pensamiento y lenguaje y su evolucin en
relacin al desarrollo del fenmeno del habla egocntrica, un tipo de habla para s
mismo, no social, que acompaa la accin del nio desde los 3 aos aproximadamente.
Piaget plante que el habla egocntrica desapareca cuando el nio supera el
egocentrismo caracterstico del perodo preoperatorio; en su modelo terico, el
desarrollo del lenguaje se subordina al desarrollo de la inteligencia, de ah la evo-
lucin del fenmeno.
Vygotski reinterpret el fenmeno del habla egocntrica relacionndolo con el
surgimiento de una nueva funcin del lenguaje: la funcin reguladora de la pro-
pia conducta. El habla egocntrica no desaparece, sino que evoluciona hacia el
pensamiento verbal.
4. Cmo se explica la adquisicin del lenguaje: modelos lingsticos innatistas
y explicaciones constructivistas
El problema de explicar la adquisicin del lenguaje y de dar cuenta de los mecanismos
que la hacen posible ha sido y es una cuestin central en Psicologa.
La propuesta del lingista Noam Chomsky es paradigmtica del tipo de explica-
ciones innatistas. Para este lingista la facultad de lenguaje implica la existencia
de una base de conocimiento especca, de origen gentico, que hace posible el
aprendizaje de la sintaxis de las lenguas la Gramtica Universal.
Captulo 6. El desarrollo del lenguaje oral 163
Objetivos
Conocer cules son los principales procesos de desarrollo del lenguaje en la etapa
entre 3 y 6 aos.
Diferenciar los procesos de cambio cuantitativo y cualitativo en el desarrollo l xico.
Identicar las habilidades relacionados con la adquisicin del componente grama-
tical en la primera infancia.
Conocer los procesos lingsticos formales y funcionales implicados en la narracin.
Establecer la importancia de las actividades narrativas en el desarrollo cognitivo y
socio-afectivo de los nios.
Conocer los planteamientos piagetiano y vygotskiano sobre las relaciones entre
el pensamiento y el lenguaje y su evolucin. Saber diferenciar la explicacin pia-
getiana sobre el lenguaje egocntrico de la propuesta alternativa de Vygotski.
Conocer las principales propuestas tericas sobre el proceso de adquisicin del
lenguaje; distinguir los modelos de tipo lingstico-innatista y de las propuestas
constructivistas.
Aproximarse al proceso de adquisicin del lenguaje en contextos bilinges.
Saber denir el concepto de perodo crtico con las matizaciones que se han he-
cho al mismo en la actualidad.
Conocer las implicaciones cognitivo-lingsticas y socio-afectivas del desarrollo en
contextos bilinges.
Introduccin
Elprocesodeadquisicindellenguajeesunadelasvertientesmsimportantesdelde-
sarrolloinfantilenlaprimerainfancia.EnelCaptulo3vimoslosiniciosdeesteproce-
soylosprincipaleslogrosadquiridoshastaaproximadamentelos3aosdeedad.Sibien
latareadeaprenderunalenguaseponeenmarchamuytempranamente,elaprendizaje
Las propuestas constructivistas, como la de Karmiloff-Smith, niegan la existencia
de representaciones lingsticas especcas, de origen gentico, pero no la de
predisposicio nes iniciales y mecanismos de aprendizaje ajustados a la tarea de
aprender una lengua.
El lenguaje se constituye en dominio especco de conocimiento como resultado
no como punto de partida del proceso de aprendizaje.
5. Aprender el lenguaje en contextos bilinges
Un individuo bilinge es aquel que posee dos sistemas lingsticos y es capaz de utili-
zarlos en cualquier circunstancia con una facilidad y ecacia semejantes.
Las circunstancias por las que un nio puede llegar a ser bilinge son enormemen-
te variadas, as como los posibles grados de bilingismo alcanzados.
Actualmente se utiliza la nocin de perodo sensible, frente a la de perodo crtico,
en relacin con los momentos evolutivos ms apropiados para el aprendizaje de las lenguas.
No todas las condiciones familiares, sociales ni culturales son igualmente propicias
para promover un desarrollo lingstico y de la identidad bilinge adecuados.
Las actitudes y expectativas positivas de padres, profesores y educadores son crticas
en relacin a un buen desarrollo de la condicin bilinge en todas sus facetas: cogniti-
vo-lingstica y socio-afectiva.
164 Bloque II. El desarrollo durante la primera infancia
dellenguajeconstituyeunmbitodedesarrollocomplejoy,comosealaacertadamente
Aguado (1997), se trata de un trabajo de sol a sol, que contina durante los aos de
EducacinInfantil.Frutodeesetrabajo,enprcticamentetresocuatroaosyencondi-
cionesnaturales,elbebhumanosetransformaenunhablantebastantecompetente:es
capaz de mantener una conversacin ciertamente fuida, comprende el lenguaje de los
adultosenconversacionessencillas,puedecontarsusexperienciaspresentesypasadas,
puede hablar de lo que va a hacer maana e incluso es capaz de jugar con el lenguaje.
Perolaadquisicindellenguajenoesslointeresanteysorprendenteensmisma,
sinoquecomoprocesocognitivobsico,sudespliegueinfuyeeneldesarrollodeotros
procesosevolutivosintelectuales,afectivosysociales.
Enestecaptulonoscentraremosendescribirlosprincipalesprocesosdedesarrollo
lingsticoquetienenlugarentrelos3ylos6aosaproximadamenteyanalizaremosel
papelfundamentalquetieneellenguajeenrelacinconeldesarrollocognitivo.Tambin
abordaremoselaprendizajedellenguajeencontextosbilingesomultilingesyrefexio-
naremossobrelascondicionesenlasqueestassituacionestienenconsecuenciaspositivas
paraeldesarrolloinfantilyposterior.
1. El desarrollo de la forma de lenguaje durante
la primera infancia
Delos3alos6aosseabreunimportanteperododedesarrolloparatodoslosaspectos
dellenguaje;sinembargo,desdeelpuntodevistaformalseproducenavancesmuyim-
portantesquehacenqueellenguajedelosniossehagamscomprensibleycomplejo.
Lashabilidadesfonolgicasdelosniosexperimentanuncrecimientoimportante,aun-
queparaalgunospersistirnlasdifcultadesdepronunciacinduranteestaetapa.Adems,
de las emisiones de 2 o 3 palabras tpicas de los nios menores de 3 aos, el lenguaje
infantil evoluciona hacia la produccin de oraciones complejas que se van hilvanando
unasconotrasypermitenalnioconstruirnarraciones.Veamosconalgomsdedetalle
algunodeestosprocesosdeadquisicinformales.
1.1. Desarrollo fonolgico: cmo se va completando
la adquisicin del sistema de fonemas
ComovimosenelCaptulo3,laactividadarticulatorianecesariaparapronunciarcorrec-
tamentelaspalabrasdecualquierlenguaimplicaunacomplejacoordinacinneuromus-
cularyrespiratoria.Generalmentelosniosmenoresde4o5aosantienendifcultades
parareproducirlassutilesvariacionesdesonidosquedemandalaproduccindellengua-
jeoral.Estasdifcultadessematerializanenformasdepronunciacinaninmadurasque
sonproductodelaaplicacindelosdenominadosprocesosfonolgicos.EnlaTabla6.1
seexplicaenquconsistendichosprocesosyculessonlosprincipalestipos.
Puestoquelaslenguassediferencianyaenelnivelfonolgico,elordendeadquisi-
cindelosdistintosfonemasvaradeunaaotra.Centrndonosendatossobrelaadqui-
sicindelalenguaespaola(Bosch,2005)podemosdestacarquealos3aos:
El 90% de los nios espaoles ya emiten correctamente los siguientes fonemas:
/m/,/n/,//,/p/,/t/,/k/,/b/,/l/,ademsdelsonidocorrespondientealajyg
enpalabrascomojota,ogesto.
Captulo 6. El desarrollo del lenguaje oral 165
Losniosyapronuncianbienlosdiptongosdecrecientes,talescomo/ai/,/ei/,pero
tienendifcultadesconloscrecientes(porejemplo,dicenlogoodenteenlugar
de luego y diente). Tambin tiene problemas con los grupos consonnticos
CL(porejemplo,clara,clase)yCR(porejemplo,croar).
Siguehabiendoalgunasdifcultadesconelfonema/d/cuandovaentrevocales(por
ejemplo,enpalabrascomoadelante),ylosfonemascorrespondientesalazy
c(enpalabrascomocerilla,Celia).Ademslamayoradelosniosnopro-
nunciancorrectamentelarfuerte(porejemplo,perro,roto).
Portanto,alostresaosestconseguidogranpartedelsistemafonolgico,siendo
normaleslasdifcultadesenlapronunciacindelosgruposconsonnticosydealgunas
consonantes.Entrelos4y5aosseobservanlossiguientesprogresos:
Selograproducircorrectamentela/d/entrevocales,searticulabienla/g/(cuando
suenacomoengato,guinda,etc.).
El90%delosniosyaproducebienlaconsonantefricativa/f/;un80%articula
bienla/s/yun70%elsonidocorrespondienteala/z/.
Lamayoradelosniospronuncianbienelsonidocorrespondienteala/ch/,adi-
ferenciadeloqueocurraalos3aos.
Todava no se alcanza la cifra del 90% de nios que pronuncian bien los grupos
consonnticos, ni la r fuerte, aunque muchos ms nios de estas edades ya las
articulanbien.
Alos6aos,antesdelcomienzodelaetapaescolar,losnioscastellano-hablantes
puedenpronunciarcorrectamentecualquiersonidodelalengua(incluidaslasfricativas,
la r fuerte y los grupos consonnticos). Pueden presentar nicamente difcultades en
relacin a palabras muy largas o complejas, pero mejoran mucho la pronunciacin de
sonidosdifciles(/ch/,/s/,/z/,/l/,rfuerte).Apartirdelos6o7aos,losniosestabi-
lizan su pronunciacin y las habilidades fonolgicas adquiridas favorecen adems el
Tabla 6.1. Los procesos fonolgicos de simplicacin del habla
Denicin y ejemplos
Losprocesosfonolgicossonestrategiasdesimplifcacinquepermitenalosniosmenoresde4aos
comunicarse y hacerse entender, an cuando no son capaces de reproducir todas las sutiles variaciones
desonidosqueimplicalaproduccindellenguajeoral.Haytrestiposdeprocesos:
1. Reduccinysimplifcacindelaestructurasilbica:consisteensimplifcarlasslabas,reduciendosu
nmerooconvirtindolasenlaslababsica(CV).
Ejemplo:Unniodicefandaenlugardebufandaodicedeteenlugardediente.
2. Procesosdeasimilacin:sonresultadodelainfuenciadeunsegmentoosonidosobreotrosegmen-
todentrodelamismapalabra.
Ejemplo:Unaniadicelibloenvezdelibro,y,nunaenlugardeluna;enelprimercaso
arrastralaconsonanteinicialalasegundaslaba,yenelsegundocasoeslaconsonantenlaque
afectaretroactivamentealaprimeraslaba.
3. Procesos sustitutorios: consisten en la sustitucin de un fonema por otro sin hacer referencia a los
sonidosprximos.
Ejemplo:Unniodiceborroenvezdegorro,y,sapatillaenvezdezapa tilla,sustituyendo
enamboscasoslasconsonantesinicialesporotrasmsfcilesdepronunciar.
166 Bloque II. El desarrollo durante la primera infancia
aprendizajeydesarrollodelalectura.Lamejoradelashabilidadesfonolgicasfacilita
el desarrollo creciente del vocabulario y ste tambin se ve impulsado por dicho creci-
mientofonolgico.
1.2. Desarrollo del vocabulario y desarrollo gramatical
Lamayoradelosestudiossobreeldesarrollodelvocabulariosecircunscribenalospri-
meros aos y abordan los principales procesos que intervienen en el aprendizaje del
lxicoinicial(vaseporejemplo,Serra,2000).EnelCaptulo3vimoscmoelvocabu-
lario creca inicialmente de modo lento y que despus este proceso experimentaba una
aceleracinimportante.Durantelaprimerainfancialaadquisicindelvocabulariosigue
estatendenciadecrecimientoacelerado.Eldesarrollocognitivodelnio,sushabilidades
deinteraccinsocialysuparticipacinencontextosextra-familiarescadavezmsdiver-
sos(escuelainfantil,amigos,etc.)favorecendeformaindudableelaprendizajedenuevas
palabras.Sinembargo,elcrecimientoadecuadodellxicosemanifestanosloeneluso
deunmayornmerodeentradaslxicas,sinotambinenlaorganizacindelvocabulario
yenlautilizacindelaspalabrasendistintoscontextoslingsticos.Porejemplo,lapa-
labraaguaqueesaprendidamuytempranamenteencontextosdealimentacinconel
signifcado de sustancia para beber, puede ser utilizada en muchos otros contextos y
conectadaconotraspalabrasrelacionadas;porejemplo,sepuedeutilizaralhablardeun
roodelmar,enrelacinalalluvia,alanieve,etc.
Sitenemosquecaracterizarelprocesodedesarrollolxicoenlaprimerainfanciaes
indudablequehayquealudirauncrecimientocuantitativo(vaseTabla6.2),perotam-
binacambiosdetipocualitativo.Estosltimossereferenalaorganizacindelvoca-
bulario, a las relaciones que se establecen entre unas palabras y otras. Por ejemplo, un
nio que aprendi la palabra coche con 24 meses, puede aprender la palabra ve-
hculoalos5aos,perodebeaprendertambinqurelacionesseestablecenentream-
bas para hacer un uso adecuado de ellas; es decir, vehculo habr de situarse como
categoramsgeneral,supraordinada,enrelacinacoche,perotambinenrelacina
autobs,tren,etc.Esemismoniopuedeaprenderlapalabrataxicomountipo
de coche especial; por tanto, si incorpora esta palabra a su vocabulario, sta se situara
enunlugarsubordinadorespectoalapalabracoche.
Tabla 6.2. Algunos datos cuantitativos sobre el desarrollo del vocabulario
Desarrollo del vocabulario
Templin(1957)estimqueeltamaodelvocabulariodeunniode6aospodaserdeunas14.000
palabras.
Carey(1978)calculqueelritmodeaprendizajemediodepalabrasdelosniosentrelos18mesesy
los6aossesitaentornoa9palabrasporda.
ElestudiodeAnglin(1993)sobreelcrecimientolxicoenlosprimerosaosdeescolarizacinindica
que entre los 6-7 aos y los 10-11 aos el vocabulario medio se multiplica por 4: de ms de 10.000
palabrasconocidasporlosniosde6aossepasaaunas40.000palabrasenlospreadolescentes.
Elvocabularioesuncomponentedellenguajequecontinacreciendomsalldelainfancia.
Laentradaenlaescuelayelaprendizajedelalecturafavorecenindudablementelosprocesosdeaprendi-
zajelxico.Loslibrosproporcionanelaccesoaunabanicodepalabrasmuchomayordelquenosencon-
tramoshabitualmenteenelhabladiaria.
Captulo 6. El desarrollo del lenguaje oral 167
Loscambiosenrelacinaldesarrollolxicosuponen,portanto,laconstruccinde
losdistintoscampossemnticosqueformanelvocabulariodeunalengua;losprocesos
cuantitativos y cualitativos que mencionbamos ms arriba implican el aprendizaje de
ms elementos por cada nivel de organizacin y el establecimiento de relaciones entre
ellos.Unametforatilparacaracterizarlarepresentacindelaspalabrasenelsistema
cognitivoeslaimagendeunaredintegradapormltiplessubredeslxico-semnticasque
dan soporte a lo que podramos caracterizar como el diccionario mental de cada ha-
blantedeunalengua.
Pero aprender las palabras de una lengua no implica nicamente ser capaz de esta-
blecer relaciones entre la forma fonolgica (cmo suena la palabra) y el referente o
signifcado de la misma; el aprendizaje lxico se relaciona tambin con el aprendizaje
gramatical.Veamosenqusentido.
Conocer una palabra supone tambin saber de modo implcito a qu categora
gramaticalpertenece.Nohacefaltaserunlingistaprofesionalparasaberque,porejemplo,
la palabra elefante es un nombre, mientras que la palabra soar es un verbo. Saber
implcitamentelacategoragramaticalalaquepertenecenambaspalabrasesunrequisitob-
sicoparapoderconstruirfrasesgramaticalmentecorrectas:pertrechadosconesteconoci-
miento,nuncasenosocurriradecir*yoelefantoparaexpresar,porejemplo,quemuevomi
manocomosifueralatrompadeunelefante,puessabemosqueeserrneotrataresapala-
bracomounverbo;diramoshagocomosifueraunelefante,agrupandocorrectamente
elnombreelefanteconelartculounyconstruyendouncorrectsimoSintagmaNominal.
Losprocesosdeaprendizajedelascategorasgramaticalessoncomplejosyconstitu-
yenunadelastareasmsimportantesdeaprendizajedurantelosprimerosaosdelde-
sarrollo lingstico. Su inicio es temprano, como apuntamos en el Captulo 3, pero su
extensin a lo largo del desarrollo ocupa al menos hasta la adolescencia. La forma de
estimarlasdifcultadesdeestosprocesosestratardeadoptarelroldeaprendizypensar
ennosotrosmismosaprendiendounasegundalengua.Lagramticasenospresentaen-
toncescomounmuromuchasvecesimpracticable!
Durantelaetapade3a6aoslosniosseencuentraninmersosenunactivoproceso
deaprendizajegramatical.Enlabibliografaespecializadasesuelesealarqueentorno
alos4aoslosniosyatienenadquiridaunaprimeragramticabsica.Sinembargo,el
estadofnal(siesqueexistetalestadoeneldesarrollodellenguaje)estanmuylejos.
Hablarcomounadultoimplicaconocerlassutilezasmorfolgicasdelalengua,especial-
mentesisetratadeaprenderunalenguatanricaaestenivelcomolaespaola,ytodas
lasestructurassintcticas,incluyendolasmscomplejas.Nopodemosentrarenlacarac-
terizacinendetalledeestosprocesos,puesnoeselobjetivodeestecaptuloniseadecua
alasnecesidadesdeformacindeuneducador.Sinembargo,paraobtenerunaimpresin
deesteimportanterecorridoevolutivoestilacercarseadatosempricoscomolosque
sepresentanenelTabla6.3.
Sicomparamosambastranscripcionesconellenguajetpicodelnioenlosinicios
delprocesodeadquisicin,esfcilapreciarloscambios:deunaausenciadeorganizacin
gramaticalenellenguajetemprano,enelquelosniosrealmentenoconstruyenoracio-
nes,sinoquejuntanpalabras(porejemplo,aqunenes),sepasaaunlenguajeinte-
gradopororacionessimplesbienformadas(porejemplo,amimegustanlasbujaspi-
rujasniade3aos)yaemisionessintcticasmscomplejas(porejemplo,mira,te
puedespasearporahsiquieresniade5aos).
168 Bloque II. El desarrollo durante la primera infancia
Entre los indicadores de las difcultades que plantea el proceso de adquisicin del
componente gramatical se encuentran los errores morfolgicos y las pausas entre una
oracinyotra,oenelinteriordeoracionescomplejas.Losprimerossonmuyinforma-
tivosdelniveldeadquisicinalcanzadoporlosniosydelprocesodeaprendizajesub-
yacente.Noeslomismocometerunerrorcomo*yosabe,enelqueloquefallaesla
concordanciaentreelsujeto(1.persona)yelverbo(3.personaenelejemplo)porque
el nio probablemente no ha detectado, ni extrado, ni almacenado el morfema verbal
de persona, que cometer un error como *yo sabo. Este segundo tipo de errores, lla-
madoserroresdesobregeneralizacin,indicanjustamentequelosniosyahanadqui-
rido una regla gramatical de tipo morfolgico. El nio que dice *sabo en lugar de
se,realmenteyasabeyestonoesunmerojuegodepalabras,comoseapreciaen
elTabla6.4.
Tabla 6.4. Errores de sobregeneralizacin
Denicin y ejemplos
Los errores de sobregeneralizacin implican la extensin de una regla gramatical ms all de lo per-
mitido por la lengua. Consisten en la aplicacin de dicha regla a palabras que son una excepcin a la
misma.
Ejemplosrelacionadosconlamorfologaverbal:Unaniade2aosymediodice:voya*cojouna
silla(envezdevoyacogerunasilla)yyono*sabo(enlugardeyonos).
Ejemplosrelacionadosconlamorfologanominal:Unniode4aosdice:mam,yosoy*unafan-
tasmayestenioes*idioto.
Loserroresdesobregeneralizacindemuestranqueelnioyaconocelasreglasgramaticales.Por
tanto,sonsignospositivosdeunbuendesarrollolingstico.
Tabla 6.3. Transcripcin del lenguaje espontneo de una nia a los 3 y 5 aos
Nia 3 aos Nia 5 aos
N=nia.
M=mam.
N: Yamequito,yamequitaolatoallaysoyMa-
niayo.
M: Claro.
N: Qutamelolatoalla,quenomegutanlasbujas
pirujas.
M: Notegustan?
N: Noo!
M: Porqu,miamor?
N: Poqueno.Amimegutanlasbujaspirujas.Es-
tabaenelcuentounabujapiruja.
M: Yquhaca?
N: Nos.
M: Pinsalo,averquhaca.
N: Quetenaunamasana,aques?
N=nia. xxx=hablaininteligible
P=pap.
P: Vasahacer,qu?
N: Unas cortinas, aqu. Unas cortinas muy boni-
tas.Sonderayas.Ahoratelasenseosiquiero
[leenseaeldibujoasupadre].Miralacortina
[pintadenuevo].Vaaestarmuybienconcor-
tina.Yaestconcortinaymuybientapadito[lo
ensea].
P: Muybien.
N: Ahoranecesitootra.Estasqueesrojadever-
dad[juntadoslpicesylosponedepie,como
si fueran muecos] Vale, hijo... xxx... ya que
hemosvenido.Mira,tepuedespasearporah,
siquieres.Aypap!Peroesqueestosetiene
queacercar.Vale!...xxx...acrcate;poraqu,
yomeacercoporaqu.
Captulo 6. El desarrollo del lenguaje oral 169
Entre los 4 y los 5 aos es frecuente que los nios mientras estn contando algo a
alguieninterrumpansusoraciones,repitanpartedelodichoycambiendeunaestructura
aotra(vaseTabla6.5)Estetipodeprocesossonindicativosdelasdifcultadesquesu-
poneconstruircorrectamenteunanarracinydelaatencinquerequiereelprocesamien-
to lingstico que subyace a esta actividad relacionada con la produccin del lenguaje.
Narrar es un tipo de actividad lingstica que constituye un interfaz
1
entre los distintos
nivelesdellenguaje:losmsformales(lxicoygramatical)ylosmsligadosalafuncin
yalainteraccin(semnticoypragmtico).Nosocuparemosdeestetemaenelsiguien-
teapartado.
Tabla 6.5. Dicultades en la construccin gramatical durante la produccin del lenguaje
Ejemplo de interaccin entre un adulto y una nia de 4 aos
[Lospuntossuspensivos...indicanpausasquepuedeninterpretarsecomotiempoparaprocesar].
Adulto:paraques?(hablandodeunchndal).
Nia:paradormir?elchndalnoesparadormir,esparalacalle,ypara....,yparacasa
Adulto:s,mivida,peroencasaloutilizamoscomopijama,vale,miamor?
Adulto:cuntamelohija,quemamnolohaentendidobien.
Nia:papsellamaMiraelnioseasust,estabasentadoenunasillaelnio,sloelnioyelnio
como,comlecomoledabacaramelol,ET,puescomoyasedespertelniosedabacaramelos
y ya estaba bueno y ya puede tomar caramelos. Estaba dormido con caramelos y y tom mucha
cervezapolo,hacababas.
2. El desarrollo pragmtico y las habilidades
para narrar
Lacomprensindellenguajeencontextosdehablarealesycotidianosimplicalaparti-
cipacin de distintos tipos de conocimientos y habilidades. Por ejemplo, ante la frase
mepuedespasarlajarra?,porfavor,unainterpretacinliteraldelamismallevaraal
oyenteacontestarsono.Sinembargo,coneseactodehablaindirecto
2
loquepersigue
elemisoresquesuinterlocutorleacerquefsicamenteelobjetoquepide,lajarra.
Sipensamosenlostiposdeinformacinquehayquetenerencuentaparacompren-
der(ytambinparaemitir)estetipodeemisionestancomunesenlavidacotidiana,de-
bemosincluiralmenoslassiguientes:1)informacinestrictamentelingsticarelativaa
laspalabrasqueformanlaemisin(supronunciacinysignifcado),losmorfemasyla
estructuragramaticalquesehautilizado;2)informacinsobreelcontextoenelquese
emiteestafrase;enelejemploprobablementesetratadeunasituacinrelacionadacon
lacomidaynoconunaclasedeyoga;3)informacinsobreelinterlocutor:siestefuera,
porejemplo,unniopequeo,nolepediramosquenosacercaralajarra,puesnopodra
1
SegnRAE,interfazesunaconexinfsicaofuncionalentredosaparatososistemasindependientes.
2
Eltrminoactodehablaindirectoserefereaemisioneslingsticasenlasquenohayunacorrespon-
denciaentreelsignifcadoliteral(loquesedicerealmente)yelpretendidoporelhablante.Sonactosdehabla
indirectostodaslaspeticionescorteses(medas...?,podrasacercarme...?,teimportaabrirlaventana?)y
lasquejasformuladascomopreguntas(noestmuyaltalamsica?),entreotras.
170 Bloque II. El desarrollo durante la primera infancia
hacerlo; 4) informacin sobre los usos del lenguaje, concretamente sobre qu tipo de
frmulasseutilizanparapedirdeformacortsenunalengua.
Esdecir,usarellenguajeencontextosrealesconstituyeunahabilidadcomplejaque
exigedistintostiposdeconocimientoquevanmsalldelosrelativosalapropiaestruc-
turadellenguaje.ComovimosenelCaptulo3,elcomponentepragmticodellenguaje
serelacionaconelusorealdesteencontextoeimplicaintegrarnecesariamentetodas
lasfuentesdeinformacinquehemosaludidoanteriormente.
Lasnumerosasinvestigacionesquesehanrealizadosobreeldesarrollodelashabili-
dadespragmticas(Bates,1976;Halliday,1975;OchsySchieffelin,1974;Snow,1986,
entremuchasotrasreferencias)muestranqueesuncomponentemuyligadoalashabili-
dadesdeinteraccinsocialyalasqueluegoconstituirnloquesehandenominadoha-
bilidades mentalistas o de teora de la mente (vase Captulo 5). En este sentido, los
orgenes de su proceso de adquisicin pueden rastrearse y encontrarse en los primeros
aos.A travs del uso del lenguaje con los otros, en las conversaciones y narraciones
cotidianas,losniosdesarrollanciertosmodelospragmticossobreellenguaje(Halliday,
1975)ydescubrenlasmltiplesfuncionesyusosaquepuedenservir.Estosmodelosson
muyvariadosysevanenriqueciendoytransformandoamedidaqueelniosedesarrolla
ycrecesuexperiencialingsticayconversacional.Elperodoqueahoraestudiamoses
unespaciotemporalprivilegiadoenrelacinconestasadquisiciones.Losniosamplan
enormemente los recursos para iniciar y mantener conversaciones con los otros, para
hacer peticiones y solicitudes, para expresar su rechazo por algo; es decir, para hacer
distintascosasconellenguaje.
Unadelasfuncionesprivilegiadasdellenguajecuyaimportanciatransciendeelpro-
pio desarrollo lingstico es la funcin narrativa. Comencemos sealando qu es una
narracin:
Lanarracinesuntipodediscursootextoquesecaracterizaporlapresen-
tacinocomentariodeacontecimientosquesedesarrollaneneltiempo.(Be-
linchn,RivireeIgoa,1992,p.630.)
Enelapartadoanterioryahemosapuntadolacomplejidadasociadaalaactividadde
narrar,ensucalidaddeinterfazentrelosdistintosnivelesdellenguaje:losmsformales
(lxicoygramatical)ylosmsligadosalafuncinyalainteraccin(semnticoyprag-
mtico).Desdeelpuntodevistalingstico,lacomplejidadligadaalaactividaddenarrar
serelacionaconlanecesidaddeconectarunasoracionesconotras,deevitarlaredundan-
cia,deestablecerrelacionesentrelainformacindadaylaquesevaintroduciendocomo
nueva, etc.Todas estas operaciones requieren de un dominio complejo de la forma del
lenguaje(porejemplo,usodeoracionessubordinadastemporalescomocuandolarana
salt,lamoscasalivolando)parapoderexpresarcorrectamentelossignifcadosqueel
hablantetieneintencindetransmitiryparahacerlodeformaordenadaycomprensible
paraeloyente.
Para numerosos autores (entre ellos, Bruner, 1991; Nelson, 1986, 1989, 1996) las
narracionesconstituyenungneroprivilegiadodediscursoporque:1)permitenintegrar
experienciaspresentes,pasadasyfuturas;2)permitencomunicarhistoriasrepresenta-
Captulo 6. El desarrollo del lenguaje oral 171
cionalmente complejas que implican personajes que actan movidos por intenciones u
objetivosencontextosconcretos;y3)permitentransmitirlaescaladevaloresdominante
en el grupo sociocultural. Este estatus privilegiado de las narraciones en la experiencia
humanaesresaltadotambinporotrosintelectualesajenosalquehacerpsicolgico.La
siguientecitaesilustrativaalrespecto:
Lanarrativa,sinembargo,sehallaenunaesferauntantodiferentedelasdems
artes.Sumedioesellenguaje,yellenguajeesalgoquecompartimosconlos
dems,comnatodosnosotros.Encuantoaprendemosahablar,empezamosa
sentir avidez por los relatos. Los que seamos capaces de rememorar nuestra
infancia recordaremos el ansia con que saborebamos el cuento que nos contaban en la
cama,elmomentoenquenuestropadre,onuestramadre,sesentabaenlapenumbrajunto
anosotrosconunlibroynosleauncuentodehadas.Losquesomospadresnotendremos
difcultadenevocarlaembelesadaatencinenlosojosdenuestroshijoscuandolesleamos
uncuento.Aqusedebeesefervientedeseodeescuchar?Loscuentosdehadassuelenser
crueles y violentos, describen decapitaciones, canibalismo, transformaciones grotescas y
encantamientos malfcos. Cualquiera pensara que esos elementos llenaran de espanto a
uncro;peroloqueelnioexperimentaatravsdeesoscuentosesprecisamenteunencuen-
trofortuitoconsuspropiosmiedosyangustiasinteriores,enunentornoenelqueestper-
fectamenteasalvoyprotegido.Taleslamagiadelosrelatos:puedentransportarnosalas
profundidadesdelinferno,peroenrealidadsoninofensivos.Noshacemosmayores,perono
cambiamos. Nos volvemos ms refnados, pero en el fondo seguimos siendo como cuando
ramos pequeos, criaturas que esperan ansiosamente que les cuenten otra historia, y la
siguiente,yotrams.(TomadodelDiscursodePaulAusterenlaceremoniaderecepcindelosPre-
miosPrncipedeAsturiasde2006.)
Losniosoyennarracionesdesdeprcticamentesunacimientoporque,deunmodo
uotro,elrelatoonarracindehistorias(personales,realesofcticias)constituyeunras-
gocaractersticodelavidasocialentodaslasculturas.As,yendoalterrenoevolutivoy
comonosrecuerdaBelinchn(2000),losnios:
Escuchanloscuentosinfantilesquelospadresylosadultosengenerallespresen-
tanconosinacompaamientogrfco.
Escuchanlashistoriaspersonalesquelosadultossecuentanentres.
Escuchanlashistoriasprotagonizadaspor(orelacionadascon)elpropionio.
Elaborancooperativamente,ensusconversacionesconlosadultos,narracionesde
loshechosenlosquehanparticipadooenlosquevanaparticipar.
Cuentan,encasayenlaescuela,loquehanhechooleshapasado,yloquequie-
renoplaneanhacer.
Losniosaprendenmuyprontoadiferenciarlosrelatosohistoriasdeotrasformas
deconversacin.Algunosdatoslongitudinales(Nelson,1989),incluso,revelanqueantes
delos2aos,losniosusanunmododevozespecialcuandoactancomonarradores.
Altenerquecontaraotrosexperienciasdelasquenohansidotestigos,comosucedea
partir de los 3 aos en el contexto escolar, deben seleccionar hechos supuestamente de
172 Bloque II. El desarrollo durante la primera infancia
intersparaelgrupo.Estaactividad,esencialparaeldesarrollodelascompetenciasna-
rrativas, constituye tambin un ejercicio de atribucin mentalista y nos remite a las
habilidadesdeteoradelamente(vanseCaptulos5y7).
Antesdelos3o4aoslosrelatosdelosniospuedenresultarextremadamentesim-
ples, pero progresivamente van incorporando dispositivos gramaticales especfcos que
sonesencialesparagarantizarlanarratividadycoherencialgico-temporaldeldis-
curso. En concreto, los nios aprenden a utilizar las marcas morfolgicas de tiempo y
aspectoverbales,losadverbiostemporalesparalocalizarcorrectamenteeneltiempolas
accionesquerelatan,trminosrelacionales,comodistintostiposdeconjunciones(copu-
lativas: y, ni; adversativas: pero, sin embargo; causales: porque, es que) y pronombres
personales para expresar la referencia a los personajes sin repetir siempre sus nombres
(l,este,nosotros...).Aunquetradicionalmentesehaconsideradoqueelaprendizajede
lagramticadelosdiscursosesposterioraldelagramticaoracional,actualmente
esmsplausiblesuponerqueambostiposdegramticasseadquierenyoperandurante
laetapainfantilcomodossistemasdeconocimientoplenamenteinterdependientes(Nel-
son,1996).
Adems,laactividaddecontarhistorias,sucesosoexperienciasalosotrosniosy
laelaboracincooperativadehistoriaspersonalesentreniosyadultos(padresoeduca-
dores)constituyeelfactorcrticoquehaceposibleapartirdelos3aoslaconstruccin
derecuerdospersonalesyeldesarrollodelamemoriaautobiogrfca.Enestesentido,
Bruner (1996/1997) plantea que la habilidad para construir y entender narraciones es
capitalparaconstruirnuestravidaysulugarenelmundo.Esteautorsubrayaunaidea
quenospareceespecialmenteinteresante:laconexinentrelaactividadnarrativadelos
sereshumanos,yadesdelainfancia,ysuimportanciaenlaconstruccindelaidentidad
personal.Lanarracinseraunmododepensamientoyunvehculoparalacreacinde
Figura 6.1. Los nios oyen narraciones de los adultos durante todo el desarrollo.
Captulo 6. El desarrollo del lenguaje oral 173
signifcados,propiosycompartidossocialmente.Yunodelosobjetivosdelaeducacin
deberasercrearunasensibilidadnarrativayfomentarlaalolargodeldesarrollo.Fi-
nalizaremosesteapartadoconlavozdeJ.Bruneratravsdelasiguientecita:
...unniodeberasaber,tenerunaideadelosmitos,lashistorias,loscuentos
populares, los relatos convencionales de su cultura (o culturas). Enmarcan y
nutrenlaidentidad.Elsegundosupuestocompartidoreclamaalaimaginacin
atravsdelafccin.Encontrarunlugarenelmundo,pormuchoqueimplique
lainmediatezdelacasa,elcolega,eltrabajoylosamigos,esenltimoextremounactode
imaginacin (...). Un sistema de educacin debe ayudar a los que crecen en una cultura a
encontrarunaidentidaddentrodeesacultura.Sinellasetropiezanensusesfuerzosporal-
canzarelsignifcado.Solamenteenunamodalidadnarrativapuedeunoconstruirunaiden-
tidadyencontrarunlugarenlaculturapropia.(Bruner,1996/1997,p.62.)
3. Las relaciones entre el pensamiento y el lenguaje
desde la perspectiva evolutiva
Hemosvistoquelanarracincomoformadediscursolingsticoconstituyeunvehculo
privilegiadoparaelestablecimientodeuntipoespecialdepensamientoo,mejor,deun
producto de l si se nos permite considerarlo as: el relacionado con la propia iden-
tidad.
Sinembargo,elproblemadelasrelacionesentreelpensamientoyellenguaje,taly
comoaparecienelcontextodelaPsicologaEvolutiva,noserefereexactamenteaesta
cuestin.
Larelacinentrepensamientoylenguajeesuntemaantiguo,quehapreocupado
histricamenteaflsofosypsiclogos,porquelascapacidadespararepresentarseyma-
nipularsimblicamentelarealidadyparacomunicarseconlosotrosconstituyenlasseas
de identidad del ser humano. Jean Piaget retom para la Psicologa del Desarrollo esta
cuestiny,posteriormente,Vygotskiofreciunaperspectivabiendistintaaladelautor
suizoparaanalizardichasrelaciones.
Piaget(1923/1983)descubriquetodoslosnios,apartirdelos3aosaproximada-
mente,hablabanenvozaltaparaellosmismosmientrasjugabanorealizabanalgntipo
deactividad.Noesdifcilobservaraniosdeesasedadesutilizandoestetipodelengua-
je no social en contextos ldicos, por ejemplo. Este autor llam a este tipo de habla
habla egocntrica y la describi con las caractersticas que aparecen en la Tabla 6.6.
(VansetambinlosCaptulos1y4.)
Tabla 6.6. Caractersticas del habla egocntrica segn Piaget
El habla egocntrica segn Piaget
1. Esuntipodehablaparaunomismo,sininterlocutor.
2. Acompaaalaaccindelnio.
3. Desaparececuandoelniosuperalafaseegocntrica.
174 Bloque II. El desarrollo durante la primera infancia
Segn Piaget el habla egocntrica no sera sino una manifestacin ms del tipo de
pensamientoegocntricopropiodelniopreescolar.Estainterpretacinescoherentecon
el modelo piagetiano general del desarrollo de la inteligencia (vase Captulo 1) en el
queellenguajeesunamanifestacinmsdelacapacidadsimblica,subordinadaadicho
desarrollo.EnestesentidosepuededecirquePiagetconcebaellenguajecomoproduc-
to del pensamiento. Planteado desde la perspectiva evolutiva, esto es coherente con el
hechodequeenlosniospequeosexisteactividadintelectualsinqueexistaanellen-
guaje(vaseCaptulo2).
Aestainterpretacinpiagetianalesiguiunosaosmstarde,en1934,lacrticade
Vygotski(1934/1973)quesupusounareinterpretacinclaramentedistintadelfenmeno
delhablaegocntrica.SegnVygotski,lautilizacindellenguajecomoacompaamien-
todelaaccin,lejosdeconstituirunindicadordelpensamientoegocntrico,constituye
unhitodecisivoeneldesarrollodelnio.Enrealidadrevelalaemergenciadeunanueva
funcin del lenguaje: la funcin de regulacin de las propias acciones.Vemoslo con
algomsdedetalle.ParaVygotski,adiferenciadePiaget,eldesarrollodellenguajeest
ligadosobretodoaldesarrollodelacomunicacin,ytiene,enprincipio,unorigendis-
tinto, no subordinado al del desarrollo del pensamiento o la inteligencia. Puesto que el
lenguajeesutilizadoporelniopequeodesdeelcomienzocomoinstrumentoparala
comunicacin,cuandonecesitautilizarloparaunanuevafuncin,lohacecomosabe:
envozalta.Portanto,loquesucedeentornoalos3aos,segnVygotski,esqueelnio
necesitaaadirunafuncinms,adquiridaenelplanointerpersonal,alasfuncionesco-
municativasyrepresentacionalesdellenguaje(vanseCaptulo1y4).Esafuncinest
ligadaaladireccinyregulacindelapropiaaccin.Medianteelhablaautodirigiday
centradaenlapropiaaccin,losniosquehastaentoncessloparticipabanenconversa-
cionesconlosotros,seconviertenalavezenemisoresyreceptoresdesuspropiasemi-
sioneslingsticas.Yusaneselenguajeprimeroparaacompaarsusaccionesyalgoms
tarde para anticiparse a ellas, planifcarlas, etc. En este sentido no se trata de lenguaje
egocntrico,sinodeuntipodelenguajequeacompaaalaaccinyalpensamiento.A
medida que avanza el desarrollo, el habla egocntrica se interiorizara, convirtindose
entoncesenpensamientoverbal,untipodelenguajeinteriorcomolodenominaSi-
gun(1986).
Vemosportanto,quelainterpretacinvygotskianadelfenmenodelhablaegocn-
tricaesabsolutamentecoherenteconsuleydedobleformacindelasfuncionespsico-
lgicas superiores; en este caso, la funcin reguladora del lenguaje como forma de
pensamientosurgeenuncontextointerpersonal(laconversacinconlosdems)yluego
setrasladaalplanointrapersonal(primeroenlenguajeegocntricoydespusenlengua-
jeinteriorizado).
Lacapacidaddelosniosdepensarverbalmente,planifcaraccionesfuturasyevaluar
lasaccionesyapasadas,tieneunaimportanciatrascendentaleneldesarrollopsicolgico
yevidentementeevolucionahastaelfnaldelciclovital.Losadultostambinutilizamos
estetipodehablainterioreincluso,enciertassituaciones,noshablamostambinenvoz
alta.Sinembargo,comoautoresmsrecienteshanpuestodemanifesto,puedeobservar-
se ya antes de la edad sealada por Piaget yVygotski, en los soliloquios que algunos
niosproducenocasionalmenteantesdedormir(Nelson,1989).Elanlisisdelosconte-
nidosyestructurasempleadosenlossoliloquiosporniosdeentre2y3aoshaconfr-
mado que sirven para rememorar y fantasear sobre experiencias cotidianas que, por lo
Captulo 6. El desarrollo del lenguaje oral 175
general,hansidonarradaspreviamenteporlospadresohansidoobjetodeconversa-
cionespreviasentrelosniosysuscuidadores.Deestemodo,apartedesuutilidadpara
el aprendizaje de dispositivos propiamente gramaticales (por ejemplo, conjunciones y
adverbios),lossoliloquiosconstituyenunaocasinmsdeentrenamiento,porpartede
losnios,enlaconstruccindelashabilidadesnarrativasalasquenosreferamosenel
apartadoanteriory,denuevo,alcomienzodeste.
4. Cmo se explica la adquisicin del lenguaje:
modelos lingsticos innatistas y explicaciones
constructivistas
Eldesarrollodellenguaje,comovimosenelCaptulo3ycomohemosretomadoenlos
apartadosanterioresdeestecaptulo,esunodelosprocesosevolutivoscentralesenrela-
cinaldesarrollohumano.Ellenguajetienecomofuncinbsicalacomunicacin,pero
es adems un medio fundamental para la representacin del conocimiento sobre el
mundoysobreunomismoyparalaregulacindelapropiaconducta.Poresoelinte-
rsporexplicarcmoesposiblesuadquisicin,porconocerqumecanismosdeapren-
dizajerequiereyporcomprenderporquseadquierecontalnaturalidadyfacilidada
pesar de ser una competencia tan compleja son cuestiones que han estado presentes
desdemuchoantesdequelaPsicologaexistiesecomocienciaindependiente.
El volumen de propuestas y publicaciones sobre el tema es inmenso. Nosotros nos
vamosalimitaraacercarallectoradostiposderespuestasparadigmticasalproblema
delaadquisicindellenguaje:lasrespuestasdetipoinnatista,delamanodelinfuyente
lingistaNoamChomsky,ylaspropuestasconstructivistasactuales,entrelasqueselec-
cionaremosladeKarmiloff-Smith,unaaventajada(ycrtica)alumnadePiaget.Estosdos
tiposderespuestasconstituyennoslopropuestasalternativasalproblemaconcretodel
aprendizaje del lenguaje, sino que dejan entrever dos modos bien distintos de concebir
cmoseorganizayconstituyelamentehumana.
EllingistaN.Chomsky(1959)realizunacrticademoledoraaSkinner,unpsic-
logo conductista que conceba en los aos cincuenta el lenguaje como conducta verbal
quepodaaprendersedelmismomodoquecualquierotraconductahumana,pormedio
delreforzamiento.
LaaportacingenialdeChomskyconsistiensituarellenguajeenelplanocogniti-
voyplantearqueelrasgofundamentaldelaactividadlingsticaerasucreatividad,
enelsiguientesentido:ellenguajeconstituyeuntipodecompetencia(untipodecono-
cimiento)quepermitegenerarinfnidaddeoracionesdistintasapartirdeunconjuntode
reglas relativamente pequeo. Evidentemente, Chomsky centra su caracterizacin del
lenguajeentornoalconocimientogramaticalquepareceserelmsdifcildeexplicary
comprender.Enestesentido,esciertoquelosaprendicesdecualquierlenguaestnex-
puestosaunconjuntorelativamentelimitadodefrasesymuestrasdehabla(lasquees-
cuchayledirigensusinterlocutoresensusinteraccionescotidianas)y,sinembargo,una
vezadquiridoellenguajeunopuedeproducirunconjuntodefrasesinfnitas,frasesque
no se han escuchado jams. Las preguntas que se hizo Chomsky son las siguientes:
cmoesposibleexplicarestepotencial?,cmoesposiblegeneraresasoracionesinf-
176 Bloque II. El desarrollo durante la primera infancia
nitas a partir de la experiencia lingstica, un conjunto de emisiones (las de los otros)
relativamentepequeoopobre?Vistaas,latareadeadquirirunalenguallevaaChoms-
ky(1959)aplantearlacuestinenlossiguientestrminos:
Elestudiodelahabilidadobservadaenunhablanteparecequenosfuerza
alaconclusindequeestagramticaesdeuncarcterextremadamentecom-
plejoyabstracto,yqueelniopequeohalogradollevaracaboconxitolo
que,desdeunpuntodevistaformalporlomenos,pareceuntipodeconstruc-
cintericamuycomplicado(p.27).
La nica solucin que encuentra Chomsky para explicar la adquisicin del conoci-
mientogramaticalporpartedelosniosessuponerquetienequehaberunconocimien-
toinnato,unaespeciedefacultadparaellenguajequevendradealgnmodoyainscri-
taenelbagajegenticodelaespeciehumana.Chomskydenomingramticauniversal
a esta capacidad humana intrnseca. Esta gramtica incluye un conjunto de principios
abstractosrelacionadosconelfuncionamientodellenguajequeserancomunesatodas
laslenguas.Graciasalagramticauniversal,unavezquelosniosseenfrentanalaex-
periencialingstica,esdecir,entranencontactoconsulenguamaterna,sabrancmo
organizar la informacin y no tendran que depender nicamente del aprendizaje para
extraerelconocimientogramatical.Evidentementeelaprendizajeesnecesario;laslen-
guassondistintasenrelacinasufonologaysuvocabulario.PeroChomskyconsidera
queesosprincipiosuniversalesrelacionadosconloqueescomndesdeunpuntode
vistaestructural,gramaticalatodaslaslenguasdelmundosonimprescindibles.Dicho
conocimiento comn o gramtica universal sera la llave que permitira a los nios pe-
queosabrirlapuertaaunaprendizajetancomplejocomoelgramatical.Enpalabrasde
Aguirre(2001)losprincipios...sonalgoqueelnionotienequeaprender,unaespecie
deregalodelanaturalezaquehaceposiblelaadquisicindelconocimientogramatical
(p.23).
Algunosautores,seguidoresdelastesisgeneralesdeChomsky,utilizanexpresiones
como el instinto del lenguaje (Pinker, 1989) o nacer sabiendo (Mehler y Dupoux,
1990/1992), llevando al extremo la posicin innatista en sentido fuerte que el lingista
introdujoenelpanoramadelapsicologacognitiva.
Lapropiateorachomskyanahaexperimentadodiversoscambiosdesdesuformula-
cinoriginalafnalesdelosaoscincuenta,perosemantienenlospostuladosprincipales
quedeformageneralhemosintroducidoanteriormente.Y,sobretodo,laideadequela
facultad de lenguaje constituye una capacidad innata e independiente de la inteligencia
general.Veamosahoraunaexplicacinconstructivista,contrapuestaalachomskyana,de
lamanodeA.Karmiloff-Smith.
Karmiloff-Smithesunainvestigadorabritnica,formadaenGinebrajuntoaPiaget
ysuescuela.Estaautoraadoptunaposturarelativamentecrticaalapiagetianasobre
elpapeldellenguajeeneldesarrollodelnio.Porunaparte,asumelospostuladoscons-
tructivistas generales de la teora de Piaget, pero por otra parte considera que el autor
ginebrinonosituensujustolugarellenguajerespectoaldesarrollocognitivogeneral.
Karmiloff-Smith lleg a plantear que el lenguaje constitua una tarea o problema de
desarrolloporsmismo(aproblem-spaceperse)(Karmiloff-Smith,1979).ParaPia-
Captulo 6. El desarrollo del lenguaje oral 177
get y sus seguidores, la adquisicin del lenguaje requiere los mismos mecanismos ge-
neralesdeaprendizajequeutilizanlosniosparaaprendersobrecualquiercosa,sobre
cualquierdominiodeconocimiento:sobreconceptosfsicos,numricos,sobreelespa-
cio,sobrelasconvencionessociales,etc.Karmiloff-Smithseopusoaesteplanteamien-
to,peroalaveznoestabadeacuerdoconaquellasotrasposturascomolasderivadas
delmodelochomskyanoqueconsideranqueellenguajeconstituyeundominioabso-
lutamente especfco de conocimiento y adquisicin. En realidad, esta autora propone
un modelo de desarrollo (Karmiloff-Smith, 1992/1994), no slo respecto al lenguaje
aunque aqu nos ceiremos a l, sino respecto al desarrollo cognitivo general del
nio, que trata de superar la anttesis entre racionalismo-innatismo y constructivismo
generallaPiaget(vaseCaptulo1).Dichomodelorecogelosnumerososhallazgos
sobrelashabilidadestempranasdeprocesamientodellenguajequeyaexhibenlosbebs
desde el inicio de su desarrollo (recurdese lo expuesto en el Captulo 3). La sntesis
que propone la autora se resume muy bien en sus propias palabras en un libro re-
ciente:
...ellenguajees,enefecto,especial,perocomohiptesiscreemosquelasolu-
cindelaevolucinnohaconsistidoenpreinstalarunasrepresentacioneslin-
gsticascomplejasenlamentedelneonato.Creemos,encambio,quelaevo-
lucinhaaportadodoscosasinteresantes.Enprimerlugar,hahechoqueenlos
humanoselperododedesarrollocerebralpostnatalseaextremadamenteamplio,demanera
que las infuencias ambientales puedan confgurar la estructura del cerebro en desarrollo.
Sinembargo,desdenuestropuntodevistaelcerebronoesunatablillablancahomognea,
comodiranlosconductistas.Nuestrosegundoargumentoesquelaevolucinnoshaequi-
padoconunaseriedemecanismosdeaprendizajeque,aunquenoseanespecfcosdedomi-
nio,sonloquellamaramosrelevantesparaeldominio.(...)enelnacimiento(yantes)elnio
poseeunaspredisposicionesmnimasquelehacenprestarparticularatencinaciertaspar-
tesdelmedio,como,porejemplo,rostrosyvoces.Desdeelprincipio,diferentesmecanismos
cerebralesestarnmssintonizadosparaprocesaruntipodeentradasqueotro.Portanto,
unmecanismoqueessensibleaentradassucesivasyquesedesvanecenconrapidezpuede
prestarespecialatencinallenguajeoralodesignos...yamedidaqueseespecializacada
vezmsenelprocesamientodellenguaje,estarmsdedicadoaesedominioespecfco.Por
esoenlaedadadultaacabamosconesasreasdelcerebroespecializadasenellenguaje.En
otras palabras, el cerebro infantil no empieza con unos circuitos dedicados en exclusiva a
procesarellenguaje,sinoqueacabaconunoscircuitosespecializadosenfuncindelaex-
periencia.(KarmiloffyKarmiloff-Smith,2005,pp.20-21.)
Lacitaanteriorrecogemuybienlaoposicindelasautorasalaexistenciadecono-
cimientoorepresentacionesinnatassobreellenguajequeestuvieranyapreinstaladas
en la mente del recin nacido. Por otra parte, cuestionan tambin la idea de que haya
mecanismos de procesamiento especfcamente destinados al aprendizaje del lenguaje.
Frenteaambasideas,lasolucinqueseplanteaseraasumirqueelconocimientodel
lenguajeeselproductocomplejodelainteraccinentreunaspredisposicionesiniciales
(vaseCaptulo3,Epgrafes3.1y3.2)ylapropiaexperienciaconlalenguaenlaquese
ven inmersos los bebs desde su nacimiento en cualquier lugar del mundo. De alguna
178 Bloque II. El desarrollo durante la primera infancia
maneralanaturalezagarantizaqueelbebhumano,frenteaotrascrasanimales,atienda
desdemuytempranamentealassealeslingsticas;estaatencinconstituyeelprimer
escalndelprocesodeaprendizaje.Sisegarantizalaatencin,lainformacinlingstica
secomenzaraprocesar,aanalizar,aalmacenaryprogresivamenteseconstituirenun
dominio de conocimiento especfco. Pero esa especifcidad de dominio ser en ltima
instanciaunaconstruccin,frutodeunlargoprocesodeaprendizaje,desdeelfetohasta
laadolescenciaalmenos,ynoalgodadoyadesdeelinicio.
Laconcepcingeneral,constructivistaperomatizada,deKarmiloff-Smithconstituye
unasntesisdenumerosascontribucionesdeinvestigadoresactualesquetrabajandefor-
maintensivasobreelprocesodeadquisicindellenguaje.Paratodoselloslaideadela
gramtica universal chomskyana est muy desencaminada. Si la especie humana tiene
algndonespecialrelacionadoconellenguaje,estenoconsisteendichagramticaen
s,sinoenlacapacidadparaaprenderla.
5. Aprender el lenguaje en contextos bilinges
Hasta ahora nos hemos estado refriendo a la adquisicin y desarrollo del lenguaje en
contextosmonolinges,esdecir,enelcasodeniosqueaprendenunanicalenguaen
la infancia. Sin embargo, desde siempre y de forma muy evidente en la actualidad, el
fenmeno del bilingismo y del multilingismo existen. Por numerosas circunstancias
familiares,sociales,econmicas,etc.,haymuchaspersonasquedesdepequeosseven
abocadosaaprendermsdeunalengua.Dichoaprendizajepresentaunasparticularidades
interesantesymltiplesvariacionesdeunosindividuosaotros.
Enesteapartadonosvamosadetenerbrevementeenlosprocesosdeaprendizajedel
lenguaje en contextos bilinges. Sealaremos algunas caractersticas de los mismos y
fnalizaremos con algunas consideraciones sobre las ventajas del bilingismo y las
circunstanciasenlasquedichacondicin,ladeserbilinge,constituyeunenriquecimien-
todeldesarrollopsicolgicogeneral.Comencemosplanteandoalgunassituaciones,como
lasqueserefejanenelTabla6.7queconducenalbilingismo:
Tabla 6.7. Situaciones bilinges
Ejemplos
Caso1:JohnyMarasonunaparejadeprocedenciainglesayespaolarespectivamente,conresidencia
enMadrid.Tienenunbebydecidendirigirsealpequeocadaunoenunalengua.Suintencinesqueel
niollegueaserbilingeyhanpensadollevarleauncolegiobilinge(espaol/ingls).
Caso 2: Ibrahim es un nio de 5 aos, hijo de una familia procedente del Magreb. Sus padres siempre
hablanconelnioenundialectodelrabe.IbrahimvaauncolegioenEspaadesdelosdosaos.Habla
dichodialectodelrabeyespaol.Estempezandoaleeryescribirenestaltimalengua.
Caso 3: Julia es una nia de 1 ao, nacida en Espaa de padre espaol y madre alemana. Su madre le
hablaenalemncuandoestnencasa;supadresedirigeaellaenespaol.Lospadreshablanentresen
alemn,aveces;otrasvecesencastellano.LaparejahadecididoquelaniavayaaunaEscuelaInfantil
pblicadesuciudadyluegoirauncolegiomonolingedeespaol.Piensanviajardevezencuandoa
Alemaniaypasaralgunatemporadaestivalall,juntoalafamiliamaterna.
Captulo 6. El desarrollo del lenguaje oral 179
Sialgotienenencomnlasanterioressituacionesesquelosniosprotagonistases-
tninmersosenunprocesodeadquisicindemsdeunalengua.Sinembargo,lascon-
dicionesdeunosyotrossondistintas,yprobablementelosresultadosdesusprocesosde
aprendizajelingsticoypersonaltambinlosern.
Esmuydifcil,comoatestigualainmensabibliografasobreeltema,darunadefni-
cindebilingismoenlaqueestndeacuerdolosdistintosautores.Sigun(1998)de-
nomina bilinge al individuo que posee dos sistemas lingsticos y que es capaz de
utilizarlos en cualquier circunstancia con una facilidad y efcacia semejantes (p. 72).
Ahorabien,comoelpropioSigunreconoce,elbilingeperfectonoexiste,einclusola
defnicinanteriorhabraqueentenderlacomounadefnicindelbilingismoidealque
slosirveenlamedidaenqueseleacercaunindividuoconcreto.Evidentementenote-
nemosdosvidas;unapersonabilingeseleccionaloscontextosenqueutilizaunayotra
lengua.Porejemplo,unniopuedehablarunalenguaencasa,perootraenlaescuela;
de este modo su mundo afectivo familiar, el ms prximo, estar impregnado por una
lengua,peronoporlaotra.Aunqueconeltiempoaprendaatraducirdeunalenguaala
otra,elmanejodeambasnosernuncaidnticoentodossusdetalles.
Lo que sin embargo no se debe confundir con el concepto de bilingismo es el de
aprendizajedeunasegundalengua.Unprofesorqueescapazdeleereninglslabiblio-
grafarelacionadaconsutrabajoeinclusoquelohablaenciertoscontextosprofesionales
nosepuedeconsiderarbilinge.VolviendodenuevoaSigun(1998)quizlacaracte-
rsticasmstpicadelbilingeesquehainteriorizadolasegundolenguayes,portanto,
capazdepensarenunauotrasegnlascircunstancias(p.72).
Endefnitiva,unapersonabilingeesaquellaqueporlascircunstanciasqueseaha
necesitado aprender a utilizar dos lenguas; el verbo necesitar es importante en esta
defnicin. Evidentemente la defnicin de bilingismo se puede hacer extensiva a ms
deunalengua;entonceshablaramosdemultilingismo,unacondicinbastanteextendi-
daenmuchosdelosllamadospasespobresdelmundo(muchospasesafricanos,la
India,etc.).
Perocentrndonosenelprocesomismodeadquisicindemsdeunalengua,cules
sonlasetapasofasesdeldesarrollolingsticoenlosniosbilinges?Sepodrapensar
queelnioquedesdesunacimientoestexpuestoadoslenguasdistintas(porejemplo:
espaolyrabe)tieneunadobletarea.Esdecir,tienequeaprenderdossistemasdeso-
nidosdiferentes,dosvocabulariosdistintos,dosconjuntosdereglasgramaticales(mor-
fosintcticas)ydosformasdeusarellenguajedeformaapropiadaalosdistintoscontex-
tos.Yesto,sinentrareneltemadelalecto-escrituraylashabilidadeslingsticastpicas
delcontextoescolar.
Asumirqueaprenderdoslenguas,lenguaAyB,esdosvecesmsdifcilqueapren-
derslouna(lenguaAoB),equivaleasuponerquecadaniocuentaconunacapacidad
determinadaylimitadaparaellenguaje.Siguiendoestalgica,siesacapacidadlaocu-
pamosconlasdoslenguasenvezdeconuna,entonceseltrabajoserdifcilycompli-
cado,einclusohabrproblemas.Haymultituddecasosconocidosybiendocumentados
deniosquehanadquiridodos(oinclusoms)lenguasalavezporquesuspadrestenan
lenguasdistintas.Estosniosnotienenproblemasnicognitivosnilingsticos.Hanad-
quirido las dos lenguas de forma natural y fuida, aunque, evidentemente su desarrollo
lingstico tiene caractersticas peculiares. La Tabla 6.8 sintetiza las principales fases
caractersticasdeestedesarrollo.
180 Bloque II. El desarrollo durante la primera infancia
Tabla 6.8. Principales fases del desarrollo lingstico bilinge
Procesos fonolgicos, lxicos y gramaticales
Procesosfonolgicos.Losniosexpuestosadoslenguasdesdemuytempranamente,sobretodosison
lenguasconentonacionesmuydiferentes,distinguenydiscriminanambasdesdemuypequeos.
Laexperienciaconmsdeunalenguafavoreceladiscriminacinperceptiva;noladifculta
Procesoslxicos.Alprincipiodeldesarrollodellenguaje,elnioslotieneunsistemadevocabulario
(lxico);esdecir,conocepalabrasenlosdosidiomasalosqueestexpuesto,perotiendeaevitarequi-
valentesdetraduccin,palabrasoexpresionesque,encadaunadelaslenguasalasqueestexpuesto,
sereferenalomismo.Unequivalentedetraduccindeunapalabraenunalenguavendraaserlapa-
labraoexpresinsinnimaenlaotralengua;elequivalentedelapalabracasaeninglseshouse,
yelequivalentedelsaludoenespaolqutal?,es,eningls,howisitgoing?.Enunasegunda
etapa de la adquisicin del vocabulario, el nio empieza a construir un sistema de equivalentes para
palabrasqueyallevausandountiempoencadalengua.Yasabequeunamismacosa,objetoosituacin
tienenombresdistintosencadalengua.Sinembargo,apesardelaevolucinqueseobservaenlase-
gundaetapadelaadquisicinlxica,duranteelprocesoseobservanavecesmezclasdelosdosidio-
mas.Estoocurreporquelaspalabrasnoseadquierennecesariamentealmismotiempoenlosdosidio-
mas. El nio puede haber aprendido la palabra elefante en el colegio, pero an no ha hablado de
elefantesconsuspadres,quehablan,porejemplo,ruso.Esenestassituacionescuandoelnioutiliza
enunamismafrasepalabrasdeambaslenguas.Veamosunejemplo:
Mishaesunniode2aosyochomeses,depadresrusosquevivenenEspaa.Unda,unamigo
desuspadresleregalauncuentodeanimales.Elniocorrehaciasumadreysealandoalcuento
dice:Smatrmma,etajigafa.Laprimerapartedelafraseladiceenruso(smatrmma,eta=
mira,mamestoes...)ylasegundaenespaol(jigafa=jirafa).Silamadre,enestecontexto,dice
lapalabrarusaparajirafa,entoncesesprobablequeelniolaaprendayestasituacinnosuce-
dadenuevo.
Procesosgramaticales.Silaexposicinylaprcticaenlasdoslenguasesequilibrada,seobservaquelos
niossiguenuncursodeaprendizajegramaticalsemejantealdelosniosmonolingesdecadaunade
laslenguasqueestaprendiendoelniobilinge.Losniosbilingessevandandocuentatraselpero-
doinicialdeadquisicin,dequealgunasreglasmorfolgicasosintcticaspertenecenenexclusivaauna
uotralenguaydebenpermanecerseparadas.Secompruebaestafaseenlascorreccionesquelosniosse
hacenespontneamente.Porejemplo,sidicenunafraseenunalengua,peroconlaestructuradelaotra,
sedancuentaysecorrigen.Esteperododediferenciacincontinadurantetodoeldesarrollolingstico.
Losprocesosrecogidosenlatablaanteriorsonprocesosgenerales.Sinembargo,si
algocaracterizalaadquisicinbilingeeslavariabilidad,pueslassituacionesdeapren-
dizajesonmltiplesysedanencontextosmuydistintos.Porejemplo,noeslomismo
aprenderdoslenguasalavez(bilingismosimultneo)queaprenderlasdeformasuce-
siva(bilingismosucesivo).Sinembargo,sielnioesanpequeoytieneuncontacto
sufcienteymotivanteconlasegundalengua,llegaradominarlayutilizarlaenloscon-
textosquelorequieran.Estacuestinnosllevaaunaspectomuyconocidoenelcampo
delaadquisicindellenguaje,queabordamosenelsiguientesubapartado.
5.1. La importancia de los perodos crticos: por qu es mejor
aprender las lenguas desde pequeos?
Comencemosporladefnicindeperodocrtico.Estetrminoseacuparareferirse
al perodo de tiempo, limitado, establecido por la naturaleza en el que los mecanismos
para la adquisicin de una determinada habilidad estn activos. Si bien surgi en un
Captulo 6. El desarrollo del lenguaje oral 181
contextodistintoaldeldesarrollodellenguaje(PrezPereira,1995:p.228),enseguida
seaplictambinaestedominioevolutivo(Lenneberg,1967).Aunquehaydiscusiones
sobresuextensin,tradicionalmentesehasupuestoqueabarcadesdeelnacimientohas-
ta los 12 aos. Hasta los tres o cuatro aos se supone que el nio est en condiciones
especialmentebuenasparalaadquisicindellenguaje.Desdelostresocuatroaoshas-
talaadolescencia,lasposibilidadesdeaprendizajesiguensiendofavorables.Despusel
cerebropareceestarmenospreparadoparaadquirirelconocimientoyusodellenguaje.
Eltemadelosperodoscrticosestsiendomuydiscutidohoy.Sinembargo,seacep-
tademodogeneralque:
Losniosadquierenellenguajedeformamsfcilyefcazquelosadultos.
Losprimerosaosdevidasonespecialmenteapropiadosparalaadquisicindelas
lenguas por varias razones: razones biolgicas (de funcionamiento y plasticidad
cerebral), razones ambientales (las condiciones de interaccin comunicativa pro-
pias de esa etapa del desarrollo favorecen la adquisicin), razones cognitivas y
perceptivas.
En conexin con estas ideas, se suele hablar hoy de perodo sensible, en lugar de
perodocrtico,dejandolapuertaabiertaaunamayorfexibilidadyplasticidadenrela-
cinalasposibilidadesdelaprendizaje.Encualquiercasopareceaprioriqueserbilinge
esunacondicinventajosaparalosindividuosquelaostentan.Desdeunpuntodevista
estrictamentelingsticoparecequeconocermsdeunalenguaesmejorquereducirsea
la condicin monolinge. Ms all de la simplicidad de este argumento es importante
resaltar una vez ms que el proceso de aprendizaje del lenguaje no es un dominio de
desarrolloaisladodelosdems.Elaprendizajedeunalenguatienelugarenuncontexto
socialycultural,ylasfuncionesdellenguajesonmltiples,entreellaslasdeayudara
constituirlapropiaidentidadpersonal.Abordaremosestetemaenelsiguienteapartado.
5.2. Ventajas del bilingismo: en qu condiciones
tiene consecuencias positivas para el desarrollo general?
Comenzaremosesteapartadosintetizandoalgunasdelascondicionesgeneralesquecon-
tribuyenaquelacondicinbilingeseconstituyaenventajosaparaeldesarrollopsico-
lgicodelnio(vaseTabla6.9).
Sisedanestascondiciones,lomsprobableesquelasituacinbilingeconllevelas
siguientesventajas:1)lamsevidenteeslaadquisicindealmenosunalenguamsde
locomnenlapoblacingeneral,conlasventajassocialesyprofesionalesfuturasaso-
ciadas;2)losniosbilingessonmsconscientesdelaspropiedadesdelalengua,pueden
refexionar (y de hecho lo hacen) sobre el lenguaje como sistema de smbolos, y estas
habilidadesfavorecenypreparanparaelaprendizajedelalecto-escriturayotrosapren-
dizajesabstractos;y3)losniosbilingesestnmssensibilizadosymotivadoshaciala
diversidadlingsticaycultural,locualaadeuncomponentedefexibilidadasudesa-
rrollointelectual.Adems,alaprendernuevaslenguasjugarnconventaja.
DelaTabla6.9sededucelaimportanciadelosfactoresexternos;esdecir,sisega-
rantizanunascondicionesfamiliaresysocio-afectivasadecuadas,elnionoparecetener
difcultadesinsalvablesparaadquirirmsdeunalengua.Dehecholosniosquecrecen
182 Bloque II. El desarrollo durante la primera infancia
endichascircunstanciasfavorableslogranunmanejoadecuadodelaslenguasyconsiguen
gradosdeidentifcacinaceptablesconlasculturasycontextosenquedichaslenguasse
hablan. Sin embargo, esto no siempre es as. Para cualquier educador (educador social,
profesor,pedagogo,psiclogo)conocerlassituacionesenlasqueunniotendrdifculta-
desderivadasdesucondicinbilinge/biculturalesespecialmenterelevante,puespermi-
tepensarenestrategiaspreventivasoenactuacioneseducativasdirigidasacompensarlas.
Hay un caso concreto de bilingismo que merece un comentario independiente por
laproblemticaquesuscita.Setratadeloshablantesdelenguasminoritarias,especial-
menteaquellosquepertenecenagrupossocialesmarginadosocuyaculturaespocovalo-
rada.EnEspaatienenproblemasescolaresloshijosdeinmigrantesmagrebesyproce-
dentesdealgunospasesdelllamadotercermundo,loshijosdepersonasprocedentes
deEuropadelEste,etc.LaTabla6.10recogelacomparacinentredossituacionesbien
distintasqueocurrenenlarealidaddenuestropas.
Tabla 6.10. Comparacin entre dos situaciones bilinges que conducen a resultados distintos.
[L1 = primera lengua; L2 = segunda lengua]
Alumno perteneciente
a la mayora lingstica (espaol)
Alumno perteneciente a la minora
lingstica (por ejemplo, marroqu)
AprenderunaL2leenriquecer.
Gruposocioeconmicomedio(lamayora).
Elprogramaescolarrefejaelsistemadevalores
desugrupo.
Elespaoleslalenguadominante.Tienepresti-
gioyapoyoinstitucional.
Elaprendizajedelespaolestgarantizado.
Elniodesarrollasuidentidadculturalnativa.
Aprender espaol es imprescindible para su
adaptacin.
Gruposocioeconmico,generalmente,bajo.
Su sistema de valores es ignorado o poco reco-
nocido.
Sulenguamaterna(L1)estdesvalorizadaenla
sociedad,sinapoyoinstitucional.
Su L1 se pierde con frecuencia o queda restrin-
gidaalentornofamiliar.
Se rechaza frecuentemente la cultura de origen
sinasimilarsetotalmentealadelamayora.
Alaconvivenciaentredoslenguasenrelacindedesigualdadseledenominadisglo-
sia,mientrasquealassituacionesdeinadaptacin,tantoalaculturadeorigen,comoa
Tabla 6.9. Condiciones en las que el bilingismo tiene consecuencias positivas
para el de sarrollo
Cundo es positivo el bilingismo?
1. Cuandoselograunniveldeconocimientosufcienteenlasdoslenguasporquesehatenidoelcon-
tactoeinteraccinadecuadosconcadauna.
2. Enelcasodeniosqueaprendenlasegundalenguaenelcolegio,esnecesariounbuendesarrollode
lalenguamaterna(L1).
3. Antecedentesfamiliaresfavorables(culturales,afectivos,sociales)favorecenunabuenaimplantacin
delbilingismoysusconsecuenciaspositivas.
4. Buenprestigiosocialdelasdoslenguas.Cuandoestasituacinnoseda,sepuedenaplicarestrategias
quesirvanparacompensarestasituacin,atravsdeprogramasescolares,sociales,etc.
5. Ysobretodo,actitudesyexpectativaspositivasdepadres,profesores,educadoresenrelacinaldesa-
rrollodelnio.
Captulo 6. El desarrollo del lenguaje oral 183
lanuevacultura,seledenominaanoma.Elobjetivodeunprogramaeducativo,enestos
casos,debeserelbilingismoeldominiodelasdoslenguasporigualylaintegra-
cinaceptacindelaculturapropiayadaptacinalaculturamayoritaria.
Veamos, por su relevancia prctica, un ejemplo en el que se pone de manifesto la
necesidaddesersensiblealosretosqueplantealaintegracinyelbilingismo:
Empieza un nuevo curso. En una clase de nios de 5 aos, la maestra pide a los nios
que dibujen una familia. Todos los nios se ponen a la tarea, menos Acharad, un nio
marroqu que viene por primera vez al colegio. La maestra se da cuenta, se sienta junto
a l y le explica lo que tiene que hacer con la ayuda de lminas, dibujos, etc. Ya entien-
de algo de espaol, pues lleg a Espaa con 4 aos. El nio de repente comprende,
sonre y se pone a hacer la tarea. Los dems nios van terminando y entregan sus di-
bujos a la profesora. Acharad sigue dibujando y pide otra hoja. Los dems nios le
miran y van a contarle a la maestra que Acharad ha dibujado a muchos padres y ma-
dres. La maestra se acerca y le dice:
No, Acharad, no hace falta que dibujes a todos tus parientes, slo a tu familia, a
los que viven contigo.
Acharad mira a la profesora sorprendido. La maestra cree que no ha comprendido
y dibuja una casa con una mam, un pap y dos nios.
Ves? Slo tienes que dibujar a la familia que vive contigo...
Pero el nio sigue sin comprender, porque l vive con su madre, el hermano mayor
de su madre (que hace de cabeza de familia) con su mujer y dos hijos, el hermano
pequeo de la madre, que es el que sabe ms espaol y va a hablar a veces con la
directora del colegio (la maestra cree que es el padre del nio) y la hermana pequea
del propio Acharad. El padre del nio slo viene a veces porque est trabajando en
Francia.
CON LOS PIES
EN LA TIERRA
Los retos de la integracin y el bilingismo:
un caso real
El ejemplo sirve para subrayar la idea de la importancia que tiene para el autocon-
ceptodeestosniosquelosmaestrosyeducadorescompruebenqusignifcansusmen-
sajesparaellos.Encasoscomoeldelejemplosucedeademsquelasfamiliasnoconsi-
guen mantener la lengua materna, la minoritaria, y sus hijos acaban por perderla. La
Tabla6.11resumealgunasdelasprincipalescausasdeestaprdida.
Anteestassituacionesyparaevitarquesedesarrolleunbilingismoincompletoy/ouna
faltadeidentifcacinconlaculturafamiliar,sepodranproponerlassiguientesmedidas:
Proporcionaralosniosunaescolarizacinquecontineeldesarrollodesulengua
materna(L1)yquecontribuyaavalorarsupropiacultura;conelloestaremospro-
mocionadoeldesarrollodeunautoconceptopositivo,conlasconsecuenciastanto
sociales,comocognitivasyemocionalesquesederivandeste.
Parallegaraserverdaderamentebilingesehadepoderhablar,comprender,leer
yescribirenlasdoslenguas.Enelcasodelenguasminoritariasnosiempreseal-
canzanestasmetas.Esfrecuenteencontrarniosyadolescentesquesonanalfabe-
184 Bloque II. El desarrollo durante la primera infancia
tos(noleenniescriben)ensulenguamaterna.Evidentemente,estasituacincon-
tribuye a desvalorizar la lengua propia. La escuela y la familia han de ser
conscientesdeestasituacinytratardedarsolucinalamisma.
Tabla 6.11. Condiciones en las que el bilingismo no se mantiene.
Cundo se pierde el bilingismo?
Hayvariasrazones.Esimportantequeeleducadoromaestrodelniolasconozcaylascomparta,sies
necesario,conlospadres:
Lospadresdebensaberquenosellegaaserbilingesloporquesehableunalenguaencasayotraen
elcolegioyenlacalle.
Silospadressesientenavergonzadosdesuorigenculturalpuedequenomotivenalnioparaquede-
sarrollelashabilidadeslingsticasencasa.
Otrasveces,lospadresaprendenprontolalenguamayoritariaycreenqueesmejorhablarenesteidio-
maconsushijos.
Lalenguaseaprendeconlacomunicacin.Lospadresdebenpasartiempoconsushijos,disfrutarcon
ellos,hablardecosasquelesinteresenmutuamente;endefnitiva,debenusaryhacerusarsulenguaal
nioencontextoscomunicativosreales.
Noesfcilmantenerunalenguaminoritariaenunacomunidadenlaquesehablaotralengua(lama-
yoritaria). Tanto los padres como el nio han de poner mucho de su parte. Pero... el resultado puede
compensarestosesfuerzosconcreces.
Conestasmedidasdecarctergeneralterminamosesteapartado,resaltandounavez
ms la enorme amplitud que tiene el tema del bilingismo y sus consecuencias para el
desarrollogeneraldelosnios.
Lecturas complementarias
Aguirre,C.yMariscal,S.(2001).Cmoadquierenlosnioslagramticadesulengua.Perspec-
tivastericas.Madrid:EdicionesUNED.
Halliday, M.A. K. (1982). Exploraciones sobre las funciones del lenguaje. Barcelona: Editorial
MdicayTcnica.
Karmiloff,K.yKarmiloff-Smith,A.(2005).Haciaellenguaje.Madrid:EdicionesMorata.
SnchezLpez,M.P.yRodrguezdeTembleque,R.Elbilingismo:Basesparalaintervencin
psicolgica.Madrid:Sntesis.
Sol,R.(2000).Eldesarrollodelapragmtica.EnSerra,M.,Serrat,E.,Sol,R.,Bel,A.yApa-
rici,M.Laadquisicindellenguaje.Captulo8.Barcelona:ArielPsicologa.
Captulo 6. El desarrollo del lenguaje oral 185
Actividades
1. Conteste a las siguientes preguntas
Considere la siguiente produccin de un nio de 4 aos: este juguete est doto. En
ella se observa el siguiente fenmeno:
a) Un error sintctico que afecta al verbo producido por el nio.
b) Una pronunciacin incorrecta que revela la presencia de un retraso del habla.
c) Un proceso fonolgico relativo a la sustitucin de un fonema de adquisicin
tarda en espaol.
El/los proceso/s de desarrollo lxico ms importante/s entre los 3 y los 6 aos es/son:
a) El crecimiento cuantitativo tan enorme que se produce en relacin al vocabu-
lario de los nios.
b) Procesos cuantitativos (por ejemplo, aumento del vocabulario), pero tambin
procesos cualitativos relativos a la organizacin del lxico.
c) Procesos fonolgicos de simplicacin del habla que permiten incorporar
palabras aunque an no se pronuncien correctamente.
El supuesto fundamental de la teora lingstica de Chomsky sobre la adquisicin
del lenguaje es el relativo a:
a) La necesidad de que exista una base de conocimiento innato sobre el funcio-
namiento sintctico de las lenguas.
b) La imposibilidad de adquirir una lengua ms all de la adolescencia por
razones biolgicas.
c) La existencia de mecanismos de aprendizaje de tipo perceptivo que aplican los
recin nacidos al lenguaje.
2. Lea atentamente el siguiente texto tomado de Belinchn, Rivire e Igoa
(1992, p. 179) referido a una de las funciones del lenguaje. Su tarea consiste
en lo siguiente: 1. Extraer las ideas principales de forma resumida. 2. Esta-
blecer la conexin entre lo que se plantea en el texto y alguna de las habi-
lidades evolutivas que se han tratado a lo largo de este captulo.
(...)Ellenguajenoesslounsistemaderelacinconlosdems,sinoque
lo emplean los usuarios para comunicarse consigo mismos, defniendo
as un plano refexivo y metacognitivo de conciencia, que modifca esen-
cialmente la experiencia humana y el modo de ser del hombre. De este
modoellenguajemodifcaelmediointernodelhombreydefne,enl,unnuevoplano
queprobablementenoseencuentreenotrasespeciesanimales:elplanodeunaconcien-
cia,porasdecirlo,desegundoorden,queposeeunaestructurasemitica,permiteni-
velesderefexividadsinprecedentes,yconsisteenprocesosautocomunicativos.Apartir
deestaadquisicincompleja,elmundohumanosemodifcaporcompleto.
3. Considere los siguientes casos de bilingismo y responda a las preguntas que
se formulan a continuacin.
Caso 1. Edad del nio: 3 aos. Pas de origen del nio: Japn. Lengua materna
del padre y la madre: japons. Escolarizacin: Se inicia a los 3 aos en un colegio
186 Bloque II. El desarrollo durante la primera infancia
monolinge de espaol, cuando la familia llega a Madrid. El nio slo dice algunas
palabras en castellano al principio. Lnea de actuacin de los padres: Hablan al nio
en japons y visitan con cierta frecuencia a amigos japoneses. Le cuentan cuentos
e historias propias de su cultura en casa y ven dibujos animados en esta lengua.
Cuando estn con personas espaolas, fuera de casa, se esfuerzan por utilizar la
lengua espaola, que tambin estn aprendiendo. El padre, por razones profesio-
nales, tiene un mejor dominio de espaol.
Caso 2. Edad del nio: 3 aos. Pas de origen: Rumana. Lengua materna del padre
y la madre: rumano. Escolarizacin: Se inicia cuando la familia llega a Espaa y el
nio tiene 2 aos. A los tres aos el nio comprende bastante aunque todava habla
poco. Lnea de actuacin de los padres: Los padres no hablan bien espaol, pero
preeren dirigirse al nio en esta lengua, aunque entre ellos hablan siempre en ru-
mano. En casa no se habla mucho sobre la cultura de origen. La familia tiene pro-
blemas de integracin en el barrio donde residen. Durante los veranos tienen pen-
sado visitar su pas de origen.
2.1. Qu cabe predecir sobre el desarrollo lingstico de ambos nios? Llegarn
a dominar las dos lenguas?
2.2. Qu consecuencias tendrn estas dos situaciones sobre el desarrollo psico-
lgico general de los nios? Qu cabe predecir sobre su grado de adaptacin
y de identicacin con las culturas espaola, japonesa y rumana, respectiva-
mente?
2.3. Qu tipo de actuaciones educativas seran recomendables en estos casos
para favorecer el aprendizaje de las lenguas y la identicacin con las culturas
mayoritaria y minoritaria?
Soluciones a las actividades
1. Preguntas
Para la primera pregunta la respuesta correcta es c). Como se recoge en el Epgrafe 2.1,
la produccin del fonema /r/ es una de las adquisiciones ms tardas en espaol. No
todos los nios de 4 aos pronuncian bien dicho fonema. Por tanto, la sustitucin que
se observa /d/ por /r/ es un proceso fonolgico perfectamente normal; no se puede
considerar a esta edad como signo de retraso del habla (alternativa b). Evidentemente,
tampoco se trata de un error de tipo sintctico, como se plantea en la alternativa a).
Para la segunda pregunta la opcin correcta es la alternativa b). Como se explica en
el Epgrafe 1.2 del texto, en la etapa de 3 a 6 aos el vocabulario experimenta un cre-
cimiento exponencial (por ejemplo, proceso cuantitativo), pero a la vez las palabras
adquiridas se organizan estableciendo las relaciones pertinentes entre ellas. Este ltimo
proceso de tipo cualitativo es tan importante como el primero para una adecuada cons-
titucin del lxico. Los procesos fonolgicos (alternativa c) son ms tpicos del desarrollo
anterior a los 3 aos, aunque se siguen observando en menor medida en nios de
4 y 5 aos.
Para la tercera pregunta la respuesta correcta es la expresada en la alternativa a).
Como es bien conocido (vase Epgrafe 4) la propuesta fundamental de N. Chomsky se
relaciona con la necesidad de que exista un conocimiento de tipo innato que gue al
nio en la adquisicin del lenguaje. Sin esta gua innata, que denomin Gramtica Uni-
versal, el lingista considera imposible la adquisicin del lenguaje. Lo expresado en la
Captulo 6. El desarrollo del lenguaje oral 187
alternativa b) podra considerarse una consecuencia indirecta de la propuesta de la GU,
pero evidentemente no constituye la principal aportacin de Chomsky al problema de
la adquisicin lingstica. La alternativa c) se reere a un conjunto de habilidades de
procesamiento de la seal del habla (vase Captulo 3, Epgrafes 3.1 y 3.2) que fueron
puestas de maniesto por distintos investigadores, pero en ningn caso por el lingista
americano.
2. Funciones del lenguaje
La primera tarea, extraer las ideas principales, es una actividad libre que admite mltiples
posibilidades. La facilidad o dicultad con que la haya realizado constituye un buen
ndice del nivel de comprensin que ha alcanzado tras el estudio del tema. En relacin
a la segunda tarea, el texto se reere a las funciones del lenguaje interior, que seran
herederas del habla egocntrica. Evidentemente la funcin de comunicacin consi-
go mismos est ms conectada con la interpretacin que dio Vygotski al habla ego-
cntrica y a su evolucin hacia un habla interiorizada, que nalmente se constituye en
la base de la conciencia personal.
3. Casos de bilingismo
3.1. Lo probable es que ambos nios adquieran las dos lenguas a las que estn
expuestos. Ambos adquirirn la lengua espaola si siguen viviendo en Espaa,
pues el contacto con la lengua ser suciente para garantizar el dominio del
espaol. El primer nio adquirir sin problemas la lengua japonesa. El segun-
do probablemente aprender tambin rumano si lo oye en casa y si pasa
temporadas en Rumana. Sin embargo, a priori parece que el grado de domi-
nio del primer nio respecto de la lengua de sus padres ser mejor que el del
segundo respecto de la lengua de los suyos.
3.2. Lo ms probable es que el primer nio pueda identicarse con las dos cultu-
ras (espaola y japonesa) sin dicultades. La situacin del segundo nio es
ms dudosa. Hay factores sociales y familiares que no favorecen que el nio
llegue a dominar igualmente bien las dos lenguas, ni que acepte la cultura
rumana, a la vez que se adapta a la cultura mayoritaria.
3.3. Caben distintos tipos de actuaciones; la respuesta a esta pregunta est com-
pletamente abierta. Algunas posibles actuaciones seran las siguientes: en el
contexto escolar de ambos nios estaran indicadas actividades que favorecie-
ran la difusin de algunos rasgos culturales propios de los pases de origen
de los nios (Japn y Rumana). Hacer partcipes a los dems compaeros de
las costumbres culturales del pas de origen (por ejemplo, los saludos tan
particulares de los japoneses) y aprender algunas expresiones en las lenguas
minoritarias (japons y rumano) ayudara a la convivencia de todos los nios
y al respeto por la diversidad. En el segundo caso sera conveniente informar
a los padres de la importancia y ventajas de dirigirse al nio en rumano, de
valorar esta lengua y de motivar al nio en relacin al conocimiento de la
misma y de su cultura de origen.
189 Bloque II. El desarrollo durante la primera infancia
El mundo social
de 3 a 6 aos
189
7
MARTA GIMNEZ-DAS
Esquema-resumen
Objetivos
Introduccin
1. El desarrollo del yo
2. El mundo emocional y afectivo
3. Las relaciones con los dems
3.1. La familia
3.1.1. Los estilos educativos
3.2. Los amigos
3.2.1. El ajuste en las relaciones sociales: nios queridos y nios
rechazados
4. El juego
5. La identidad de gnero
6. El pensamiento moral
6.1. La intencionalidad y la responsabilidad objetiva
6.2. La mentira
6.3. La justicia inmanente y retributiva
Lecturas complementarias
Actividades
Soluciones a las actividades
190 Bloque II. El desarrollo durante la primera infancia
Esquema-resumen
1. El desarrollo del yo
Entre los 3 y los 6 aos, los nios reejan la idea que tienen de s mismos a travs del
lenguaje. En un principio, se describen a travs de rasgos visibles como el sexo, la edad
o sus pertenencias y poco a poco van incorporando otros menos evidentes como las
caractersticas de personalidad.
La interaccin con otros nios ayuda al sujeto a establecer la denicin de s mismo.
La teora de la mente y la formacin de amistades son dos elementos que inciden de
forma signicativa en este proceso.
Los nios de estas edades suelen disfrutar de una buena autoestima, es decir, suelen
mantener una visin positiva de s mismos. No obstante, con el inicio de la escolariza-
cin, comienzan a tener importancia las valoraciones positivas y negativas de los dems.
2. El mundo emocional y afectivo
Los nios de estas edades empiezan a entender emociones complejas como la vergen-
za o el orgullo. Por otra parte, comienzan a establecer relaciones entre acontecimientos
y emociones y entre estados mentales y emociones.
Se producen avances importantes en el autocontrol y la expresin de las emociones,
adquirindose otras estrategias ms adaptativas que producen mejores resultados al
interactuar con los dems.
En el mbito del desarrollo emocional se ha encontrado una gran variabilidad indi-
vidual. El establecimiento del vnculo afectivo y el desarrollo cognitivo se han propuesto
como dos elementos que podran explicar estas diferencias.
3. Las relaciones con los dems
La familia es el contexto ms importante para los nios entre 3 y 6 aos. Satisface las
necesidades afectivas y constituye el primer contexto de socializacin.
Los padres emplean diferentes estilos educativos que tienen importantes repercusio-
nes en sus hijos.
En esta etapa los nios comienzan a hacerse amigos gracias a la capacidad para
considerar al otro y al juego de ccin, que proporciona el contexto ideal para intimar
con otros nios.
Las estrategias que los nios emplean para acercarse a los dems ya pueden consi-
derarse efectivas o provocar rechazo. La autoestima, la comprensin emocional y las
estrategias de interaccin son elementos que inuyen en la popularidad o rechazo que
los nios provocan.
4. El juego
Hacia los 3 aos, los nios realizan juego de ccin simple y solitario o en paralelo. A
partir de los 4 aos, se observa un juego simblico diferente en el que los nios represen-
tan situaciones cotidianas, exploran sus temores, etc. La expresin de este tipo de juego,
denominado sociodramtico, est condicionada por los estereotipos y roles de gnero.
5. La identidad de gnero
Desde muy temprano los nios interiorizan estereotipos y roles de gnero. La acumula-
cin de informacin relativa a cmo debe ser y qu deben hacer los hombres y las mu-
jeres termina, aos ms tarde, con la adopcin de una identidad de gnero.
Captulo 7. El mundo social de 3 a 6 aos 191
Introduccin
Alolargodeestecaptulovamosadescribircmosedesarrollanenelniodiferentes
aspectosparalosqueelcontactoconotraspersonasesunapoyoimprescindible.Aunque
alolargodetodoellibroyahemosmencionadoque,tantolosprogresosdelrazonamien-
tocomolosemocionalesolosafectivos,estnmediadosporlainteraccinconlosdems,
existenciertosaspectosligadosalmundosocialenlosquedichainteraccinesconstitu-
tivaeinseparabledelpropioprocesodedesarrollo.As,porejemplo,losniosvanapren-
diendoquconductassonbuenasyculesreprobables,culessonlasmejoresestrategias
Objetivos
Entender los progresos que realizan los nios entre los 3 y los 6 aos en diversos
mbitos relacionados con el mundo social, es decir, en entornos en los que el
contacto con los dems es un elemento clave.
Asimilar los progresos que se producen en la comprensin emocional y en la con-
sideracin del otro como un agente intencional. Relacionar dichos progresos con
los cambios que se dan en el desarrollo social.
Comprender la importancia de la familia como contexto de socializacin para el
nio y la repercusin de los estilos educativos en los hijos.
Entender las repercusiones que tiene la interaccin con otros nios en todos los
mbitos del desarrollo social.
Conocer la importancia del juego de ccin como forma de prctica social y como
contexto de interaccin que da paso a la intimidad y la amistad.
Denir y explicar cmo se adquiere la identidad de gnero desde los distintos
modelos tericos expuestos.
Aprender los rasgos tpicos del criterio moral en el nio tal y como los deni
Piaget.
Desde el psicoanlisis, las teoras del aprendizaje y los modelos cognitivos se han
realizado diferentes propuestas que intentan explicar cmo el nio adopta dicha iden-
tidad.
6. El pensamiento moral
La vida del nio se rige por una gran cantidad de normas impuestas por el adulto. A
partir de estas normas los pequeos van desarrollando un pensamiento o criterio moral,
es decir, van aprendiendo lo que est bien y lo que est mal.
Piaget dedic parte de su obra a estudiar el criterio moral en el nio. A partir de sus
conversaciones con los nios, calic la moral del nio pequeo como una moral hete-
rnoma, basada en la obediencia a la autoridad y en el cumplimiento de normas im-
puestas.
Adems, Piaget observ que los nios pequeos no consideraban la intencionalidad
a la hora de juzgar las conductas (responsabilidad objetiva), consideraban los errores y
palabrotas como mentiras y crean en la justicia inmanente y retributiva.
192 Bloque II. El desarrollo durante la primera infancia
para tener amigos, qu implica socialmente y para uno mismo ser nio o nia o cmo
interpretarlasemocionespropiasyajenas.Todasestascuestionesnacenysedesarrollan
teniendocomomarcoinmediatoalotro,atravsdelasinteraccionesmscercanascomo
lafamiliaolosamigos,ycomoreferentemsamplioelcontextosocioculturalqueim-
ponelasnormasmorales,lasimplicacionesligadasalgnero,etc.
Noobstante,nohayqueolvidarqueenelcentrodetodasestascuestionessociales
est siempre el sujeto, el propio nio que va elaborando su propia identidad, su propio
yocomorefejodelosotrosydesupropiodesarrollo.Deestemodo,lamayorcomple-
jidad que va alcanzando el pensamiento permite que el nio comprenda aspectos ms
sofsticadosdelasrelacionesconlosdemseintegrenuevoselementosasuidentidad.
Entrelos3ylos6aoslosnioscomienzanadefnirseasmismosaunqueslosea
atravsdeelementosbsicos,empiezanaentenderlasemocionescomplejasyapre-
decirlasconductasdelosdemsenfuncindecmosesientenyestablecenrelaciones
conotraspersonasguiadasporpautassocialesquedebeninteriorizarporejemplo,con
loshermanosoloscompaeros.Porotraparte,enestaetapadominaprincipalmenteel
juego de fccin.A este tipo de juego subyace un importante avance cognitivo ya bien
asentado(lacapacidadsimblica,vanseCaptulos1y2)queenestaetapatendruna
importante repercusin en la comprensin infantil del mundo social, de lo real y de lo
posible.Atravsdeljuegodefccinlosniosreproducirnnumerosassituacionesdela
vida real y tambin explorarn nuevas posibilidades, con la ventaja de que ninguna de
susaccionestendrconsecuenciasreales.Porltimo,doscuestionesqueseintegranen
laidentidadylapersonalidaddelniotienenenestaetapasusinicios:lasimplicaciones
deservarnomujerylacomprensindelasnormasmoralesqueregulanlainteraccin
conlosdems.Acontinuacinexploraremostodosestosaspectosdeldesarrolloinfantil.
1. El desarrollo del yo
Entrelos15ylos18meseslosbebsdanclarassealesdequesereconocencuandose
venfrenteaunespejo(LewisyBrooks-Gunn,1979).Lasconductasqueaparecenaesta
edad,cuandopercibensupropiaimagen,constituyenlaprimeramanifestacinclarade
reconocimientodeunomismo.Apartirdeestaedad,pues,podemospensarqueelnio
sereconocecomounserindependienteydiferenciadodelresto,almenosenloreferen-
tealaspectofsico.Porotraparte,laaparicindellenguajeautorreferencialmediantela
utilizacin de los pronombres personales (vase Captulo 3) indica que, tambin desde
unpuntodevistacognitivo,elnioconsiguediferenciarsedelresto.Estasdoshabilidades
revelancmolaconcienciadeunomismosevaadquiriendodeformalentayprogresiva
alcompsdelashabilidadescognitivasqueelniovadesarrollando.
Entrelos3ylos6aos,losniosofrecenmuyamenudomuestrasdelaconciencia
desmismosatravsdellenguaje.Aestaedad,losniosrealizanmultituddeafrmacio-
nesenlasquerefejanloquelescaracterizayloquenoformapartedesuyo.Porejem-
plo,puedendecirsisonunnioounania,cuantosaostienenoaqugrupopertenecen
medianteafrmacionescomoyonosoyunbeb,soyunaniamayor.Igualmente,con
frecuencia van a hablar de s mismos en funcin de los objetos materiales que poseen.
As,frasescomotengouncochegrandeoestemuecoesmoformanpartedesu
repertoriohabitual.Estaidentifcacindeunomismoconlascosasqueposee,aunqueno
Captulo 7. El mundo social de 3 a 6 aos 193
desapareceenlaedadadulta,vaacompletarsealolargodeldesarrolloconaspectosms
complejos,msrelevantesymenosvisiblescomolosrasgosdepersonalidad,lascapaci-
dadesyloslogrosvitalesquenoscaracterizan.Noobstante,losniosentre3y6aos
tienenyaciertacomprensindelosrasgosmssobresalientes,delosestadosemociona-
lesydelarelacincausalentrelosacontecimientosylasemocionesqueprovocan.Como
veremosmsadelante,lacomprensindelasemocionesestodavalimitada,perolosu-
fcientementeavanzadaparaqueelniocomprendacmoseprovocanyquconsecuen-
ciaspuedenteneralgunosestadosemocionalescomolaalegra,latristeza,elenfadoyel
miedo.As,enesteperodoaunqueelniotodavanoentiendelavariabilidaddelasap-
titudesnilasconductasesdecir,queunamismapersonapuedatenerhabilidadespara
ciertastareasperonoparaotras,oquepuedacomportarsedeunaformaenunasituacin
ydeotracompletamentedistintaenotra,spuedeatribuirtendenciaspsicolgicasge-
nerales. Por ejemplo, cuando los nios de esta edad excluyen a un igual de un juego
pueden explicarlo en funcin de un rasgo o una predisposicin del nio excluido con
argumentoscomoporqueesunamandonaoporquesiemprepega.
Unodelosprincipaleselementosatravsdeloscualeselnioprogresaenladefni-
cindesmismoeslainteraccinconlosdems.Tantolosintercambiosconlosadultos
comoconotrosnios,constituyencontextosenlosquelasdiferenciasentrepersonasse
manifestanclaramente.Lainteraccinconlosotrosponederelievelosdiferentesinte-
reses, las distintas estrategias y las diversas predisposiciones que nos caracterizan y el
nio, al igual que el adulto, tendr no slo que tomar conciencia de dichas diferencias
sino lograr conciliarlas para conseguir una interaccin armnica. Durante este perodo
del desarrollo los nios logran una importante mejora en sus habilidades sociales. La
comprensin de la separacin de los estados mentales y emocionales propios y ajenos
lallamadateoradelamenteconstituyeunlogrodelpensamientoquepermiteco-
ordinaryarmonizarlasinteracciones(vaseCaptulo5).Alos6aos,pues,losniosya
noinsistirnparaconseguiralgo,sinoquepondrnenmarchaestrategiasdenegociacin
atravsdelascualesharnconcesionesydemandasparaalcanzarsuobjetivo.
Laformacindeamistadesque,comoveremosmsadelante,tienesusiniciosenesta
etapaconstituyeunelementoclaveenladefnicindeunomismo.Atravsdelasrela-
cionesconlosamigoselniocoordinalasinteraccionescreandounvnculoemocional
quefavorecelaconsideracindelosintereses,emocioneseintencionesdelotro.As,los
niosponenenmarcharecursosmssofsticadosysemuestranmsconciliadorescuan-
dointeractanconunamigoquecuandolohacenconunsimpleconocidooinclusoun
hermano (Dunn, 2004). Estas diferencias ponen de manifesto no slo la capacidad de
consideraralotroydenegociarconl,sinolamediacindelosvnculosemocionalesy
ladiferenciacindeloscontextosinteractivos.Aunqueconunhermanotambinseesta-
bleceunfuertevnculoafectivo,larelacinnoeslamismaqueconunamigoy,desde
muytemprano,losniosrefejanesasdiferenciasensumaneradeinteractuar.Msade-
lantetrataremosestosaspectosenprofundidad.
Unelementoqueformapartenucleardeladefnicindeunomismoeslaautoestima.
Losniosdeestasedadessuelendisfrutardeunavaloracinpositivadesmismos.Los
padres,principalesartfcesdelaautoestimaenestaetapa,generalmenteofrecenjuicios
positivossobretodaslascapacidadesdesushijos.Estosjuiciosdanlugaraunconcepto
positivoyunabuenavaloracin,detalformaquelosniossecreencapacesdellevara
cabocualquieraccin.Porejemplo,siunadultoproponeaunniode5aosecharuna
194 Bloque II. El desarrollo durante la primera infancia
carrera,elnioaceptarsiempreelretopensandoademsquepuedeganaralgoque,de
hecho,sueleocurrirpuestoqueeladultoledejarcorrermsrpidoyllegarantesala
meta.Medianteaccionescomoesta,losadultoscreanenlosnioslaideadequetienen
grandescapacidades.Porotraparte,laconciencia,larefexinylaautocrticasobrelas
propiascapacidadesaestasedadesesprcticamenteinexistente,tantoenloqueserefe-
re a las capacidades fsicas como a las intelectuales. Por ejemplo, los estudios sobre la
memoriainfantilenlosquesepideaniosentre5y6aosquepredigansiserncapa-
cesderecordarunaserielargaycomplejadecifrasyletrasodepalabras,muestranque
suelenequivocarseatribuyndoseunacapacidadderecuerdodelaquenodisponen(Kail,
1990;SchneideryPressley,1989).Igualmente,cuandojuzgansucapacidadpararealizar
tareas o imitar modelos se creen ms habilidosos de lo que son.Algunos autores han
pensadoqueestafaltadeconocimientoydecontrolsobrelospropiosprocesosycapa-
cidadespuedetenerunainfuencianegativaenelrendimiento.Noobstante,esmsplau-
siblepensarqueestavisintanpositivaquelosniosmantienendesmismosconstituya
noslounaproteccincontralosataquesalaautoestima,sinotambinunaventajamo-
tivacional que predispone de forma positiva para el aprendizaje (Bjorklund y Green,
1992,citadoenVasta,HaithyMiller,1996).Silosniosfueranmsrealistasyportan-
toconscientesdequehaymuchascosasquenopuedenconseguir,nisiquieralointenta-
ran.Deestaotraforma,alestarconvencidosdelaposibilidaddealcanzarlametaque
se proponen, intentan las cosas una y otra vez sin desanimarse ante el primer fracaso.
ComoafrmanVasta,HaithyMiller(1996)esatravsdeestapersistenciacomosesu-
perangradualmentelaslimitacionesyseconsigueeldominiodelascosas(p.365).
Laautoestimaconstituyeunelementoesencialdelapersonalidadquecuandopresen-
tacarenciaspuedetenerrepercusionesmuynegativas.Losniosylosadultosquenotienen
unabuenavaloracindesmismospuedenperderlainiciativayelintersporlascosas.
Lasensacindeincapacidadpuedellegaraprovocarsentimientosprximosaladepresin
yhacerqueelsujetoabandonelastareasyactividadesqueleproducenplaceryatravs
delascualesprogresaensudesarrollo.Comoacabamosdeapuntar,podemospensarque
losniosdeestasedadesseencuentranprotegidosdeestospeligrosgraciasadoselemen-
tos. Por una parte, el nio no puede elaborar por s mismo una visin realista sobre sus
propiascapacidades.Porotra,laactituddeladultoimpidedichaelaboracinrealistayfo-
mentalavisindeunsuperniocapazdecualquiercosa.Amboselementosimpidenuna
actitudcrticahaciaunomismoyfomentanlamotivacinparaelaprendizaje.
Noobstante,existenotroselementosenelmundodelnioquelimitanestavaloracin
positivadesmismo.Porunaparte,lacrticadelospadrescuandonoseactadeforma
correctay,porotra,eliniciodelaconsideracindelosjuiciosdelosiguales.Comoire-
mos viendo, la consideracin de la valoracin de los padres y la de los iguales siguen
patronesopuestosalolargodeldesarrollo.Lavaloracindelosigualesvacobrandocada
vez ms importancia, alcanzando su punto mximo en la adolescencia, mientras que la
delospadresvadisminuyendo.Entrelos3ylos6aos,lavaloracindelospadrescons-
tituyeelelementofundamentalsobreelqueseasientalaautoestimadelosnios.Estos
integranyempleanlosvaloresdelosadultosparaevaluarelxitoofracasodesuspropias
conductasyemitirjuiciossobresmismos.Deestaforma,cuandonoconsiguenrealizar
una tarea o provocan un desastre rompiendo o tirando algo, incluso en ausencia de los
adultos,losniosreaccionanconvergenzaosentimientodeculpa(BergeryTompson,
1995).Comodecamosantes,enesteperodolosigualesrealizansuprimeraapariciny
Captulo 7. El mundo social de 3 a 6 aos 195
constituyenyaunreferenteaconsiderar.Apartirdelaescolarizacinelniocomenzar
atenerencuentalosjuiciosdesuscompaerosquepuedenconstituirlaprimerafuente
devaloracinnegativa.Adems,laaceptacindelosdemscomienzaaserimportante
obligandoalpequeoaadaptarsealasnormasqueimponeelgrupo.
Utilizando la descripcin de Erikson, el nio se encuentra en este momento en la
etapadeiniciativafrenteaculpabilidad(Erikson,1950).Esdecir,tienequelograrcon-
ciliar su motivacin para realizar tareas y conseguir nuevos logros (iniciativa) con las
normasqueleimponenlosadultosylosigualesparaseraceptadoyvalorado(culpabili-
dad).As,laguaprincipalparaelprogresoenesteperodoeslainiciativaylaindepen-
denciadelnioquelellevanalaexploracinyelintentodenuevosobjetivos,perocon-
siderandoalavezlasnormasdeactuacinqueleimponendesdeelexterioryterminarn
porregularsuconducta.Laimposicineintegracindeestasnormasjuntoconlosvalo-
res para emitir juicios sobre lo bueno y lo malo darn lugar, como explicaremos ms
adelante,atodounsistemadepensamientomoral.
2. El mundo emocional y afectivo
Hacialos2aoslosniosadquierenunagrancantidaddetrminoslingsticosreferidos
asusestadosemocionales.Aprendenaidentifcaryetiquetaralgunasdelasemociones
bsicascomolaalegra,elmiedo,latristezayelenfadoypuedenempezarahablar
de las emociones pasadas o futuras.A partir de los 3 o 4 aos el conocimiento de las
emocionessehacemuchomscomplejo.SiguiendoaPons,Doudin,HarrisydeRosnay
(2005),porunaparte,seidentifcanotrasemocioneslasdenominadasemocionescom-
plejascomolaculpa,lavergenza,elorgulloolatimidezysehacendistincionesms
sutilesentreestadosemocionales.Porotra,seempiezanaidentifcarlosacontecimientos
queprovocanlasemocionesylascausasdedichosestados.Porejemplo,hacialos3aos
losniosentiendenquerecibirunregaloprovocaalegramientrasquelamuertedeuna
mascotaprovocatristeza.Tambinaestaedadcomprendenqueatravsdelafccinse
puedenprovocaremocionesyque,porejemplo,siunnioesperseguidoporunabruja
sentirmiedo,aunqueseafngido.
Hacia los 4 aos, los nios comienzan a entender que la memoria y los recuerdos
pueden intervenir en los sentimientos. Comprendern, pues, que recordar una festa de
cumpleaosprovocaralegramientrasquerecordarlapersecucindeunperroprovoca-
rmiedo.Entrelos4ylos5aoslosniosentiendenquelasemocionesdelosotrosson
agentescausalesdesucomportamiento,esdecir,quetienenintenciones,creenciasyde-
seospropiosyqueactandeacuerdoconellos.Estacomprensininfuyeenlaconside-
racindelosaspectosmentalescomoelementosqueintervienenenlosestadosemocio-
nales. As por ejemplo, entendern que si alguien consigue algo que desea estar
contentoyviceversa.Tambincomprendernladiferenciaentreemocionesrealesyemo-
cionesaparentesylautilidaddefngiremocionesenciertassituaciones.Porejemplo,si
unniopierdetodassuscanicasaljugarconotro,peronoquieremanifestarsuenfado,
losniosde5aospredecirncorrectamentequetendrquefngiralegraoindiferencia.
Otroavancedeestaetapa,relacionadoconlaconcepcindelotrocomoagenteinten-
cional,eslacomprensindequedistintaspersonaspuedensentirdiversasemocionesante
elmismoacontecimientoenfuncindecuestionesinternas.Estopermitirpredecir,por
196 Bloque II. El desarrollo durante la primera infancia
ejemplo,queanteelmismoregalounniosesientafelizporqueesloquemsdesea-
barecibiryotrosesientadecepcionadoporqueesunjuegoquenolegusta.Unpoco
mstarde,hacialos6aos,empezarnaentendercmoelconocimientoinfuyeenlos
estadosemocionales.
Tambinentrelos5y6aosseproducenavancesrespectoalcontrolylaexpresin
delasemociones,unelementofundamentalparaestablecerrelacionessatisfactoriascon
losdems.Losniosvanaprendiendoqueparaconseguirdeterminadosobjetivosdeben
controlar sus emociones. Por ejemplo, el enfado o las rabietas son respuestas emocio-
nales bruscas que van desapareciendo con la edad porque el grado de control es cada
vez mayor. Los adultos suelen ofrecer pautas alternativas para que los nios consigan
susobjetivosmedianteotrasvascomolaespera,lanegociacin,etc.Igualmente,cuan-
do se juega con otros nios, la frustracin, el enfado y las conductas agresivas se van
controlandoparadejarpasoaestrategiasmsadaptativasyqueproducenmejoresresul-
tados.
Apesardeestaspautasgeneralesdeldesarrollodelacomprensinyregulacinemo-
cional,hayquesealarqueenestembitoexistengrandesdiferenciasindividualesob-
servablesdesdemuytemprano.Inclusodesdelos2aos,hayniosqueverbalizanuna
grancantidaddetrminosemocionalesunamediade25referenciasporhoramien-
trasqueotrosnoproducenninguno(Dunn,BrownyBeardsall,1991).Existendospos-
turasqueintentanexplicarestasdiferencias.Porunaparte,losmodeloscentradosenla
afectividaddefendenqueunaexperienciaemocionalyafectivaajustadaeslabasenece-
saria,aunquenosufciente,paradesarrollarmstardeunabuenacomprensinyregula-
cinemocional.Laexperienciaemocionaltempranasecentraprincipalmenteenelesta-
blecimiento del vnculo afectivo.As pues, como vimos en el Captulo 4, se considera
queelestablecimientodeunapegosegurodurantelosprimerosmesesyaosdevidaes
elindicadordeunaadecuadaexperienciaemocional.Elnioqueestableceunapegose-
guro aprende que sus necesidades emocionales estn cubiertas y que cuenta con unos
padresatentosasusdemandas.Estaseguridademocionalenlarelacinconlospadres
ayudaaqueelniodesarrollemstardeunacomprensinyregulacinemocionalefec-
tiva.Diferentestrabajoshanencontradoque,engeneral,losniosconapegosegurore-
suelvenmejortareasenlasquehayquecomprenderysolucionarconfictosemocionales
(Ponsetal.,2005).
Desdeotropuntodevista,existenautoresquedefendenqueeldesarrollodecapaci-
dades cognitivas y la prctica a travs de la interaccin social son los elementos que
explicancmoseadquiereunabuenacomprensinyregulacinemocional.Lasinterac-
cionesfamiliaresdesempean,segnestemodelo,unpapelfundamental,puestoquese
tratadelprimercontextoenelqueelniosocializasumundoemocional.Alanalizar
eltipodecomunicacinacercadelasemocionesdentrodelafamilia,sehaencontrado
quelosnioscuyasfamiliashablanamenudosobreestadosemocionales,suscausasy
consecuencias, la relacin con los estados mentales, etc., comprenden y regulan mejor
lasemociones(Denham,1998;Dunn,BrownyBeardsall,1991).Lashabilidadeslings-
ticas,queconstituyenunbuenindicadordeldesarrollocognitivo,tambinserelacionan
conlacomprensinemocionaly,deformamsgeneral,conlashabilidadesmentalistas
delosnios.As,sehaencontradoquelosniosconunnivelverbalmselevadotambin
resuelvenmejorlastareasdeteoradelamenteycomprendenmejorlasemociones(Cut-
tingyDunn,1999;Pons,Lawson,HarrisydeRosnay,2003).Todavanoestclarocul
Captulo 7. El mundo social de 3 a 6 aos 197
de los dos modelos explica mejor la comprensin emocional, pero quizs habra que
plantearsesilaartifciosaseparacinentreafectoycognicinnonosestarconfundien-
dounavezms.
Comoacabamosdever,elmundoemocionalescomplejoysusmecanismosysuti-
lezas se van aprendiendo poco a poco. Como veremos ms adelante, las repercusiones
quetienenlashabilidadesemocionalesenelajustesocialdelosniosydelosadul-
tosesenorme.Aunquelasemocionesnosehantrabajadodesdelaescueladeforma
sistemtica,hoyseempiezaareconocerelimportantepapelquedesempeanyseestn
desarrollando programas de intervencin centrados en las competencias emocionales
cuyoobjetivoespromoverlainteligenciaemocionaldelosnios.Enelsiguientecua-
droresumimoslasprincipalesestrategiasquesetrabajandesdeestosprogramas.
Los profesores y tambin los padres pueden mejorar las habilidades emocionales de los
nios. El objetivo principal de estos programas es lograr que el nio sea consciente de
sus emociones y las de los dems y aprenda a manejarlas adecuadamente en sus inte-
racciones sociales. Algunos aspectos que suelen trabajar en estos programas son
1
:
Aprender vocabulario emocional identicando diferentes estados emocionales y eti-
quetndolos mediante palabras.
Aprender a reconocer las emociones en uno mismo y en los dems a travs de si-
tuaciones reales, juegos, canciones, etc.
Aprender algunos aspectos bsicos sobre las emociones:
las emociones cambian
puedes sentir de forma distinta a los dems
puedes tener ms de una emocin hacia algo
todas las emociones son vlidas, lo que importa es lo que haces con ellas
Aprender a identicar el enfado y manejarlo:
aprender que el enfado puede impedir la solucin de un problema
aprender a reconocerlo
tcnicas para calmarse
buscar formas adecuadas de expresarlo
buscar soluciones alternativas y evaluarlas: es una solucin justa, es segura,
nos hace sentir bien a todos
Qu hacer en situaciones de conicto?
aprender respuestas alternativas cuando alguien nos molesta o pega
aprender a expresar de forma adecuada cuando algo molesta
aprender a ignorar conductas negativas de los dems
CON LOS PIES
EN LA TIERRA
Cmo se puede trabajar la competencia
emocional?
1
Basado en el programa diseado por el Center on the Social and Emotional Foundations for Early
Learning.Mdulo2:Enseandoestrategiassocioemocionales.
198 Bloque II. El desarrollo durante la primera infancia
3. Las relaciones con los dems
3.1. La familia
Comoyahemosmencionado,elcontextofamiliareselmsimportanteparaeldesarrollo
enesteperodo.Lafamiliaconstituyeunsistemacomplejoenelquetodoslosmiembros
interactan entre s, se infuyen y evolucionan. De esta forma, podemos considerar la
familiacomounsistemaenconstantecambio,enelquetodossusmiembrossedesarro-
llan adaptndose en funcin de las necesidades y cambios que van aconteciendo. As
pues,cualquiercambioonovedadqueseproduzcaafectaratodoslosmiembrosdela
familiayasusrelaciones.Porejemplo,elnacimientodeunnuevohijoouncambiode
residenciasonacontecimientosqueprobablementemodifcarntantolasrelacionesfami-
liarescomoacadaunodesusmiembros.
Lafamiliahumanaesuntipodeagrupacinquecumplediversasfunciones.Entrelas
msimportantesseencuentranasegurarlasupervivenciadelascrasyportantodela
especieatravsdelcuidadoqueseproporcionaalosmiembrosmsjvenes,facilitar
un contexto afectivo y emocional adecuado para el desarrollo e instruir acerca de las
normas y pautas de conducta ajustadas al contexto sociocultural al que los hijos se en-
frentarn(Berk,1999).Todasestasfuncionesestnestrechamenterelacionadasentres
ytienencomoejecomnelvnculoafectivoqueseestableceentrepadresehijosdesde
eliniciodelavida.Graciasaestacapacidadinnataparacrearlazosafectivos,losadultos
cuidan y protegen a los miembros jvenes y se preocupan por ofrecerles un contexto
afectivoquepromuevaeldesarrolloajustado.Estosvnculostanestrechossemodifcan
coneltiempo,peropermanecentodalavida.Enestesentido,lasfamiliasdisfuncionales,
comolasquemaltratanosonnegligentes,suelendejargravessecuelaseneldesarrollo
afectivoyemocionaldelosnioslimitandosusposibilidadesdeadaptacin(vaseCa-
ptulo12).
Lafamiliasuponeparalosnioselprimercontextodesocializacin,esdecir,elpri-
merlugarenelqueaprendenainteractuarconlosdems.Sonlospadresquienesempie-
zanaponerlmitesenlaconductadelnioyquienesempiezanapautarlasinteracciones
desdelosprimerosmesesdevida.Losniosmuyprontoempiezanaobservaryescuchar
loquesedebehacery,sobretodo,loquenosedebehacer.Deestaforma,losadultos
proporcionan de forma explcita e implcita herramientas y normas para que los nios
actendeacuerdoconelcontextosocialenelqueviven.Lasestrategiasdeinteraccin
que los nios observan y aprenden en casa son las que en principio ponen en prctica
cuando se encuentran en otros contextos.As por ejemplo, las interacciones con otros
niosestarnguiadasporlaspautasdeinteraccinfamiliarydeellasdependernaspec-
tos como la popularidad o la valoracin positiva por parte de los compaeros. Como
veremosacontinuacin,losllamadosestiloseducativosquelospadrespracticanestn
muyrelacionadosconlasestrategiasdeactuacindelosniosy,comoconsecuencia,con
suajustesocialenotrosambientes.
3.1.1. Los estilos educativos
Cmoeducanlospadresasushijos?Ponenenmarchaunaseriedeestrategiasplani-
fcadas y estudiadas o simplemente siguen su instinto? Son consistentes a la hora de
Captulo 7. El mundo social de 3 a 6 aos 199
aplicar sus estrategias o varan en funcin de la situacin y con cada hijo? En general,
lospadressuelenguiarseporpautaseducativasespecfcasquesesuelenaplicardeforma
constanteaunquepuedenvariardeunhijoaotro.Laadopcindelaspautaseducativas
dependedefactorescomolaspropiasexperienciaseducativasdelospadres,elcarcter
deloshijosydelospadres,lasexpectativassobreloshijosylasideasimplcitasdelos
padresacercadeldesarrolloylaeducacin.Tambininfuyenaspectosexternoscomola
clasesocialyelentornocultural.Estaspautaseducativasquelospadresaplicansedeno-
minan estilos educativos y determinan el tipo de interaccin que se establece con los
hijos.
Los estilos educativos lograron defnirse partiendo de observaciones de interaccin
entreniosde3a6aosysuspadres.Alrealizarestasobservacionesparecaclaroque
existandosgrandesdimensionesquediferenciabandichasinteracciones:porunaparte,
elcontroldelospadressobresushijosy,porotra,elafectoquelospadresproporcionan
asushijos(Baumrind,1971;Maccoby,1992).Laprimeradimensincontroldife-
renciaalospadresenfuncindelarigidezalahoradeimponeryhacercumplirnormas,
mientras que la segunda afecto les diferencia en funcin del grado de implicacin
emocional,apoyoysensibilidadantelasnecesidadesdeloshijos.Enfuncindelacom-
binacin del nivel de control y de afecto que los padres emplean con sus hijos se han
defnido cuatro estilos educativos diferenciados: democrtico, autoritario, permisivo e
indiferente(Baumrind,1971;MaccobyyMartin,1983,citadoenVastaetal.,1996;Ma-
cDonald,1992).Aunquenosehaestablecidounarelacincausaldirectaentreeltipode
estiloeducativoylosrasgosqueloshijosdesarrollanconeltiempo,sparecequeelem-
pleodealgunosestilostienemsprobabilidadesdegenerardeterminadascaractersticas
enloshijos(BergeryThompson,1995).
Lospadresquesiguenunestilodemocrticoadoptannivelesaltosencontrolyafec-
to.Sonpadresqueproporcionanunentornoafectivoycomunicativoadecuado,soncari-
osos,creanunentornoconunaaltaexpresividademocionalyestnpendientesdesus
hijos,peroalavezmantienenbiendelimitadaslasnormasyreglasqueloshijosdeben
cumplir.Cuandoaparecenconfictosintentanquelosnioscumplanlasnormasatravs
deldilogo,elrazonamientoyelcompromisomutuoevitandoelcastigofsicoylaim-
posicin.Estospadressesientenmuycomprometidosconlaeducacindesushijos,pero
valoranyfomentanlaautonomaylacapacidadcrticaantesquelaobedienciainmedia-
ta.Losnioscuyospadresempleanesteestiloparecenserlosmsbenefciados:poseen
una buena valoracin de s mismos, son independientes y curiosos y obtienen buenos
resultadosenelcolegio.
Los padres autoritarios ejercen altos niveles de control y manifestan poco afecto.
Setratadepadresexcesivamenteexigentesyseverosencuantoalaimposicinycum-
plimientodenormas.Estasnormassuelenserincuestionablesyseutilizaelcastigocuan-
do no se cumplen. Por otra parte, no establecen buenas vas de comunicacin con sus
hijos,mantienenunarelacindistanteynocreanunclimaafectivoadecuado.Losnios
no suelen reaccionar bien ante este estilo educativo y pueden presentar problemas de
conducta,agresin,hostilidadyfrustracin.Adems,puedensermsinmaduros,insegu-
rosydependientes,ascomodesarrollarunmenorniveldecapacidadcrtica.
Cuandoelniveldecontrolesbajoperoelniveldeafectoesaltoseempleaunestilo
educativo permisivo. Estos padres no tienen inters en imponer normas de conducta a
sus hijos ya que consideran que los nios deben progresar por sus propios medios. El
200 Bloque II. El desarrollo durante la primera infancia
niveldeexigenciadelospadresesmuybajoylosniospuedentomardecisionesoactuar
sobrecuestionesquenolescompetenyquesuperansucapacidaddeprevisin,susha-
bilidades, etc. No obstante, dado que el nivel de afecto es alto, estos padres establecen
unarelacincariosa,mantienenbuenasvasdecomunicacinconsushijosylesofrecen
apoyoemocional.Losnioscriadosconesteestiloeducativotiendenaserimpulsivose
inmaduros.
Porltimo,lospadresquepresentanbajosnivelesdecontrolydeafectoutilizanun
estiloeducativoindiferente.Esteeselestilomsdainoparalosnios.Estospadresno
proporcionanasushijosapoyoemocional,nocreanunentornoafectivoadecuadoytam-
pocosepreocupanporestablecerlmitesninormasdeconducta.Engeneral,setratade
padres poco comprometidos con la tarea de educar a sus hijos y en ella emplean poco
esfuerzo.Estosniosnodisfrutandebuenosvnculosafectivosconsuspadresnisebene-
fcian de una rica estimulacin cognitiva. Los hijos educados con este estilo no suelen
presentarundesarrolloajustado,tienendifcultadesparaestablecerinteraccionessatisfacto-
riasconlosdemsypuedenserinmaduros,inestables,desobedientesyexigentes.Adems,
tienendifcultadesparacontrolarseycumplirnormasypresentanunabajaautoestima.
A pesar de que existen ms estilos educativos, ya que esta clasifcacin deja fuera
muchosmaticesylospadresnosiempreejercenlosestilosdeformapura,pareceque
el mejor estilo para el desarrollo sano de los nios es el democrtico, es decir, el que
proporcionaunadecuadoclimaafectivoenelqueelniosesientevaloradoyescuchado,
peroquealavezimponenormasasuconductaymantieneunaltoniveldeexigenciaen
suslogros.
Comomencionamosaliniciodeesteapartado,existenmuchasvariablesqueinciden
enelestiloeducativodelospadres.Unastienenqueverconcaractersticasdelospadres
como su personalidad, su propia educacin o sus ideas acerca de cmo se produce el
desarrollo.Muchospadresreproducen,antesusorpresa,laspautaseducativasqueellos
mismos recibieron de pequeos. Esta reproduccin, que puede ser inconsciente e irre-
fexiva,ponedemanifestohastaqupuntolaaplicacindeunestiloeducativoestcon-
dicionadapornumerosasvariablesinternasqueinclusoescapananuestrocontrol.Otras
variablesqueincidenenestaeleccintienenqueverconlosrasgosdepersonalidadde
loshijos.Aunqueelestiloeducativodelospadressueleserconsistente,sinembargo,se
adaptaalosdiferenteshijosenfuncindesusrasgosdepersonalidad.Otrascaractersti-
casdeloshijos,comoporejemplo,elgneroyelordendenacimiento,tambininfuyen
enlaspautaseducativasqueseadoptan.Losajustesqueserealizanconcadahijosobre
elestiloeducativoempleadounidoalasdiferenciasdepersonalidadentreellosylare-
percusindelosestilosencadauno,explicanenpartelasdiferenciasqueluegoseob-
servanentrehermanos.Porltimo,elentornoculturalyeconmicotambininfuyeen
la adopcin de un estilo educativo. Las familias que poseen pocos recursos y soportan
problemassocialesgravescomopobreza,desempleo,etc.nopodrninvertirelesfuerzo
querequiereelestilodemocrticoyrecurrirnmsamenudoalaimposicindenormas
yalcastigocomoestrategiaeducativa.
3.2. Los amigos
Entrelos3ylos6aoslosniossuelenenfrentarseaunanuevaeimportantetarea:es-
tablecer relaciones con otros nios de su edad. Hasta este momento los nios no han
Captulo 7. El mundo social de 3 a 6 aos 201
creadoverdaderosvnculosdeamistad.Aunqueentrelos2ylos3aossepuedenesta-
blecerinteraccionesclidasyenocasionesduraderasconalgunoscompaeros,general-
mente los nios de estas edades no disponen de las habilidades cognitivas ni sociales
necesariasparapoderestablecerverdaderasamistades.Apartirdelos3aos,sinembar-
go,yconelcomienzodelaescolarizacin,losniospodrnsumergirseenlacomplejidad
delasocializacinydelaamistad.
Losestudiosmsclsicossobrelasrelacionesinfantilessealanquelasamistadesen
estaetapasonmsbienrelacionesocasionaleseinestables,pocoprofundas,dirigidaspor
losadultosygobernadasporelegocentrismo(Rubin,1980;Selman,1981).Apesarde
quemuyamenudolasamistadesinfantilesenestaetapaposeenestascaractersticas,a
estaedadlosnioscomienzanadesarrollarunaseriedehabilidadesbastantecomplejas
que les permiten relacionarse con los iguales estableciendo lazos ms profundos. As
pues,losniosdeestasedadespreferenjugarconunosniosdeterminadosydespliegan
conellostodaunaseriedehabilidadesquenoutilizanenotroscontextos.
Existendoselementosquepermiteneliniciodeestasnuevasrelaciones.Enprimer
lugar,elniopuedeempezarautilizarunaseriedeestrategias,comolanegociacino
lacooperacin,queposibilitanlainteraccinconlosdems.Elempleodeestasestrate-
giasvienedeterminadoporlaadquisicindenuevashabilidadessociocognitivasrelacio-
nadasconlaadopcindelpuntodevistadelotro.As,graciasaestedescensodelego-
centrismoyalarecientecapacidadparatenerencuentalospensamientos,sentimientos
e intenciones de los dems, los nios pueden establecer intercambios ms complejos,
negociar o sentir empata. En segundo lugar, el juego de fccin, que como veremos
constituyeunadelasprincipalesocupacionesdelniodeestaedad,proporcionaeles-
pacio ideal para la aparicin de relaciones ntimas. Cuando las relaciones que se van
creando a travs del juego son satisfactorias, aparecen los vnculos afectivos que dan
lugaralaamistad.
Los nios pequeos no se hacen amigos de cualquiera. Existen varios elementos que
facilitan o impiden el acercamiento y condicionan la eleccin de un amigo potencial. De
forma general, parece que los nios similares se hacen amigos. Esta similitud se concre-
ta en varios rasgos fcilmente observables: el gnero, la edad y el grupo tnico.
El gnero constituye en estas edades y hasta la adolescencia, el principal factor por
el cual los nios se guan para escoger amigos. En este perodo de construccin y ar-
macin de uno mismo, los nios se relacionan principalmente con otros de su mismo
gnero y las interacciones entre nios y nias son raras.
Por otra parte, los nios suelen relacionarse con otros de su misma edad que dis-
frutan de las mismas actividades, comparten los mismos intereses, etc.
El grupo tnico constituye tambin un importante factor a la hora de elegir amigos.
Dada la importancia del tema y su relativo desconocimiento, nos centraremos en este
aspecto. A partir de la dcada de 1940, diferentes estudios realizados en Estados Unidos
mostraron que desde los 4 aos, los nios manifestaban pautas claras y marcadas de
preferencias y rechazos a sus compaeros en funcin del color de piel. As, los nios
CON LOS PIES
EN LA TIERRA
Quieres ser mi amigo? Factores que
condicionan la eleccin de las amistades
202 Bloque II. El desarrollo durante la primera infancia
Entre los 3 y los 4 aos los nios descubren todo un universo ldico que pueden
compartir con los dems.A partir de este momento los iguales pasan a ser el mejor
compaerodejuegoylosadultosquedanrelegadosaunsegundoplano.Porqulle-
ga un momento en el que a los nios les interesa ms jugar con otros nios que con
adultos?Laclavedeestecambioestenlaaparicindeljuegodefccin(vaseEp-
grafe 4). Cuando el nio empieza a disfrutar de todas las posibilidades que ofrece el
juegodefccin,seencuentraconunadultodemasiadopegadoalarealidadquenole
sigueenlaimaginacindemundosfantsticosoenlaadopcindepapeles.Jugaralos
piratas,porejemplo,esmuchomsdivertidoconuncompaero,queestdispuestoa
saltarselasleyesdelmundorealeimprovisarenlosacontecimientosquevansurgien-
do,queconunadultoqueprobablementesevaalimitarareproducirelestereotipodel
pirataconvencional.
As pues, el juego de fccin, a travs del cual se inventan situaciones, se adoptan
papelesosereproducenescenarios,seconvierteenelespacioperfectoparacompartiry
blancos preferan como amigos nios de su mismo color de piel y rechazaban a los nios
de piel negra. Los nios de piel oscura o bien preferan a los nios blancos y rechazaban
a los de su propio grupo, o bien no mostraban una pauta de elecciones clara (Clark y
Clark, 1939). Los resultados de estos trabajos provocaron tal alarma social que consi-
guieron que en las escuelas estadounidenses se aboliera la segregacin racial. A pesar
de este importante logro social, desde entonces se han realizado numerossimos estu-
dios sobre el tema en diferentes pases y, en general, podemos concluir que las pautas
se mantienen. Por supuesto, con el tiempo se han producido cambios que responden a
las situaciones sociales que viven los diferentes grupos tnicos en sus pases de acogida.
Por ejemplo, hoy en Estados Unidos la mayor parte de los nios de piel negra ya pree-
ren nios de su mismo color de piel y rechazan a otros grupos. Los movimientos de
Derechos Civiles y el trabajo de revalorizacin social que se ha realizado dentro de este
grupo durante muchos aos ha conseguido que estos nios puedan sentirse, al igual
que los de piel blanca, ms orgullosos de su grupo de referencia. No obstante, la pauta
observada en los nios de piel negra hacia 1940 la reproducen hoy los nios latinoame-
ricanos que viven en Estados Unidos.
En nuestro pas tambin se han recogido datos con nios pequeos y se han en-
contrado resultados similares: ya en 1997 nios espaoles de 5 aos preferan a nios
de su mismo grupo y rechazaban a los de piel oscura (Gimnez-Das, 1999). Estos re-
sultados sorprenden por dos motivos principales: la fecha del estudio y la edad de los
nios. Hace diez aos, cuando en Espaa prcticamente no haba mezcla entre grupos
tnicos diferentes y por tanto no poda haber conictos, los nios de 5 aos ya
utilizaban el color de piel como un rasgo determinante de sus preferencias y sus recha-
zos. Es decir, estos nios haban asimilado perfectamente los estereotipos y prejuicios
que invaden nuestro mundo viviendo incluso en un contexto sin mezcla ni conicto.
Qu ha ocurrido en estos aos en Espaa? Estudios recientes han indagado las prefe-
rencias y rechazos de los nios latinoamericanos que residen en Espaa, encontrndose
resultados que recuerdan los de Estados Unidos. As, en un estudio realizado en Madrid
con nios latinoamericanos de diferentes edades, los de 4 y 5 aos fueron los que ex-
presaron mayor preferencia por su propio grupo llegando al 33 por 100 (Gmez, en
preparacin). Adems, todos los nios expresaron preferencias marcadas por los espa-
oles de piel blanca y un claro rechazo hacia los nios de piel negra.
Captulo 7. El mundo social de 3 a 6 aos 203
comenzaraintimarentrenios.Atravsdeestosintercambiosldicoslosniossehacen
amigos,esdecir,construyenrelacionesntimasycompartenintereses.Apartirdelos5
aos,ademsdecompartireljuego,losnioscomienzanaintercambiarpensamientos
ysentimientosdeformamsexplcita.Apartirdeestaedadseobservaungranincre-
mentoenlafrecuenciadelasconversacionessobrepensamientos,recuerdos,sentimien-
tosycreenciasconlosamigos.Adems,estasconversacionessedanconmsfrecuencia
entreamigosqueconmiembrosdelafamilia(Dunn,2004).Porotraparte,losniosde
estasedadesqueyamanejanestrategiasdecooperacinoquesoncapacesdeprovocar
enfadoenlosdems,nosecomportanigualcuandoestnconunamigo,conunherma-
nooconunadulto.Porejemplo,lasestrategiasdeconciliacinylaconsideracindel
puntodevistadelotroaparecenconmsfrecuenciacuandohayconfictoconunamigo
queconunhermanooconunadultocomolamadre.Sinembargo,lasconductascuyo
fnesmolestarofastidiaraotrosedanmsamenudoentrehermanosqueentreamigos
(Dunn, 2004). Estas diferencias a la hora de ajustar la propia conducta y producir un
efectoenotraspersonas,ponendemanifestounconocimientobastanterefnadoacerca
delasrelacionessociales.Enconcreto,parecequelasrelacionesentreamigospromue-
venlautilizacindeestrategiasmsorientadashacialaarmonaenlarelacin.Segura-
menteaspectoscomolaigualdadqueexisteentrelosniosalahoradeinteractuaryla
calidademocionaldesurelacindeterminanlaaparicindeestasestrategiasmspro-
sociales.
3.2.1. El ajuste en las relaciones sociales: nios queridos
y nios rechazados
Comovemos,saberconquinseinteracta,questrategiassedebenadoptaryqufnes
sequierenalcanzarempiezayaaserimportanteparaconvertirseenunapersonasocial-
mentecompetente.Desdeedadestantempranascomolos4y5aos,sepuedenidentif-
car los nios que tienen xito social y los que son rechazados porque tienen estilos de
interaccinmuydiferentes:unoesajustadoyfuncionamientrasqueelotroproducere-
chazo. Cmo son estos estilos de interaccin? Los nios populares son hbiles a la
hora de introducirse en un grupo o acercarse a un desconocido. No son intrusivos, no
agredenypersisteninclusocuandonosontanbienacogidoscomoesperaban.Adems,
sonexpresivos,alegresyproponenactividadesqueresultanatractivasalosdems.Cuan-
doaparecenconfictossemuestranatentosalasopinionesyemocionesdelosdems,se
comunican con facilidad, saben escuchar, negocian y proponen soluciones razonadas y
justas.Endefnitiva,losniospopularessonlosquetienenlascualidadesquesedesean
enunamigoyporesolosconsiguenconfacilidad.
Alosniosrechazadoslesocurretodolocontrario.Suelenserniosquenodisponen
delashabilidadesnecesariasparaintroducirseenlosgruposysepresentanantelosde-
msde forma agresiva e intrusiva. En general, los nios poco valorados por los dems
suelenestarporencimadelnivelmediodeagresividad.Adems,puedenpresentarcon-
ductasantisocialesysuelenproponeractividadespocoadecuadasparaelgrupoquepue-
denmolestarlaactividadoresultarextraas.Estosniostienenpocashabilidadespara
negociaryencontrarsolucionesylescuestaentenderelpuntodevistadelotro,susemo-
ciones,susdeseoseintenciones.
204 Bloque II. El desarrollo durante la primera infancia
Aspues,desdeeliniciodelasrelacionessocialesencontramosgrandesdiferencias
enlahabilidadpararelacionarseconlosdems.Porquexistendiferenciastanmar-
cadasentreniostanpequeos?Qufactoresinfuyenenlacompetenciasocialdelos
niosdeestasedades?Existenvarios.Porunaparte,numerososestudioshanmostrado
que los nios ms competentes en el plano social obtienen puntuaciones ms altas en
pruebas de teora de la mente. Es decir, los nios populares entienden y diferencian
mejor las intenciones, los deseos, las creencias y los pensamientos propios y ajenos
(DunnyCutting,1999;HughesyLeekam,2004;JenkinsyAstington,2000;Lalondey
Chandler, 1995, entre otros). Por otra parte, muchos trabajos tambin han encontrado
que los nios populares entienden mejor sus emociones y las de los dems y son ms
hbilesalahoradeexpresaremocionesadecuadasalcontextoycontrolarlasinapropia-
das (Cassidy, Parke, Butkovsky y Braungart, 1992; Denham, McKinley, Couchoud y
Holt, 1990; Dunn y Herrera, 1997; Edwards, Manstead y MacDonald, 1884; Hughes,
DunnyWhite,1998).Estosresultadosponendemanifestoquemanejarunabuenateo-
radelamenteyposeerunabuenacomprensinemocionalsondosingredientesclaves
paraelxitosocial.
Otrosfactoresqueinfuyenenlacompetenciasocialdelosniosestnrelacionados
con cuestiones del contexto, en concreto, de la familia. El tipo de apego que se esta-
bleceentrelospadresyelnio(vaseCaptulo4)esunbuenpredictordelacompe-
tenciasocialposteriorsiendolosniosconapegosegurolosmsbenefciados(Daz-
AguadoyMartnezArias,2006;Vasta,HaithyMiller,1996).Elestablecimientodeun
vnculo afectivo seguro tambin predice la calidad de la amistad.As pues, los bebs
con apego seguro tendrn ms posibilidades de ser nios socialmente competentes,
popularesydeestablecerrelacionessatisfactoriasconlosdems.Otroelementofami-
liarqueestrelacionadoconlacompetenciasocialeselestiloeducativodelospadres.
Los hijos de padres democrticos son los ms populares y mejor valorados por sus
compaerosenelcolegio(BergeryThompson,1995).Losefectosdelestilodemocr-
tico se dejan notar en varios mbitos que repercuten en la competencia social de los
nios. Por una parte, como ya vimos, estos nios desarrollan una buena autoestima
teniendo as la base a partir de la cual relacionarse satisfactoriamente con los dems.
Adems, los padres democrticos proporcionan apoyo afectivo y ofrecen un contexto
conunaaltaexpresividademocional,formandoasalosniosenlacomprensinyel
adecuadomanejodelasemocionespropiasyajenas.Porltimo,cuandoexistencon-
fictos los padres democrticos suelen razonar, negociar y cooperar para alcanzar un
acuerdo con sus hijos.A partir de estas formas de socializacin, los hijos de padres
democrticos utilizarn estas mismas estrategias principalmente porque no poseen
otrascuandoseencuentrenenunasituacindifcilconsuscompaeros.Endefniti-
va, una buena autoestima como base, una adecuada comprensin de las emociones y
herramientasparanegociarycooperarconsiderandolaposturadelotrosontrescarac-
tersticasquefomentaelestilodemocrticoyquerepercutenenloshijos,ayudndoles
ahacerseamigosydevenirpopulares,esdecir,asersocialmentecompetentes.
Captulo 7. El mundo social de 3 a 6 aos 205
A partir del ao y medio, los nios pueden realizar conductas de ayuda y apoyo a otros.
Por ejemplo, cuando un nio llora o est triste pueden intentar consolarle ponindose
a su lado, abrazndole, preguntndole qu le pasa, etc. Para poder realizar este tipo de
conductas es necesario darse cuenta de cmo est el otro, sentirse implicado con l y
pensar que se le puede ayudar a sentirse mejor. Estas tres capacidades son bastante
complejas y aunque se observan de forma rudimentaria desde temprano, entre los 3 y
los 6 aos se van aprendiendo respuestas cada vez ms apropiadas y se van compren-
diendo estados mentales y emocionales cada vez ms sosticados. Como acabamos de
sealar, para ayudar a otro antes hay que darse cuenta de que tiene una necesidad, es
decir, es necesario adoptar su punto vista. Muy relacionada con esta toma de perspec-
tiva se encuentra la empata, que se reere a la experiencia de los sentimientos ajenos
en uno mismo. Estos dos elementos son denitivos para llevar a cabo conductas proso-
ciales y altruistas. Los nios que tienen facilidad para ponerse en el punto de vista de
otro y que sienten de forma intensa las emociones de los dems, tienden a ayudar ms
a menudo. No obstante, sentir empata no garantiza ayudar a otra persona, ya que
existen otros elementos que estn implicados en este proceso. Estos son (Kail y Ca-
vanaugh, 2003):
El sentimiento de responsabilidad: los nios ayudan ms cuando se sienten res-
ponsables de la persona que se encuentra mal. As, por ejemplo, ayudarn ms
a menudo a sus amigos que a desconocidos.
La sensacin de competencia: poseer las estrategias necesarias para poder prestar
una ayuda ecaz condiciona la aparicin de la ayuda. Si un nio se enfada porque
no consigue poner una pelcula en el DVD necesitar de un compaero ms com-
petente. Quien no sepa manejar el aparato no podr ayudarle.
El estado de nimo: los nios que se sienten competentes y estn contentos ayu-
dan ms a menudo que los que estn tristes o sienten que han fracasado.
El coste de la ayuda: los nios se comportan de forma altruista cuando el coste
es pequeo o moderado. A un nio le cuesta ms compartir su golosina preferi-
da que otra menos querida.
Con estos elementos, cmo se puede promover el altruismo y la conducta pro-
social en nios pequeos? Por una parte, se pueden fomentar las habilidades relacio-
nadas con la teora de la mente que incluyen adoptar el punto de vista ajeno y
sentir las emociones de los dems. Razonar con los nios, tanto en la escuela como
en casa, por ejemplo, cuando surgen problemas parece ser muy ecaz. Si a los nios
se les explica las consecuencias materiales, pero sobre todo emocionales que tie-
nen sus conductas en los dems, aprenden a adoptar otra perspectiva y a sentirse
responsables frente a los otros. Adems, disponer de modelos adultos que ayudan y
son altruistas es una excelente inuencia para los nios. Cuando los adultos expresan
preocupacin por los dems, los nios aprenden a ser empticos; cuando los adultos
se comportan de forma altruista y ofrecen apoyo, los nios aprenden a ayudar, a com-
partir y a ser menos crticos con los dems. Por ltimo, cuando los adultos premian y
alaban las conductas altruistas de los nios les hacen sentir competentes y refuerzan
su autoestima. Como ya hemos visto, una buena autoestima, un buen estado de ni-
mo y una sensacin de competencia son elementos que promueven las conductas
prosociales.
CON LOS PIES
EN LA TIERRA
Fomentando la competencia social:
empata, conducta prosocial y altruismo
206 Bloque II. El desarrollo durante la primera infancia
4. El juego
Entrelos3ylos6aos,losniospasancasitodosutiempojugando.Eltipodejuegoque
principalmente les ocupa es el juego simblico o de fccin. Este juego supone actuar
comosiuncomportamientoounobjetofueranotracosa(Bretherton,1984).Entrelos15
y18meses,losniosempiezanautilizarsmbolosdeformaldica:utilizanobjetoscomo
sifueranotracosaofngenescenassimples.Porejemplo,puedenhacerquecomenco-
giendocomidadeunplatovaco,puedenhacercomosisepeinaranpasndoseunlpiz
por el pelo o pueden simular que hablan por telfono ponindose la mano en la oreja y
emitiendo sonidos.Todos estos son ejemplos de las formas ms tempranas y simples de
juegosimblico.Enunprimermomento,enestetipodejuegoelniorealizaaccionesco-
tidianasmuyconocidassobresmismo.Estasmismasaccionessepuedentrasladaraotros,
generalmentemuecos,alosquesedadecomer,sepeina,seacuesta,etc.Hacialos3aos
losniosyarealizanjuegosimblicoperotodavanosoncapacesdecoordinarseentres
yjuegandeformasolitaria.Estetipodejuego,denominadoenparalelo,essegnalgunos
autorescomoPiaget,unrefejodelegocentrismointelectualpropiodeestaetapa.Cadanio
estaracentradoensupropiaactividadynosecomunicaconlosdems.
Hacialos4aos,eljuegodefccinempiezaaorganizarseentrevariosjugadoresy
aborda temas ms complejos e interesantes. El juego simblico adquiere entonces otro
matizysepuededenominarsociodramtico.Estejuegosimblicosecaracterizaporque
losjugadoresencadenansusaccionesconsiderandolasconductassimblicasdelosde-
ms(Garvey,1977).Losniosempiezanarepresentardiferentessituacionesmsome-
nosconocidascomolasmams,lostenderos,losmdicos,etc.Atravsdeestosescena-
rios actan como si fueran otras personas, es decir, adoptan otras personalidades, otros
puntos de vista, otros paisajes emocionales y exploran los elementos y variables de la
vidareal.Medianteestosjuegoslosnioscomprenden,aprendenyensayanlospapeles
socialessinestarexpuestosapeligrosnialasconsecuenciasrealesdelasacciones.Para
queelresultadodeestetipodejuegosimblicoseasatisfactorio,losniosnecesitanes-
tablecer una estrecha colaboracin y coordinar sus acciones (Garvey, 1977). Para eso
empleanunasreglasdeterminadas:antesdeempezarajugardecidirneltema,sepon-
drn de acuerdo sobre qu papel desempear cada uno y sobre cmo transcurrir la
accin. Los nios de estas edades preferen refejar la realidad a travs del juego y se
reprendern unos a otros cuando las acciones se desven de esa realidad.An as, los
acuerdos que guan el juego suelen ser fexibles y los participantes estn dispuestos a
modifcarlos, transgredirlos e improvisar situaciones nuevas que se van creando al hilo
delpropiojuego.
Unodelosaspectosquecondicionancmoseorganizaeljuegodefccintieneque
verconlosestereotiposdegnero,queyaaestasedadesmarcangrandesdiferenciasen
lasactuacionesdeniosynias.Aunqueacabamosdemencionarqueeljuegoesfexible
yestabiertoamodifcacionesespontneas,sinembargo,existenconvencionessociales
asociadasalgneroquelosniosnosuelensaltarse.Asporejemplo,serextraoque
unnioactedemadreorealiceconductasasociadasalasmujeres.Enocasiones,inclu-
so,lospropiosjugadoresexplicitarnlasconductasquenoresultenadecuadasenfuncin
delgnero.Duranteestosaos,losniosylasniasjueganseparados,muestranestilos
de interaccin diferentes y preferen de forma muy marcada compaeros de juego del
mismosexo.Enelsiguienteepgrafevolveremossobrelascuestionesdegnero.
Captulo 7. El mundo social de 3 a 6 aos 207
Atravsdeljuegodefccinelniotambinexploraaspectosdelarealidadquele
preocupanoleatemorizan,comolaoscuridadolamuerte,ypracticacuestionesrelacio-
nadasconelconocimientopsicolgicoquevaadquiriendo.Porejemplo,unniopuede
reconfortaraunmuecoexplicndolequenopasanadaporbajaralstanoaunqueest
oscuroyquelosmonstruosnoexisten.Atravsdeestasfccioneselnioatribuyeemo-
cionesaotros,controlalaspropiasylograconvencerseasmismoadoptandolaperspec-
tivaquesuelentomarlosadultosanteestascuestiones.Otrojuegotpicopuedesercas-
tigaraunmuecoporquesehaportadomal.Losniosexploranatravsdeestafccin
lossentimientosdeculpacuandonohacenloqueseesperadeellosyadoptantambin
elpuntodevistadeladultoqueaplicalasnormaseimponelassanciones.Endefnitiva,
atravsdeestosjuegos,losniosexploransustemores,emocionesycreenciasypracti-
cansituacionessocialesadoptandoperspectivasdiferentesalapropia.
Eljuegodefccinsevahaciendoconeltiempomsymscomplejo.Estacomple-
jidadsetraduceenunadescontextualizacincadavezmayor.Enunprincipiolosobjetos
resultanimportantesparajugar,perolosniosvanempleandocadavezmsellenguaje
paracrearescenariosysustituirobjetos.Deestaforma,losniosde5y6aospodrn
representar papeles y construir escenarios complejos y poco conocidos. Por ejemplo,
podrn organizarse para jugar a los astronautas aunque no dispongan de ningn objeto
relacionadoynosepanexactamentequhaceunastronautaocmoeselespacio.
Esta progresiva descontextualizacin es posible gracias a las estructuras cognitivas
que se van adquiriendo y al desarrollo del lenguaje (Harris y Kavanaugh, 1993), pero
tambinlaprcticadeljuegodefccinfavoreceeldesarrollodecapacidadesintelectua-
lescomoellenguaje,lateoradelamente,lamemoriayelrazonamiento(KailyCava-
naugh,2003).Porotraparte,laintervencindelosadultoseneljuegopuedefavorecer
el desarrollo de capacidades cognitivas y sociales en el nio. Por ejemplo, si un nio
juegaaconstruirunatorreconbloquesestejercitandolamotricidadfna,laplanifcacin
delaaccin,lacoordinacin,etc.,perosiunadultocogelosbloquesylosconvierteen
vasos para beber limonada, est incitando al nio a jugar en un nivel superior. En otro
sentido,cuandodosniosjueganjuntosysurgenconfictos,lamediacindeunadulto
queayudeaconciliar,negociarybuscarunasolucinintermediacontribuiralaadqui-
sicindehabilidadessocialesyaldescensodelaagresividad.Aspues,laintervencin
deladultoeneljuegoinfantilpuedeconstituirunaformadeandamiaje,deformaqueel
nioseapoyaraenestructurascognitivasprestadasparaactuarypensarenunnivel
superior.
Entre los 3 y los 6 aos, los nios pasan gran parte de su tiempo inmersos en un mun-
do en el que las reglas y las leyes de lo real se desafan continuamente. Cuando los ni-
os juegan a ser personajes fantsticos son capaces de traspasar paredes, volar o ver
a travs de objetos. Las pelculas y las historias infantiles estn plagadas de seres con
poderes mgicos que pueden desaparecer, poseen un conocimiento ilimitado o viven
eternamente. En principio, parece que la mayor parte de los nios separan el mundo
CON LOS PIES
EN LA TIERRA
Existen las hadas y las brujas? La
distincin infantil entre realidad y ccin
208 Bloque II. El desarrollo durante la primera infancia
real y el cticio y no intentan aplicar las reglas que funcionan en uno para conseguir
metas en el otro. As, si por ejemplo un nio desea ir al cine intentar convencer a sus
padres para que le lleven y no probar a transportarse mediante mecanismos mgicos.
Sin embargo, todos los nios han tenido alguna vez miedo de los monstruos que se
esconden en los armarios o esperan debajo de la cama, han credo durante algunos
aos en la existencia real de los Reyes Magos y han pensado que las hadas tie nen
poder para conceder deseos. As pues, la cuestin principal que nos planteamos aho-
ra es existen fronteras claras entre la ccin y la realidad en el razonamiento infan-
til?
Muchos estudios han intentado resolver esta cuestin y parece que se puede dar
una respuesta clara aunque matizada: en la mayor parte de las situaciones los nios
distinguen la ccin de la realidad pero existen algunos elementos de confusin para
los pequeos. Los nios mantienen elementos contradictorios en las explicaciones sobre
algunos acontecimientos del mundo en el que viven porque se les anima tanto a creer
en la ccin como a mantener concepciones ms orientadas hacia la realidad. Los adul-
tos proponemos explicaciones mgicas cuando consideramos que vale la pena que el
nio crea en algo cticio como los Reyes Magos pero tambin las desmontamos
cuando juzgamos que no conviene fomentar la creencia como en el caso de las bru-
jas o los monstruos. No obstante, cuando el nio es quien inventa su contexto cticio
es raro encontrar confusin. El juego de ccin es un claro ejemplo en el que el nio se
muestra lcido en su distincin a pesar de la gran implicacin emocional que supone.
Incluso en los casos que podramos denominar extremos de juego de ccin, en el
que los nios crean personajes imaginados con los que mantienen una estrecha amistad
y comparten muchas actividades, la conciencia de su naturaleza cticia es siempre clara.
El control que mantiene el nio en su creacin cticia parece ser un elemento clave en
la diferenciacin.
As pues, los adultos podemos inducir al error e impulsar al nio a investigar la exis-
tencia real de los seres cticios cuando el contexto es propicio. Si el nio encuentra la
ocasin de comprobar si hay un monstruo debajo de la cama o de probar la ecacia de
las palabras mgicas, no la desaprovechar. Estas conductas reejan, efectivamente, la
confusin del nio y la duda sobre la existencia real de aspectos cticios.
Con el tiempo y la conuencia de varios elementos, los nios terminan por con-
vencerse de la irrealidad de la ccin. En primer lugar, los adultos comienzan a des-
montar las creencias mgicas y a sustituirlas por otro tipo de explicaciones. Para todos
los nios llega un momento en el que los Reyes Magos dejan de existir. Adems, la
educacin formal insiste ao tras ao en la conguracin de un sistema racional y
cientco que, sin duda, organiza de manera coherente las explicaciones sobre el mun-
do en la mente infantil. Las demostraciones cientcas son ms convincentes y termi-
nan por imponerse porque, por otra parte, todas las exploraciones que los nios rea-
lizan cada vez que pueden llevan siempre al mismo resultado decepcionante: ni las
hadas ni las brujas ni los monstruos existen. Ningn nio consigue obtener pruebas
ables sobre la existencia de los seres cticios ni sobre la ecacia de los conjuros. Al
contrario, lo que s obtienen son explicaciones alternativas que permiten entender los
fenmenos mgicos de una forma ms realista. Ahora bien, signica este abandono
de la causalidad mgica una renuncia total de la ccin? Se puede decir que los
adultos mantienen nicamente creencias racionales y que el pensamiento mgico des-
aparece de su sistema cognitivo? Sin duda, la ccin se sigue manifestando durante
la vida adulta provocando intensas reacciones emocionales y el pensamiento mgico
muchas veces inunda el razonamiento adulto plagndolo de creencias y supersticiones
cticias.
Captulo 7. El mundo social de 3 a 6 aos 209
Antesdeterminaresteapartadoqueremossealarquemuchosniosdeestasedades
preferen jugar con otros, precisamente para compartir y crear estos espacios ldicos,
aunqueeljuegodefccincompartidonoocupatodosutiempoyexistenmuchasdife-
renciasindividuales.Engenerallosniossuelendisfrutardeljuegosimblicocomparti-
doperotambinbuscanespaciosdejuegosolitario.Elqueunniopreferajugarsolono
debesermotivodepreocupacinens,aunquehayciertaspautassolitariasquepueden
indicarunaausenciadehabilidadessociales.Porejemplo,losnioscuyapautadejuego
habitualesdeambularsolosdeunaactividadaotraperosindetenersearealizarninguna
ylosniosqueprincipalmenteobservanjugaraotrosniosperonoparticipan,pueden
necesitarunentrenamientoquelesproporcionelasestrategiasnecesariasparaintroducir-
seenungrupoocolaborarconotros(KailyCavanaugh,2003).
Tabla 7.1. Comparacin de los aspectos tericos del juego entre Piaget y Vygotski
El juego visto por Piaget El juego visto por Vygotski
SegnPiaget,eljuegoquerealizaelnioesun
refejo de sus estructuras cognitivas. Una vez
queelnioescapazdeutilizarsmbolos,puede
realizarjuegosimblicoodefccin.
Unadelasfuncionesdeljuegoesconsolidarlas
estructurasintelectualesquesevanadquiriendo
a lo largo del desarrollo. Tambin lo considera
unaproyeccindecuestionesinternasyunafor-
madeexplorarlarealidad.
Eneljuegopredominalaasimilacin.
Unadelascrticasrealizadasalavisinpiage-
tianadeljuegoeslaescasaimportanciaquecon-
cedealainteraccinentreiguales.
ParaVygostki el juego simblico es la realiza-
cin inmediata, a travs de la imaginacin, de
deseosirrealizables.
El juego no es, por tanto, una actividad inte-
lectual.
Aunque no es la actividad primordial del nio,
el juego simblico es en la primera infancia la
fuenteprincipaldedesarrollo.Atravsdeljuego
simblicoelniocreazonasdedesarrolloprxi-
moquefomentansudesarrollo.
Eljuegosimblicosurgedelasideasynodelos
objetos. La separacin de la percepcin directa
esunadesuscaractersticasprincipales.
5. La identidad de gnero
Una de las categoras bsicas que organiza nuestra sociedad es el gnero, es decir, las
ideasyconvencionessocialesligadasalsexobiolgico.Paralagranmayoradelosadul-
toslasactitudesyestereotiposasociadosalgneroestntaninteriorizadosquemuchas
vecesseadoptanysetransmitencasideformaautomtica.Nacerniooniacondiciona
enlosadultosyentodalasociedadunaseriedeconductas,atribucionesyexpectativas
quemarcarndemaneradefnitivaeldesarrollodelapersonalidadylaidentidaddelin-
dividuo.
Lasideasacercadeloquedebenhacerrolesdegneroocmodebenseres-
tereotiposdegnerohombresymujeresjuntoconlasconductasqueculturalmente
seconsideranapropiadasacadagruposeaprendendesdemuytemprano.Alavezque
elniovainteriorizandoestosestereotiposyrolesdegnerovatambinidentifcndose
con uno de los dos grupos, formando as su identidad como nio o nia. Hacia los 2
aos,losniosyareconocenaloshombresylasmujeresytambinsabensiellosmis-
mossonniosonias.Desdeestaedad,oinclusoantes,losniospreferenjugarcon
210 Bloque II. El desarrollo durante la primera infancia
juguetesasociadosasugrupo.As,losniospreferenjugarconbloquesdeconstruccin
o camiones mientras que las nias preferen jugar con muecas. Un poco ms tarde,
como ya hemos visto, nios y nias preferen como compaeros de juego a los de su
mismosexo.Tambindesdelosiniciosdeljuegosimblicolosrolesqueserepresentan
estntipifcados,estoes,lasniassuelen,porejemplo,hacerdemamsylosnios
depaps.
Entrelos3ylos6aoslosniosaprendenmuchasmscosasacercadelgnero.Este
aprendizajeculminaraosmstardeconlaadopcindeunaidentidaddegneroque
se puede defnir como el conjunto de valores, actitudes, estereotipos y roles ligados al
grupodereferenciavaronesomujeresconlosqueunosereconoce.Laidentidadde
gneroesuncomponentemsdelautoconceptojuntoconelrestodeloselementosque
conformanlavisindeunomismo.Pero,cmoseconstruyeestaidentidaddegnero?
Mediantequvassetransmitenesosvaloresyactitudes?Diferentesteorashaninten-
tadoexplicaresteproceso.
Segnelpsicoanlisis,delos3alos6aoslosniosseenfrentanconlaetapaflica.
En esta fase aparece en los nios el complejo de Edipo, llamado as en honor al mito
griegoenelqueEdiposinsaberlomataasupadreysecasaconsumadre.ParaFreud,
alprincipiodelavidalosbebsestnunidosdeformasimbiticaconsumadreysienten
quetodoelafectodelamadreesparaellos.Hastalos2aoscreenquelamadreesex-
clusivamentesuya,peroapartirdeestemomentoapareceunrivalquepretendequitarle
elcarioexclusivodelamadre:elpadre.Ascomienzaunarelacintriangularenlaque
elniosienteagresividadporelpadreyalaveztemesercastigadoporl.Estemiedoa
sercastigadoporsentiragresividadhaciaelpadreseexpresaenlaterminologaanaltica
comomiedoalacastracin.Noesunmiedoaquenoscastreslogenitalmente,sino
aquenosdestruya,puestoqueesunrivalmuypoderoso.Elnio,ensufantasa,siente
queentraenrivalidadconungigante(FernndezVillamarzo,1978).Noobstante,elpa-
dreconstituyeunafguraesencialenlavidadelnioynecesitasolucionaresteconficto.
Laformaqueencuentradesolucionarloesinternalizarlaprohibicindelamadreeiden-
tifcarseconelpadre.Deestaforma,silmismoseprohbealamadre,elconfictocon
el padre desaparece. Esta prohibicin pasar a formar parte de los imperativos morales
delsuperyo.Alinternalizarlaprohibicindelamadreseproducelaidentifcacincon
unodelosprogenitores,queenlasniassuelesermsfuerteconlamadreyenlosnios
conelpadre.Aspues,duranteestaetapalosniosadquierensuidentidadsexualpref-
riendorealizaraccionestpicasdesusexoeidentifcndoseconlaspersonasdesumismo
sexo.
Lasteorasdelaprendizajemantienenquelosniosaprendenacomportarsecomo
varonesomujeresenfuncindeloquelosadultosylasociedadlesensea.Tantolos
adultos,comolosigualesylosmediosdecomunicacin,transmitenpermanentemente
estereotipos y valores ligados al gnero que los nios van interiorizando. Los padres,
por ejemplo, refuerzan y premian las conductas acordes con el estereotipo de gnero
mientras que critican o castigan las conductas que no se ajustan a lo que se espera de
unnioodeunania.Enestesentido,algunosestudioshanmostradoquelospadresy
lasmadresnosecomportandelamismaformaconsushijosehijas(KailyCavanaugh,
2003).Aunqueambossonigualdecariososyfomentanlaindependenciaensushijos
ehijas,existenciertasdiferenciasdetratoligadasalgnero.Porejemplo,losjuegosque
se fomentan en nios y nias son distintos y las tareas de casa tambin se asignan en
Captulo 7. El mundo social de 3 a 6 aos 211
funcin del sexo de los hijos. En general, parece que los padres tienden ms que las
madres a tratar a sus hijos e hijas en funcin de los estereotipos de gnero. As por
ejemplo, los padres sern ms crticos si su hijo juega de forma femenina, pero fo-
mentarnlasensibilidaddesushijas.Lasmadres,alcontrario,parecentratarasushijos
e hijas ms en funcin de sus caractersticas y necesidades personales que en funcin
delosestereotiposdegneroynocriticarnelllantodesuhijosi,porejemplo,respon-
deaunafaltadeseguridad.
Otro elemento que contribuye a este aprendizaje de la identidad de gnero son los
iguales.Comohemosvisto,eljuegoylaorganizacindelosgruposenestasedadesse
realizanenfuncindelsexo.Niasyniospreferenjugarconcompaerosdesumismo
sexo. Esta separacin hace que cada nio o nia pase la mayor parte de su tiempo con
otros de su mismo sexo, aprendiendo precisamente de sus iguales, consolidando las
semejanzasdentrodesugrupoyenfatizandolasdiferenciasconelotro.Estaseparacin
ayudaalaconstruccindelapropiaidentidadyareforzarelsentimientodepertenencia
aungrupo.Ademsdeinteriorizarlopropiodecadagrupo,mediantelainteraccincon
losiguales,losniosaprendenquconductasseconsideraninadecuadasporelgrupoy
susconsecuencias.Yadesdeestasedadeslosniosmarginanycriticanaaqulloscuyo
comportamientonorespondealosestereotiposdegnero,especialmentealosniosque
realizanconductasasociadasalasnias.
Porltimo,lostericosdeaprendizajesocialconsideranquelosniosaprendenmu-
chosaspectossobreelgneroobservandoeimitandolasconductasquevenasualrede-
dor.Lospadressuelenserlosmodelosquelosniostienenmsamanoydeellosimitan
conductas e integran valores que el adulto reproduce, en muchos casos, sin tomar con-
ciencia.
Losmodeloscognitivossecentranencmoentiendenlosnioslasdiferenciasentre
hombresymujeresparaconstruirsuidentidaddegnero.Desdeestepuntodevista,al-
gunosautoreshanplanteadolanecesidaddecomprenderelsexocomounrasgoinmodi-
fcablealolargodelavidaantesdepoderadoptarunaidentidaddegnero.Esdecir,los
niospequeosdebenentenderqueelsexoesunrasgopermanenteparapoderatribuir
rasgosyconductasacadaunodelosgruposeidentifcarseconunodeellos.Estacom-
prensin del sexo como un rasgo permanente, denominada constancia de gnero, se
suele adquirir hacia los 5 aos (Bem, 1989). Sera, pues, a partir de esta comprensin
cuandolosniosempezaranainteresarseporlosrasgoscaractersticosdecadagnero
yaadaptarsuconductaenfuncindelosrolespropiosdesugrupo.Noobstante,algunos
estudios han mostrado que antes de comprender la constancia de gnero los nios se
comportandeacuerdoconlosrolesasociadosasugrupoyconocenmuchosdeloseste-
reotipos de gnero que regulan la conducta de los hombres y las mujeres (Berger y
Thompson,1995).
Este problema ha llevado a una reformulacin de las teoras cognitivas que se han
centradoenelconceptodeesquemadegnerocomounidadexplicativaprincipaldela
adquisicindelaidentidaddelgnero.Unodelosaspectosenlosquelosniossefjan
cuandoconstruyensusesquemasdeconocimientosobrelaspersonassonlosrelacionados
conelgnero.Losesquemasdegnero,pues,sonelconjuntodeconocimientosquese
vanadquiriendoenrelacinconelgnero,incluyenestereotiposyrolesydarnlugara
laidentidaddegnero.Estosesquemasdegnero,quesevanadquiriendodeformapro-
gresiva,ayudantantoacomportarsedeformaadecuadacomoapredecirlaconductade
212 Bloque II. El desarrollo durante la primera infancia
losdems.Porejemplo,hacialos2aos,losniosyaposeenelconocimientosufciente
comoparapodercategorizaralaspersonasenhombresomujeresenfuncindelaspec-
tofsico.Esteesquemadegnerobsicoseirhaciendomssofsticadoamedidaqueel
nioincorporeinformacinrelacionadaconelgneroqueleayudeacomprenderaspec-
tos ms complejos. Por ejemplo, hacia los 3 o 4 aos muchos nios y nias ya habrn
integradoasuesquemadegneroquecuidaralosbebsesunatareaasignadasobretodo
a las mujeres. Igualmente, muchos nios y nias a esta misma edad ya se habrn dado
cuentadequeloshombresseocupanmsamenudodecuestionesmecnicascomoarre-
glarelcoche.Estasrepresentacionessobreloqueespropiodehombresymujeresguan
laconductadelosniosalavezquesevanformandounaideasobresmismoscomo
niosonias.Losesquemasdegneroseadquierenmuyprontoporquenuestrasociedad
establecemuchasdistincionessignifcativasentrehombresymujeresquelosniosper-
ciben desde temprano, pero son instrumentos que se emplean toda la vida. Durante la
edadadultalosesquemasdegnerotambindirigirnlasconductas,expectativas,atribu-
ciones y valoraciones que se hagan sobre lo que es propio de las mujeres y lo que es
propiodeloshombres.
6. El pensamiento moral
Apartirdelos2aos,oinclusoantes,losniosyasabenqueciertasconductassonre-
probadasporlosadultos.Lamayorpartedelosadultosregaanalnioquepegaydes-
aprueban las muestras de egosmo animando a compartir con los dems.Adems, los
adultos imponen gran cantidad de normas en cuya elaboracin el nio no interviene y
cuyafnalidadprobablementeselesescapa.Porejemplo,lasnormasdehigiene,dese-
guridad o de respeto hacia los dems no tienen, probablemente, mucho sentido para el
nio,perorigensuvidadesdemuytemprano.Apartirdelasvaloracionesylasnormas
impuestasporlosadultos,losniosvandesarrollandounpensamientoocriteriomoral,
esdecir,vanaprendiendoloqueestbienyloqueestmal.
Piaget(1932)dedicpartedesuobraaestudiarenprofundidadcmoentiendenlos
niosaspectosmoralesrelacionadosconlajusticia,lamentiraoelrobo.Paraelloplan-
teabaunaseriedehistoriasypreguntabaalosnioscuestionescomoqudebanhacer
lospersonajes,culsehabaportadomejor,culmerecamayorcastigo,etc.Dadoque
eltrabajodePiagetofreceladescripcinmsdetalladasobreelrazonamientomoralen
estaetapadeldesarrollo,noscentraremosensuinvestigacinysusresultados.
Comohemosmencionado,elniovaaprendiendoloquesedebeyloquenosedebe
hacer a partir de las indicaciones que recibe de los adultos. Cuando los nios son pe-
queos,losadultosimponenmultituddenormasquerigenlaconductadelosniosen
todoslosmbitos.Enmuchasocasiones,losniospequeosnoentiendenelsentidode
estasnormaspero,dadalapresinqueejerceeladultoparasucumplimiento,losnios
nopuedensinoacatarlassinnegociarocuestionarlas.Enestesentido,Piagetcalifcla
moraldelniopequeocomounamoralheternoma,esdecir,unamoraldeobedien-
ciaalaautoridadquesedebealrespetoqueelniosienteporeladultoysebasaenel
cumplimientodenormasimpuestas.Estetipodemoraldecumplimientodenormasse
mantiene porque el nio percibe al adulto como una autoridad a la que es obligatorio
obedeceryquetienepoderparasancionarypremiar.Aunque,laorientacinmoraldel
Captulo 7. El mundo social de 3 a 6 aos 213
nioseharmsautnomagraciasalareciprocidadylacooperacinqueseestablece
en las interacciones con otros nios, la moral heternoma propia del nio pequeo se
mantienealolargodetodalavida.Durantelaedadadulta,granpartedelasnormasque
rigenlavidadelosciudadanossecumplenporpresindelaautoridadyporevitarlas
sancionesqueimpone.Aspues,aunqueelcriteriomoraldevienemuchomscomplejo,
laorientacinheternomapermanece.Enestesentido,Piagetnoconcibilamoralhe-
ternomaylaautnomacomodosetapasquesesucedeneneldesarrollosino,msbien,
comodosorientacionesquepuedencoexistir.Veamosacontinuacincmorazonanlos
niospequeossobrediferentesaspectosmoralesalosquePiagetprestespecialaten-
cin.
6.1. La intencionalidad y la responsabilidad objetiva
Unodelosprincipaleselementosquelosadultostienenencuentaaljuzgarunaconduc-
tacomoadecuadaoinapropiadaeslaintencindequienlarealiza.Si,porejemplo,un
nio empuja a otro sin querer, juzgaremos su conducta menos grave que si lo hace de
formaintencionadaparahacerledao.Piagetseinteresporlaconcepcininfantildela
intencionalidad y la responsabilidad a la hora de juzgar acciones. Para preguntar a los
niosporestascuestiones,lespresentabahistoriascortasconsituacionescotidianasyles
pedaquerefexionaransobrelasactuacionesdelospersonajes.Veamosunejemplode
estashistorias:
Historia I: Haba un nio que se llamaba Jules. Su pap no estaba. Entonces
Julestuvolaideadedivertirseconeltinterodesupap.Jugunmomentocon
laplumaydespusmanchunpoquitoelpaodelamesa.
HistoriaII:Unnio,quesellamabaAuguste,vioqueeltinterodesupap
estabavaco.Undaquesupaphabasalido,seleocurri,parahacerleunfavor,llenar
eltinteroparaqueelpapencontraratintaalvolver.Pero,alabrirlabotelladetinta,hizo
unagranmanchaenelpaodelamesa.
Estosnios,sonigualdemalosounodeellosesmsmaloqueelotro?Culdelos
dosesmsmaloyporqu?(Piaget,1932,p.105.)
Alformularestetipodepreguntasalosnios,Piagetobservquelospequeosemi-
tanjuiciosenlosquenoconsiderabanlaintencindelactorsinoslolasconsecuencias
materialesdelaaccin.Estetipodejuiciolodenominresponsabilidadobjetiva.Por
ejemplo, en la historia anterior, una respuesta tpica de nio de 6 aos sera: [Es ms
malo] el que ha hecho la mancha grande. Por qu? Porque era grande. Por qu ha
hecho una mancha grande? Para hacer un favor.Y el segundo, por qu ha hecho una
manchapequea?Porquelotocabatodo.Hizounamanchapequea.Entonces,cules
msmalo?Elquehizolamanchagrande(ibd,p.106).
Piaget encontr que a partir de los 7 u 8 aos los nios ya consideran la intencin
comounelementoimportantealahoradevalorarunaaccinydenominaestosjuicios
responsabilidadsubjetiva.
214 Bloque II. El desarrollo durante la primera infancia
6.2. La mentira
Otro de los aspectos estudiados por Piaget fue la concepcin infantil de la mentira.
Cmoentiendenlosnioslasmentiras?Cmoestablecenladiferenciaentrelaver-
dad,lamentirayelerror?Paraestudiarestacuestin,pedaalosniosquedefnieran
quesunamentira.Piagetencontrquelosniospequeosentendanquelamentira
eraunengaoperoleaadanotrossignifcados.Hastaaproximadamentelos6aos,
losniosconsiderabanmentira,porunaparte,loqueparalosadultosylosniosma-
yoressonexageracionesoerroresy,porotra,laspalabrotas.Veamoslasrespuestasde
un nio de 6 aos: Qu es una mentira? Quiere decir cuando se dicen cosas malas
quenohabaquedecir.Ququieredecircosasmalas?Quehadichomalaspala-
bras. Dime malas palabras, sabes alguna? Charrogne (carroa) (esta palabra se usa
enSuizacomoreniegooinsulto).Esunamentira?S.Porquesunamentira?Porque
esunamalapalabra.Unchicohabavolcadounataza,perohabadichoquenoeral.
Esunamentira?S.Porqu?Porquelohabahechol.(...)Decirque2y2son5,
esunamentiraono?S.Malaono?Noesmala.Porqu?Porquenoesunamala
palabra.
Al igual que en el caso de la responsabilidad objetiva, para los nios pequeos la
gravedaddelamentiranoseencuentrarelacionadaconlaintencinnilaconsecuencia
delengao,sinoconsucredibilidad.Paraexplorarestetemalosniosentrevistadospor
Piagetescucharonhistoriascomoestas:
HistoriaI:Unchicosepaseaporlacalleyencuentraunperrograndequele
damuchomiedo.Entraensucasayexplicaasumamquehavistounperro
tangrandecomounavaca.
HistoriaII:Unniovuelvedelaescuelayexplicaasumamquelamaes-
tralehadadobuenasnotas.Peronoeraverdad:lamaestranolehabadadoningunanota,
nibuenanimala.Sumamsepusomuycontentaylediounarecompensa(Ibd,p.124).
Cuando se les preguntaba cul de las dos mentiras era peor, los nios pequeos
afrmabanqueerapeorlaprimeraporqueestonoesposibleoporquesumamlosaba
(queerafalso,imposible)mientrasqueenlaotrasituacinlamamnolosaba.Sise
dice algo que mam no sabe, es menos malo, porque la mam podra creerlo. Si la
mam lo sa beque no es verdad, la mentira es ms grande (Ibd, p. 127).A pesar de
comprender que en la segunda historia el personaje consigue un premio gracias a la
mentira, los nios pensaban que habra que castigar ms al primero porque era ms
mentirosoymsmalo(p.126).
6.3. La justicia inmanente y retributiva
Piagetestudialgunosaspectossobrelaconcepcindelosniosdelajusticia.Poruna
parte,explorsilosnioscreanenunajusticiainmanente,esdecir,enlaideadeque
tardeotempranolosculpablessiempreserncastigados.Aestaideasubyacelaconcep-
cindeunajusticiaperfectaquecastigaaquienlomerece.Paraestudiarestepuntopre-
sentabaalosniosestahistoria:
Captulo 7. El mundo social de 3 a 6 aos 215
Habaunavezdosniosquerobabanmanzanas.Derepentellegaunguarday
losdosniosescapancorriendoperoelguardacogeaunodeellos.Elotro,al
volverasucasaporunatajo,cruzaelroporunpuenteenmalestadoysecae
alagua.
Sinohubierarobadolasmanzanasyhubierapasadoelroporelmismopuente,tam-
binsehabracadoalagua?(Ibd,p.211.)
El86%delosniosde6aospensabanquesielprotagonistanohubierarobadolas
manzanastampocosehubieracadodelpuente,estableciendounarelacincausalentre
ambossucesos.Asporejemplo,decanqueesjusto,nohubieradebidorobar()sino
hubierarobadonosehabracadoalaguaporquenohabrahechonadamalo(p.213).
Tambinpodanafrmarquesinosehubieracadodelpuentelehubierapasadootracosa,
esdecir,detodasformashubierarecibidouncastigoporrobarlasmanzanas.Sinembar-
go,apartirdelos9aos,lasrespuestasdelosniosponandemanifestoquenohaba
unarelacindirectaentreelroboylacada.
Porltimo,Piagetencontrquealosniospequeoslesparecejustocastigaralcul-
pableconelmismodaoquelcaus,esdecir,creenenlajusticiaretributiva.Estacon-
cepcin se expresa popularmente con el famoso ojo por ojo, diente por diente. Esta
concepcindelajusticiafueestudiadaapartirdehistoriascomo:
Unamamtenadoshijas,unaobedienteyotradesobediente.Estamamque-
ramsalaqueobedecayledabalostrozosdepastelmsgrandes.Qute
parece?(Ibd,p.221.)
Anteunasituacindeestetipo,lamayorpartedelosnioshastalos9aosaprueban
laconductadelamamdiciendoporejemploqueerajusto,deberahacersiempreloque
seledice,queestababienparaensearalaotracmolaquerrasifueraobedienteo
quelamsobedientedebetenerlasmejorescosas(p.222).Apartirdelos9aos,sin
embargo, los nios ya manifestaban en sus respuestas que el reparto igualitario de los
bienesesunaopcinmsjusta.
Lecturas complementarias
Cantn,J.yCorts,M.R.(2000).Elapegodelnioasuscuidadores:Evaluacin,antecedentes
yconsecuenciasparaeldesarrollo.Madrid:Alianza.
Garvey,C.(1977).Eljuegoinfantil.Madrid:Morata,1985.
Gimnez-Das,M.(2003).Existenlashadasylosmonstruos?Ladistincininfantilentreloreal
ylomgico.Unarevisincrticadelaliteratura.Estudiosdepsicologa,24(3),337-352.
Harris,P.L.(1989).Losniosylasemociones.Madrid:Alianza,1992.
Rodrigo,M.J.yPalacios,J.(Coords.)(2003).Familiaydesarrollohumano.Madrid:Alianza.
Rubin,Z.(1980).Amistadesinfantiles.Madrid:Morata,1981.
216 Bloque II. El desarrollo durante la primera infancia
Actividades
1. Conteste a las siguientes preguntas:
Un nio de 5 aos se mostrar ms conciliador cuando tenga que resolver un conicto
con:
a) Su madre.
b) Un hermano pequeo.
c) Un amigo.
Sobre los estilos educativos podemos armar que:
a) Existe una relacin causal directa entre el estilo adoptado por los padres
y los rasgos de personalidad y aptitudes de sus hijos.
b) El autoritario tiene consecuencias ms negativas para los hijos que el
indiferente.
c) Los padres realizan ajustes en el estilo que emplean en funcin de las
caractersticas de cada hijo.
Los nios de 4 y 5 aos que son competentes socialmente, probablemente:
a) Han establecido un apego seguro con sus cuidadores.
b) Han sido educados con un estilo permisivo.
c) Preeren ser espectadores del juego de otros nios.
2. Diseo de actividad
Disee una actividad que fomente una competencia emocional para nios entre 3 y 6
aos. Puede adaptar materiales que ya conozca, inventar otros nuevos o inspirarse en
libros o juegos infantiles.
3. Juan, Antonio y Carla
Estudie la siguiente situacin y conteste a la pregunta que se plantea a continuacin:
A Juan, que tiene 6 aos, se le ha quedado atrapado el dedo en el reproductor
de CD cuando intentaba poner un disco. Mientras lloraba y lloraba, sus hermanos An-
tonio y Carla de 2 y 3 aos, le miraban pero no fueron a ayudarle. Cuando lleg su
madre consol a Juan y vio que al dedo no le haba pasado nada, pero se qued pre-
ocupada ante la reaccin de sus hijos pequeos. Por qu, viendo que Juan lloraba,
Antonio y Carla no hicieron nada para ayudarle? (Adaptado de Kail y Cavanaugh,
2003, p. 189).
4. Los estilos educativos
Complete la siguiente tabla relacionando lo que ya sabe sobre los estilos educativos que
practican los padres y las consecuencias probables que tienen en los hijos. En las dos
primeras las debe establecer si el nivel de control y afecto es alto o bajo para cada uno
de los estilos, escribiendo uno u otro adjetivo en cada casilla. En el resto de la tabla,
marque con una cruz las caractersticas que describen cada estilo (en letra normal) y las
consecuencias que suelen provocar en los hijos (en negrita).
Captulo 7. El mundo social de 3 a 6 aos 217
Autoritario Permisivo Democrtico Indiferente
Afecto
Control
Excesivamenteexigentes
Altaautoestima
Impulsividad
Inmadurez
Buenrendimientoescolar
Autonoma
Dependencia
Altacapacidadcrtica
Pococomprometidos
Bajaautoestima
Utilizaelcastigo
Enfatizaelrazonamiento
Desobediencia
Evitalaimposicin
Agresividad
Difcultadesenrelaciones
sociales
Soluciones a las actividades
1. Respuestas a las preguntas
En la primera pregunta la respuesta correcta es la c). Como se explica en el texto, los
nios a los 5 aos despliegan capacidades distintas en funcin de con quin interactan.
Las relaciones con los iguales son ms igualitarias y ms clidas desde el punto de vista
emocional, lo cual puede favorecer que los nios se muestren ms conciliadores cuando
surge un conicto.
En la segunda pregunta la respuesta correcta es la c). Los padres suelen utilizar el
mismo estilo educativo con sus hijos aunque realizan ajustes en funcin de las cualida-
des de cada uno. La alternativa a) es falsa porque no se han establecido relaciones
causales directas entre la adopcin de un estilo educativo y sus repercusiones en los
hijos. Slo parece que el empleo de algunos estilos tiene ms probabilidades de generar
determinadas caractersticas en los hijos. Por ltimo, la alternativa b) es falsa porque el
estilo ms daino para los nios es el indiferente.
En la tercera pregunta la respuesta correcta es la a). Entre los factores que parecen
estar relacionados con la competencia social est el haber establecido un vnculo segu-
ro con los cuidadores. La alternativa b) es falsa porque es el estilo democrtico el que
fomenta la competencia social. La alternativa c) es falsa porque los nios que preeren
mirar cmo juegan otros nios no suelen tener habilidades para introducirse en los
grupos y, por tanto, no se puede decir que sean socialmente competentes. La pauta
de juego que se caracteriza por la observacin del juego de otros o el juego solitario
suele darse en nios que necesitan apoyo para colaborar con otros y establecer amis-
tades.
218 Bloque II. El desarrollo durante la primera infancia
2. Diseo de actividad
Por ejemplo, para aumentar el vocabulario emocional e identicar diferentes emociones
en los dems se pueden hacer fotografas de los nios de la clase pidindoles que ex-
presen alegra, enfado, tristeza, rabia, etc. Despus se pueden colgar en un espacio de
la clase y pedir a los nios que las identiquen para ponerles la etiqueta correspondien-
te. Tambin se pueden presentar caras en blanco y que los nios dibujen la expresin
correspondiente a un estado emocional. Otra forma de trabajar es con espejos: los
nios ponen la expresin correspondiente a la emocin que se est explicando o tra-
tando.
3. Juan, Antonio y Carla
Dos factores pueden explicar por qu los hermanos pequeos no ayudaron al mayor. En
primer lugar, la responsabilidad para ayudar al mayor se diluye entre los dos pequeos
y ninguno se siente lo sucientemente responsable como para actuar. En general, los
nios de estas edades no suelen sentirse responsables de los dems. En segundo lugar,
probablemente, ninguno de los dos hermanos sabe cmo ayudar a Juan puesto que su
experiencia con el reproductor de CD es mnima. As pues, tampoco tienen la compe-
tencia necesaria para ayudar a su hermano mayor.
4. Los estilos educativos
A continuacin tiene la tabla en la que aparecen las respuestas correctas sobre los rasgos
de los estilos educativos y sus consecuencias probables en los hijos.
Autoritario Permisivo Democrtico Indiferente
Afecto Bajo Alto Alto Bajo
Control Alto Bajo Alto Bajo
Excesivamenteexigentes X
Altaautoestima X
Impulsividad X X
Inmadurez X X X
Buenrendimientoescolar X
Autonoma X
Dependencia X
Altacapacidadcrtica X
Pococomprometidos X
Bajaautoestima X
1
X
Utilizaelcastigo X
Enfatizaelrazonamiento X
Captulo 7. El mundo social de 3 a 6 aos 219
Desobediencia X
Evitalaimposicin X
Agresividad
X
Difcultadesenrelaciones
sociales
X
1
Hemosconsideradoqueelrasgoinseguridadqueapareceeneltextosepuedeconsiderarcomo
bajaautoestimaenestatabla.
EL DESARROLLO
DURANTE LA ETAPA
ESCOLAR Y LA
ADOLESCENCIA III
BLOQUE
Este bloque de captulos ahonda en los cambios que se producen entre los 7 y los 11 aos
y en la adolescencia. El primer captulo trata los avances que se producen en el mbito inte-
lectual y socio-afectivo. De este modo, veremos que la principal ventaja que adquieren los
nios de esta edad es la posibilidad de razonar siguiendo las leyes de la lgica, lo que les
permite descomponer y ms tarde recomponer en un todo mayor y coherente la informacin
que reciben del medio. Se explican los hitos fundamentales en la comprensin social y emo-
cional del nio. La autonoma personal e intelectual que se alcanza en este perodo hace
que, de forma casi obligada, compaeros y amigos emerjan como un espejo esencial en el
que mirarse y compararse. La exposicin a un clima social ms exigente propiciar que la
autoestima, la capacidad de negociacin y la visin del Yo sufran cambios muy signicativos.
Como consecuencia de todo ello, el nio se inicia en las responsabilidades propias de la vida
adulta dejando atrs el buclico perodo de la in fancia.
Este bloque sigue con un captulo (Captulo 9) dedicado a los logros intelectuales que
se alcanzan en la adolescencia. Segn Piaget, el pensamiento adolescente supone la cul-
minacin del razonamiento lgico-formal, por lo que atribuye al adolescente notables
habilidades como el razonamiento hipottico-deductivo. No obstante, dichas conquistas
lgicas no constituyen el punto nal del desarrollo cognitivo, ni son una consecuencia
universal del hecho de cumplir aos. En cualquier caso, es indudable que en la adolescen-
cia se producen importantes avances cognitivos que merecen conocerse y que resultan
imprescindibles para entender ciertas caractersticas intelectuales tpicas de esta etapa,
como el llamado egocentrismo adolescente, la sensacin de audiencia imaginaria o la f-
bula personal, entre otras.
El Captulo 10 aborda la adolescencia desde el ngulo social y emocional, ahondando de
manera especial en los cambios y continuidades que se producen en el autoconcepto y en
la autoestima de los adolescentes. Las relaciones personales no slo continuarn siendo una
importante fuente de comparacin social sino que sern, adems, el escenario en el que
experimentar nuevos desafos como la amistad, el enamoramiento o la sexualidad, que in-
uyen de forma importante tanto en el autoconcepto como en el proceso de bsqueda de
222 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
una verdadera identidad. Pese a todo, la familia del adolescente continuar desempeando
un papel fundamental en la construccin de su identidad.
SUMARIO
CAPTULO 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los
11 aos
1. Desarrollo cognitivo
2. Desarrollo emocional y social
CAPTULO 9. El desarrollo cognitivo durante la adolescencia y la primera
juventud
1. La llegada del pensamiento formal
2. Crticas a la visin de Piaget
3. Cambios cognitivos y sensaciones adolescentes
CAPTULO 10. El desarrollo socio-emocional del adolescente
1. Modelo del cambio individual: la teora de Erikson
2. Autoconcepto y autoestima
3. Relaciones familiares
4. Relaciones con los iguales
223 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
El desarrollo cognitivo
y socio-afectivo desde
los 7 hasta los 11 aos
223
8
NURIA CARRIEDO
Esquema-resumen
Objetivos
Introduccin
1. Desarrollo cognitivo
1.1. El desarrollo del razonamiento: la llegada de la lgica operacional
1.1.1. El desarrollo de la nocin de conservacin
1.1.2. El desarrollo de la clasicacin, la seriacin y la nocin de nmero
1.1.3. El desarrollo de las nociones espacio-temporales
1.1.4. Estudios de replicacin sobre las operaciones concretas
1.2. El desarrollo de la atencin y de la memoria.
1.2.1. El desarrollo de la atencin
1.2.2. El desarrollo de la funcin ejecutiva y de la memoria operativa
2. Desarrollo emocional y social
2.1. Adquisicin de la competencia emocional
2.2. El mundo de las relaciones
2.2.1. La inuencia del apego en el desarrollo psicolgico posterior
2.2.2. Las relaciones con los iguales
2.3. El desarrollo moral
Lecturas complementarias
Actividades
Solucin a las actividades
224 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Esquema-resumen
1. Desarrollo cognitivo
1.1. El desarrollo del razonamiento: la llegada de la lgica operacional
El razonamiento se caracteriza por la aparicin de la lgica operacional.
Operacin mental: accin interiorizada que rene las propiedades de transitividad,
reversibilidad, asociatividad, identidad y tautologa.
1.1.1. El desarrollo de la nocin de conservacin
Durante este perodo una de las adquisiciones ms importantes es la nocin de
conservacin:
Invariante cognitivo de este perodo. Las relaciones cuantitativas entre dos ob-
jetos permanecen constantes pese a las transformaciones perceptivas irrelevan-
tes sufridas por uno de los objetos.
Etapas en su adquisicin: no conservacin, reacciones intermedias y conservacin.
Aparecen desfases horizontales:
No todas las conservaciones se adquieren en el mismo momento.
Secuencia de adquisicin: conservacin de la cantidad de lquido o de bolitas
(7-8 aos); nmero, longitud y materia (8 aos), peso (9-10 aos) y volumen
(11-12 aos).
Los desfases ponen de maniesto:
La inuencia del contenido sobre la realizacin de la tarea.
La dependencia de unas conservaciones respecto a otras.
1.1.2. El desarrollo de la clasicacin, la seriacin y la nocin de nmero
Clasicacin:
Consiste en agrupar objetos en funcin de sus semejanzas.
Para realizarla es necesario coordinar la comprensin de la clase con su extensin.
Etapas de la adquisicin: colecciones gurales (2-5 aos), colecciones no -
gurales (5-7-8 aos) e inclusin jerrquica de clases.
Seriacin:
Consiste en agrupar y ordenar objetos en funcin de sus diferencias.
Para realizarla es necesario la toma de conciencia del esquema transitivo.
Etapas de adquisicin: series de 2 elementos (perodo preoperatorio); etapa de
transicin de ejecucin variable; construccin correcta de series (perodo de las
operaciones concretas).
Nmero:
Se pasa por los mismos estadios que en la conservacin de los otros contenidos.
Clases, series y nmeros se desarrollan sincrnica e interdependientemente.
Requisitos de la nocin de nmero: a) tratar los elementos equivalentes como
unidades que puedan ser contadas; b) conservar la estructura de inclusin;
c) tener en cuenta el orden serial.
1.1.3. El desarrollo de las nociones espacio-temporales
Operaciones infralgicas que requieren razonar a partir de las relaciones parte-
todo o parte-parte dentro de un mismo objeto.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 225
Nociones espaciales fundamentales:
Topolgicas: tienen que ver con la proximidad, orden, cierre y continuidad de
los objetos.
Euclidianas: se reeren a las distancias entre objetos y su medida.
Proyectivas: ordenacin de objetos en el espacio y perspectiva.
Orden de adquisicin: nociones topolgicas (7 aos); proyectivas y euclidianas
(9-10 aos).
Nociones temporales: sucesin, la inclusin de intervalos y eleccin de una unidad
de medida .
1.1.4. Estudios de replicacin sobre las operaciones concretas
Realizados dentro de la Escuela de Ginebra: sus estudios tienden a conrmar la
teora piagetiana.
Otros estudios muestran que los nios pequeos tienen ms capacidades de lo
que Piaget supona.
1.2. El desarrollo de la atencin y de la memoria
El estudio de la atencin y la memoria tom como marco de referencia el mode-
lo multialmacn de Atkinson y Shiffrin (1968), segn el cual la informacin sen-
sorial es procesada en tres almacenes: sensorial, la memoria a corto plazo (MCP)
y la memoria a largo plazo (MLP).
Sin embargo, recientemente se ha cuestionado la existencia de estos almacenes
armando que:
La retencin de la informacin depende ms de la profundidad con que es
procesada.
Las dicultades para procesar mucha informacin al mismo tiempo vendran
determinadas por la capacidad de atencin que, al ser limitada, no se puede
distribuir ecientemente en la realizacin simultnea de distintas tareas. Por
ello, se ha sustituido el trmino MCP por el de memoria operativa (MO), para
referirse al conjunto de recursos atencionales de los que dispone el sistema
cognitivo para llevar a cabo el procesamiento de la informacin.
Algunos tericos neopiagetianos han retomado estas ideas para explicar el desa-
rrollo cognitivo. P. ej., Pascual-Leone (1970) propone que el desarrollo cognitivo
sera la evolucin de un constructo similar al de MO denominado espacio mental.
1.2.1. El desarrollo de la atencin
Los nios presentan dicultades para centrarse en la informacin relevante e ig-
norar la irrelevante (atencin selectiva) y les cuesta mantener la atencin durante
perodos prolongados de tiempo.
1.2.2. El desarrollo de la funcin ejecutiva y de la memoria operativa
Las funciones llevadas a cabo por el ejecutivo central de la MO han sido concep-
tualizadas en un constructo denominado funcin ejecutiva, funcin que est aso-
ciada a la actividad del lbulo frontal.
La funcin ejecutiva incluye un amplio rango de habilidades relacionadas con el
control consciente de la accin, el pensamiento y las emociones: la autorregula-
cin, el control de la inhibicin, la planicacin estratgica, la exibilidad cogni-
tiva y el control de impulsos.
226 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Algunos autores arman que existe una correlacin entre las diferencias indivi-
duales en la capacidad inhibitoria del lbulo frontal y las diferencias individuales
observadas en el desarrollo.
2. Desarrollo emocional y social
2.1. Adquisicin de la competencia emocional
El desarrollo emocional a lo largo de la infancia tiene que ver con la adquisicin
de la competencia emocional, la cual est relacionada con la ecacia en las inter-
acciones sociales.
La competencia emocional est compuesta por ocho tipos de habilidades: 1) toma
de conciencia de las emociones propias; 2) capacidad para identicar y compren-
der las emociones de los dems; 3) capacidad para expresar de forma apropiada
las emociones; 4) capacidad para empatizar con las experiencias emocionales de
los dems; 5) toma de conciencia de que un estado emocional interno no tiene
por qu corresponderse con una manifestacin emocional externa; 6) capacidad
para enfrentarse adaptativamente a las emociones aversivas y a las circunstancias
estresantes; 7) toma de conciencia de la forma en que se comunican las emocio-
nes y 8) auto-eciencia emocional.
2.2. El mundo de las relaciones
Los nios se desarrollan en un entorno de relaciones sociales que tienen un efec-
to determinante en su formacin como personas, tanto a nivel cognitivo como
social.
A partir de la interaccin con los dems, los nios construyen teoras intuitivas
sobre s mismos y sobre las otras personas que: guan la comprensin de las emo-
ciones y controlan sus esfuerzos para regular la activacin emocional; articulan la
formacin del autoconcepto y de la personalidad; regulan el comportamiento
social y moral.
2.2.1. La inuencia del apego en el desarrollo psicolgico posterior
La mayora de las investigaciones toman como marco de referencia el modelo de
Bowlby, segn el cual, a partir de sus experiencias tempranas de cuidado, los ni-
os construyen modelos internos de trabajo sobre la accesibilidad de sus cui-
dadores y sobre el merecimiento de los cuidados que reciben.
Los modelos internos de trabajo actuaran como ltros inconscientes a partir de
los cuales se construye la comprensin de uno mismo, de las relaciones y de otras
experiencias sociales. Estos modelos internos tienden a perpetuarse a lo largo del
desarrollo, pero no son estticos, sino representaciones en desarrollo que surgen
y van transformndose progresivamente.
Su inuencia se ha estudiado en relacin con una gran variedad de conductas
durante la infancia, la adolescencia y la edad adulta: la relacin padres-hijos, el
establecimiento de relaciones con los iguales, las relaciones de amistad y de no-
viazgo, o en el desarrollo de la personalidad.
Con respecto a las relaciones sociales. El apego seguro inuye considerablemen-
te en la calidad de las relaciones que el nio establece durante sus primeros aos
de vida, tanto con sus padres, como con sus iguales. Sin embargo, la inuencia
del apego a ms largo plazo no es tan evidente, pudiendo estar modulada por
otros factores.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 227
En relacin con el desarrollo de la personalidad. Se han encontrado correlaciones
positivas entre apego seguro por un lado, y desarrollo de la autoestima, autocon-
anza, resiliencia etc., por otro. Sin embargo, se necesitan ms estudios que
analicen la relacin entre el apego seguro y los modelos internos; y cmo estos
modelos mentales van cambiando a lo largo del desarrollo en funcin de las nue-
vas relaciones que se van estableciendo.
2.2.2. Las relaciones con los iguales
De los 6 a los 12 aos empieza a cobrar importancia la interaccin en otros con-
textos como la escuela, internet u otros espacios que favorecen la actividad ldi-
ca as como con los iguales.
Durante esta etapa disminuyen las agresiones fsicas, pero aumentan las verbales.
Tambin se incrementa el juego de reglas y el juego violento (especialmente entre
los chicos); e igualmente es muy frecuente el cotilleo.
Los amigos se convierten en el principal marco de referencia y de apoyo emocio-
nal. Diversos estudios han encontrado una correlacin entre las relaciones esta-
blecidas con los iguales en la infancia y el ajuste psicolgico posterior.
Cuando las relaciones sociales son positivas, se augura un mejor ajuste futuro
porque aanzan la sensacin de pertenencia al grupo y potencian las actitudes
y las creencias positivas. Tambin facilitan el aprendizaje en contextos de cola-
boracin.
Sin embargo, a veces las relaciones entre iguales tienen consecuencias negati-
vas. Entre ellas se destaca el entrenamiento desviado, la co-rumiacin, el acoso
(bullying) y la victimizacin.
En general, con respecto a las relaciones de amistad, se observa que tanto chi-
cos como chicas se sienten atrados y eligen como mejores amigos a chicos y
chicas que son similares a ellos. Las relaciones de las chicas estn marcadas por
una mayor intimidad, autoconanza, validacin y proteccin, aunque, parad-
jicamente, son ms inestables que las de los chicos. Las amistades de los chicos
estn ms centradas en las actividades fsicas y normalmente no requieren el
intercambio de informacin personal.
2.3. El desarrollo moral
Piaget propone que el desarrollo moral progresa desde la moralidad heternoma
hacia una moralidad ms autnoma.
Kohlberg reelabora la propuesta piagetiana sosteniendo que:
Las nociones morales se construyen en sentido positivo.
Los nios construyen las nociones morales a partir de las interacciones sociales.
Esto les permite ir desarrollando emociones de empata y comportamientos de
ayuda y respeto.
Establece tres niveles de desarrollo moral: preconvencional, convencional y
postconvencional. Son formas universales de juicio moral, aunque el contenido
podra variar entre culturas.
Los nios antes de lo que Piaget o Kohlberg proponan pueden hacer juicios mo-
rales basndose en su propio concepto de justicia y no slo en funcin de la
obediencia o las sanciones.
El desarrollo de las nociones morales est asociado a la capacidad para cambiar
la perspectiva y pasar de estar centrados en uno mismo a adoptar la perspectiva
de los otros. Este cambio de perspectiva est relacionada con los cambios que se
estn produciendo a nivel cognitivo.
228 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Introduccin
1
El estudio del desarrollo cognitivo y del desarrollo emocional y social se ha llevado a
cabodesdemarcosdeinvestigacinydetrabajodiferentesenlosquenohahabidouna
gran convergencia. De hecho, algunos autores han diferenciado entre el estudio de los
aspectosfrosdeldesarrolloparareferirsealosaspectoscognitivosfrenteales-
tudiodelosaspectosmsclidosaludiendoconelloalosaspectosafectivosysociales,
sinquesehayabuscadolainteraccinolaconvergenciaentreellos.
Sinembargo,emocinycognicinestnestrechamenterelacionadasyenloslti-
mos aos han aumentado considerablemente los estudios que tratan de conectar el
desarrollocognitivoconeldesarrolloemocionalysocial.Porejemplo,enrelacincon
eldesarrolloemocionalsehadeterminadoqueparallegaraseremocionalmentecom-
petenteslosniostienenqueadquirirdeterminadascapacidadessocio-cognitivasrela-
cionadas con la facultad para comprender y tener en cuenta la informacin sobre los
estadosmentalesdelosotrosbienseanintenciones,emociones,motivacionesocog-
niciones y en funcin de ello, ser capaces de predecir la conducta de los dems y
comportarseenconsecuencia(vaseCaptulo5).Portanto,estetipodeanlisissocio-
1
Conelfndeagilizarlalecturahemosomitidoenmuchasocasioneslareferenciaalasfuentes.Eneste
sentido,queremosponerdemanifestoqueenlaelaboracindeestecaptulonoshemosbasado,fundamen-
talmente,enPiaget(1970),Piaget(1967)yenlasrevisionesdelaobrapiagetianarealizadasporFlavell(1978)
yBrainerd(1978)paralapartededesarrollocognitivo.Paraeldesarrolloemocionalysocialnoshemosba-
sadofundamentalmenteenSaarnietal.(2006);Thompson(2006)yTuriel(2006).
Objetivos
Comprender el concepto de operacin mental y cmo se utiliza para describir y
explicar el desarrollo cognitivo durante esta etapa.
Comprender el concepto de conservacin y las etapas de su adquisicin.
Comprender el desarrollo de la clasicacin, la seriacin y el nmero, as como
sus etapas de adquisicin.
Comprender el desarrollo de las nociones espacio-temporales.
Establecer correspondencias entre las distintas adquisiciones para lograr una vi-
sin integrada del desarrollo cognitivo durante esta etapa.
Describir y explicar el desarrollo de la memoria y de la atencin durante esta
etapa.
Comprender la evolucin de la funcin ejecutiva y su inuencia en el desarrollo
psicolgico posterior.
Comprender el concepto de competencia emocional e identicar el conjunto de
habilidades que lo componen.
Determinar la inuencia del apego en el desarrollo psicolgico posterior con res-
pecto a las relaciones sociales y al desarrollo de la personalidad.
Describir la importancia de las relaciones entre iguales durante esta etapa.
Describir y explicar cmo se produce el desarrollo moral.
Relacionar el desarrollo moral con el desarrollo cognitivo y con el desarrollo emo-
cional.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 229
cognitivo sera bsico para el establecimiento de las relaciones sociales que tendran
noslouncomponenteafectivo,sinotambincognitivo.Asimismo,sehaargumentado
queexisteunnotablesustratocognitivoenlaconstruccindelyo(Harter,2006),enel
desarrollomoral(Turiel,2006),enlamotivacin(Wigfeldetal.,2006),oenlasocia-
lizacin(BugentalyGrusec,2006).Deformaanloga,sehaencontradoquelasemo-
cionestambininfuyenenelpensamientoyenlainteligencia,unasvecesfacilitando
el procesamiento de la informacin cognitiva y otras difcultndolo. Las emociones
facilitanelpensamientoalfuncionarcomounsistemadealertaquedirigelaatencin
a los cambios importantes que se producen tanto en la persona como en el entorno
(MayerySalovey,1997),perotambinsesabequeestadosemocionalesalterados(por
ejemplo, sufrir una gran ansiedad) infuyen negativamente sobre el rendimiento y la
memoria.
Enestecaptulonoscentraremosenelanlisisdeldesarrollocognitivoysocio-afec-
tivodelos7alos11aos,etapaquecoincideprcticamenteconlaeducacinprimaria.
Abordaremosprimeroelestudiodeldesarrollocognitivofocalizndonoseneldesarrollo
dealgunosdelosprocesosmentalessuperioresmsimportantes:laevolucindelrazo-
namiento,delamemoriaydelaatencin.Loharemos,adems,desdeperspectivaste-
ricasdiferentes.Utilizaremoslateorapiagetianacomomarcodereferenciafundamental
paracaracterizarelrazonamientoqueseproduceduranteestaetapa,productodelaapa-
ricindelalgicaoperacional,msconcretamentedeloquePiagetdenominelestadio
delasoperacionesconcretasdelascualesyavimosunavanceenelCaptulo1.Porotra
parte,paralaexplicacindeldesarrollodelosprocesosdeatencinydememoriautili-
zaremoslaperspectivadelProcesamientodelaInformacin(PI).Desdeesteenfoquela
menteseconceptualizacomounsistemaespecializadoenelprocesamientoymanipula-
cindelainformacinqueentraalsistemacognitivoatravsdelossentidos.Finalmen-
te,algunosmodelosevolutivoslosmodelosneopiagetianossuponenunaintegracin
delaperspectivapiagetianaydelenfoquedelPIalosqueharemosalusinparaexplicar
cuandocorrespondadeterminadosfenmenosdeldesarrollocognitivoqueaborda-
remosalolargodelcaptulo.
La segunda parte del captulo est dedicada al estudio del desarrollo emocional y
social.Enellatrataremosdeconectareldesarrolloemocionalysocialalanalizarlasha-
bilidadesrelacionadasconlaadquisicindelacompetenciaemocionalensituacionesque
requierenefcaciasocial,esdecir,enlashabilidadesemocionalescuyologrofacilitalas
relacionesconlosdems.Tambinabordaremoselmundodelasrelacionessocialesdu-
rante esta etapa las consecuencias del apego en el desarrollo psicolgico posterior y
las relaciones con los iguales y el desarrollo moral. Los estudios realizados en este
camposondenaturalezamsdescriptivaymenosexplicativaquelosllevadosacabopara
estudiareldesarrollocognitivo,aunquequeremosrecordarqueenelestudiodelacom-
prensin de las emociones propias y ajenas el marco terico de referencia es el de la
Teora de la Mente (vase Captulo 5) y en el del apego sigue siendo el modelo de
BowlbycuyasprimerasconceptualizacionesyasevieronenelCaptulo4.Porotraparte,
quizelreadeinvestigacinenlaqueconfuyendeformamsclaralaconsideracin
delosaspectoscognitivosysocio-afectivosseaposiblementeladedicadaalestudiodel
desarrollo moral. Para abordarlo, partiremos de la conceptualizacin piagetiana cuya
descripcinyasevioenelCaptulo7paracentrarnosdespusenlaexplicacinofrecida
porKohlberg.
230 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
1. Desarrollo cognitivo
1.1. El desarrollo del razonamiento: la llegada de la lgica
operacional
ComovimosenelCaptulo1,paraPiageteldesarrollocognitivoconsisteenunatransi-
cinhaciaelpensamientooperacional.Lasoperacionesson,desdeestateora,laesencia
delainteligenciaydelpensamientoy,portanto,haciadondehadedirigirseeldesarrollo.
Sin embargo, y aunque la construccin de este pensamiento operatorio no es indepen-
dientedelasadquisicionesrealizadasenlasetapasanteriores,noestampocounasimple
traduccinocontinuacindelasaccionessensoriomotoras;necesita,entrminosdePia-
get,reconstruirsesobreunplanonuevo:esdecir,necesitadescentrarsedelaaccindi-
rectaconlosobjetos.Paraello,lacapacidadderepresentacin(funcinsimblica)pre-
senteyaenelsextoestadiodelperodosensoriomotoresunrequisitoimprescindible.
LallegadadelasoperacionessuponeparaPiagetunhitoeneldesarrollocognitivo.
Cuandolosnioslasalcanzan,suformaderazonarsobrelarealidadseasemejamsa
ladeunadultoquealadelosniosmspequeos.Estenuevomododepensarsobrela
realidad comienza alrededor de los 7 aos y culmina aproximadamente a los 11 con la
llegadadelpensamientoformal.
Piagetllevacabotodasuconceptualizacinmedianteeldiseodeingeniosastareas
enlasquesepedaalosniosutilizandoelmtodoclniconoslolarespuestade
lasmismas,sinoquetambinselespreguntabaporelprocesoderazonamientoquese-
guanparadarunarespuestadeterminada.Entrelastareasqueutilizparaelestudiode
lasoperacionesconcretasdestacanlastareasdeconservacin,correspondencias,clasif-
cacinoinclusinjerrquicadeclasesyseriacin.Estastareaspuedenverseejemplif-
cadasenlaFigura8.1.
1.1.1. El desarrollo de la nocin de conservacin
Piaget consideraba la adquisicin de la nocin de conservacin como el logro ms im-
portantedelaetapadelasoperacionesconcretas.Bsicamenteconsisteenrealizardelan-
tedelosniosunatransformacinporejemplo,setrasvasaunlquidodesdeunreci-
piente largo y estrecho a un recipiente ancho y bajo y se pregunta si la cantidad de
lquidohavariado.Sedicequelosnioshanalcanzadolaconservacincuandoafrman
quelacantidaddelquidonohavariadopeseaqueperceptivamenteparecequehayms
lquidoenelrecipientelargoyestrecho.Latareadeconservacinsehaaplicadoadis-
tintos contenidos como cantidad, materia o masa, peso, longitud y volumen (vase la
Figura 5.2 del Captulo 5). Se trata de comprobar que los nios son capaces de darse
cuentadequelacantidad,lamateria,lalongitud,elvolumenoelpesonovarancuando
sehacentransformacionesenlosobjetossinquitarniaadirnada.
Desdelateorapiagetianaseconsideraquelaadquisicindelanocindeconserva-
cineselmejorindicadordequeunniohapasadodelperodopreoperatorioalperodo
de las operaciones concretas. Su comprensin requiere que el nio tome conciencia de
quelasrelacionescuantitativasentredosobjetospermanecenconstantespeseaquepue-
dahaberdeformacionesperceptivasirrelevantesdeunodelosobjetos,esdecir,transfor-
macionesquenoaadenniquitannada.Paraelloesprecisoqueelnioserepresentela
C
a
p

t
u
l
o

8
.

E
l

d
e
s
a
r
r
o
l
l
o

c
o
g
n
i
t
i
v
o

y

s
o
c
i
o
-
a
f
e
c
t
i
v
o

d
e
s
d
e

l
o
s

7

h
a
s
t
a

l
o
s

1
1

a

o
s


2
3
1
Tarea1:Conservacin
delacantidadI
Tarea2:Conservacin
delacantidadII
Tarea3:Correspondencia Tarea4:Inclusindeclases Tarea5:Seriacindevarillas
Sellenandosrecipientesdelas
mismasdimensionesconla
mismacantidaddebolitas.A
continuacin,selepidealnio
quevayadepositando,lmismo,
unabolitaencadavaso.
A A'
Posteriormente,ydejandoqueel
niosigaviendoA,setrasvasa
elcontenidodeA'aotro
recipienteBdediferente
forma.
B
Losniosde4-5aosconcluyen
quehaymsbolitasenel
recipienteB,porqueesmsalto,
oquehaymenosporqueesms
delgado,ancuandoestn
segurosdequenoseha
cambiadonada,dequenose
hanaadidoniquitadobolitas.
Sinembargo,delos7alos11
aosdicenquehaylamisma
cantidaddebolitasenlosdos
recipientes.
Sepresentanalnio,
simultneamente,dosrecipientes
deformasdistintasAyB
yselepidequevayacolocando
unabolitaenAyotraenB,y
assucesivamente:
A B
Cuandosetratadeunnmero
pequeodebolitashasta4
o5elniocreeenla
equivalenciadeambos
conjuntos,perocuandolas
formascambiannotablemente,
noadmitelaigualdad.
A B
Elexperimentadorhaceunafla
con6fchasnegrasydaalnio
unmontndefchasdeotro
color,pidindolequelasponga
enlamesajuntoconlasnegras.
Entre4y5aoselniohace
unafladelamismalongitud,
sinestablecercorrespondencia
algunaentrelosdosconjuntos.
Entrelos5ylos6aos,elnio
colocar6fchasblancasjusto
debajodelas6azules.
Sinembargobastaconagrupar
oextenderdelantedellos
elementosdeunadelasseries,
paraqueelniodejedecreeren
laequivalencia.
Sepresentaalaniaunacaja
con20bolitasdemadera,delas
cuales15sonnegrasy5
blancas.
Posteriormenteselepregunta:
quhayms,bolasdemadera,o
bolasnegras.Hastalos7aos
lasrespuestassoncasisiempre
quehaymsbolitasnegras
porqueslohayunaspocas
blancas.
Laniasabequetodaslas
bolitassondemadera,pero
centrasuatencinosobreel
todo,osobrelaspartes,perono
sobreambosaspectos
simultneamente.Apartirdelos
7aoscomienzaadarsecuenta
delasrelacionesjerrquicasde
clasequelaclase(bolasde
madera)incluyealasubclase
(bolasnegras)yqueporlo
tanto,siemprehabrmsbolas
demaderaquebolasnegras.
Sepidealaniaquehagauna
serieconvarillasdedistintas
dimensiones.
Alos4y5aos,losniosslo
puedenagruparlasvarillasdosa
dos:
Luegolaniaescapazdehacer
seriespequeasnomayores
de10elementosyadems,es
incapazdeintercalarnuevos
elementossindeshacereltodoy
comenzardenuevolaserie.Sin
embargo,apartirdelos7aos
comenzarapoderseriarlos
elementos,primeroenfuncin
deunanicadimensin,y,
posteriormente,enfuncinde
msdeuna.
Figura 8.1. Algunas tareas piagetianas utilizadas para estudiar la construccin del pensamiento operatorio (tomado de Carriedo, Gutirrez y
Garca-Madruga, 2002).
232 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
posibilidadderealizarunaaccinensentidoinverso,detalmaneraqueseanulelapri-
merayque,portanto,permitavolveralpuntodepartidadeigualdadinicial.Porejemplo,
queenlatareadeconservacindelacantidaddelquidoodebolitaselnioserepresen-
tequeeltrasvasedelquidodelrecipienteBalrecipienteAanulalaprimeradelastrans-
formaciones,esdecir,lapercepcindelaumentodecantidadproducidaporeltrasvase
deA hacia B. Cuando los nios son capaces de representarse una transformacin y su
inversasedicequehanadquiridolareversibilidaddelasoperaciones,locualindicasin
dudaqueseencuentranenelperodooperacional.
Laadquisicindelanocindeconservacinnoesunacuestindetodoonada.Es
unprocesoenelquelosniospasanportresfasesoestadioscaractersticos:
EstadioI:Losniosnoconservan.Sedejanguiarporlainformacinperceptivay
concluyenquehaymscantidaddespusdelatransformacin.
EstadioII:Esunestadiodereaccionesintermediasenelquelosniosunasveces
conservanyotrasno.Adems,siselespidequediganloquecreenquevaapasar
antesderealizarlatareatiendenaconservar,perocambiandeopinincuandola
transformacin perceptiva es muy grande; y a la inversa, si no han conservado
cambiandeopininsilatransformacinperceptivaesmuypequea.
EstadioIII:Conservacin.Losniospredicenlaconservacinantesdelarealiza-
cindelatareaynocambiandeopinindespus.Secorrespondeconelestadio
delasoperacionesconcretas.
Sinembargo,aunquetodoslosniospasanporidnticasfasessiempreenelmismo
ordenlohacenadistintasedadesoendiferentesmomentosdependiendodeloscon-
tenidos.Porejemplo,sellegaantesalestadioIIIdelaconservacindelnmeroqueal
estadioIIIdelaconservacindelasustanciaolamasa.Laconservacindelacantidad
lquidoobolitaseslaprimeraqueseadquierealos7-8aos.Asimismo,alrededor
delos8aos,losniossoncapacesdedarsecuentadequeelnmerodeelementosno
vara,aunqueslohagalalongituddelaflaenlaqueestndispuestos,oquelalongitud
ylamaterianolohacenaunqueseproduzcaundesplazamientoenelprimercasoo
cambielaformadeloselementosenelsegundo
2
.Sinembargo,estosmismosnios
quenopresentanproblemasenlarealizacindeestetipodetareasyqueademsafr-
manquenecesariamenteseproducelaconservacinpresentandifcultadespararesol-
verlatareadeconservacindelpesooladelvolumen.As,hastalos9-10aos,losnios
noadmitenqueelpesoseconserva,ynoserhastalos11-12cuandoreconozcanlacon-
servacindelvolumen.Antelosproblemasdeconservacindelpesoydelvolumenlos
niosnoaplicanlosesquemasoperatoriosquelespermitenrealizarlasotrasconserva-
ciones,sinoqueactanaplicandountipoderazonamientointuitivoparecidoalutilizado
porlosniosde4-5aosbasadoenlaprimacadelosdatosperceptivos(porejemplo,el
adelgazamientodelabola,enelcasodelpeso,esdefnitivo).Aestafaltadesincronaen
laadquisicindelanocindeconservacinparadistintoscontenidosesaloquePiaget
denomindesfaseshorizontales.
Elproblemaquepresentanlosdesfasesesqueesdifcilexplicarporqulosniosno
aplican los esquemas que poseen independientemente del contenido; es decir, por qu
2
Laconservacindelamateriaserealizaunaodespusqueladelacantidad.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 233
aplicanelesquemadeconservacinalacantidadperonoalpesoyalvolumen.Enestos
dosltimoscasosPiagetpiensaquehaycreenciasimplcitasqueimpidenodifcultanla
aplicacindelosesquemasdeconservacin,aunquedehechosetengan.Enelcasodel
peso,elniopuedepensarqueesasunidadesdeplastilinatienendiferentepesodepen-
diendo de su ubicacin espacial. En el caso del volumen, los nios creen que cuando
manipulanunabolitadeplastilinanoslocambiasuforma,sinoquealcomprimirsey
descomprimirse,varatambinsudensidadenfuncindelespacioqueocupaencadauna
delastransformaciones.Enestecaso,estaraninterviniendolosesquemasresponsables
delacomprensindeladensidadydelacompresinydescompresin,esquemasqueno
seadquierenhastalaadolescencia.
Laexistenciadedesfasespondrademanifesto,porunlado,lainfuenciadelconte-
nidosobrelarealizacindelatarea:unoscontenidosfacilitaranmsqueotrossuestruc-
turacin;yalavezsubrayanelcarcterconcretodelasoperacionesdeesteperodoque
estnligadasacontenidosespecfcos.Esdecir,ponendemanifestolafaltadeindepen-
dencia entre la estructura lgica operacin y el contenido sobre el que se aplica,
independencia que slo se adquirir con el pensamiento lgico-formal. Finalmente, los
desfasestambinponendemanifestoladependenciadeunasconservacionesconrespec-
toaotras:laconservacindelasustanciapareceserunrequisitoparalaconservacindel
pesoysta,paralaconservacindelvolumen.
1.1.2. El desarrollo de la clasicacin, la seriacin y la nocin de nmero
Laclasifcacin
Entrminosgeneralesclasifcarobjetosconsisteenagruparlosenfuncindealgncri-
teriodesemejanzaoequivalencia,demaneraquecadaelementoseidentifqueporloque
tienedecomncomomiembrodeunaclaseynoporloquetienedenico.Enestesen-
tido,unaclaseposeedospropiedadesfundamentales:suintensin,relativaalconjunto
decaractersticasodecualidadesqueladefnenysuextensin,quehacereferenciaal
conjuntototaldeobjetosqueposeenesascualidadesocaractersticas.Portanto,enuna
correctaclasifcacindeobjetos,ambaspropiedades(intensinyextensin)debencoor-
dinarseycorresponderseestrictamente.
Paraestudiarlagnesisdelasoperacionesdeclasifcacin,Piagetutilizadostiposde
tareas:clasifcacinlibreycomprensindelainclusinjerrquicadeclases(vanseejem-
plosenlaFigura8.2).Enlastareasdeclasifcacinlibreseledaalniounconjuntode
objetosporejemplo,unconjuntodeformasgeomtricasquevaranenforma,tamao
ycoloryselepidequepongajuntaslasquesonsemejantes.Enlatareadeinclusin
jerrquicadeclasessepreguntaporlarelacinentrelasubclase(p.ej.,tringulos)yla
clase(p.ej.,fguras).Apartirdeestosdostiposdetareas,eneldesarrollodelaclasifca-
cin se han identifcado tres etapas: 1) colecciones fgurales (de 2 hasta 5 aos): al
principiolosniosvanagrupandolosobjetossinningntipodeplan,guiadosporcrite-
riosperceptivosdesemejanzamsqueporcriteriosdeclase(p.ej.,comienzacolocando
juntosloscuadrados,porloqueparecequeestactuandocomosisetratasedeunaclase,
peroderepentemiraaloquehahechoysisepareceaalgnobjetoconocido,loasimi-
la a l, exclamando, por ejemplo, es un coche!); 2) colecciones no fgurales (de 5
hasta7-8aos):losniosagrupanlosobjetosenfuncindelasemejanzadelosatributos
2
3
4


B
l
o
q
u
e

I
I
I
.

E
l

d
e
s
a
r
r
o
l
l
o

d
u
r
a
n
t
e

l
a

e
t
a
p
a

e
s
c
o
l
a
r

y

l
a

a
d
o
l
e
s
c
e
n
c
i
a
Punto
de partida
Tarea
Clasifcacin Inclusin
jerrquica de
clases
Seriacin
Simple Mltiple
Ponjuntaslasfgurasquesonsemejantes Quhay
ms,
tringuloso
fguras?
Quhay
ms,fguras
blancaso
fguras?
Quhay
ms,fguras
grandeso
fguras?
Ordenaloscrculos
demenoramayor
Ordenalasfgurasenfuncindesu
tamaoydesuforma
Resultado
Esperado
Forma Color Tamao Hayms
fguras
Seriacin simple
Seriacin mltiple
Figura 8.2. Ejemplos de tareas piagetianas utilizadas para estudiar las nociones de clasicacin y seriacin.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 235
loscuadrados,lostringulos,etc.asignandotodoslosobjetosqueencuentranacada
unodelosgruposquehaestablecido,einclusoestableciendosubclasesencadaunode
losgruposporejemplo,cuadradosblancos,cuadradosgrises,etc.,perotodavatie-
nen difcultades para comprender la inclusin: slo pueden comparar entre los subcon-
juntos(p.ej.,sihaymstringulosocuadrados),peronoentreelconjunto(fguras)con
elsubconjunto(tringulos);3)inclusinjerrquicadeclases:losniosrealizanclasif-
caciones jerrquicas combinando sin difcultad los procedimientos ascendentes (que la
subclasetringulosestincluidaenlaclasedefguras)ydescendentes(quelaclasefgu-
rasincluyediversassubclases,entreellasladelostringulos)ysoncapacesderealizar
lacomparacinimplicadaenlainclusin,estoes,elconjuntoconelsubconjunto.
Laseriacin
Laseriacinconsisteenagruparyordenarobjetosenfuncindeciertasdiferenciasapre-
ciablesenalgunadesuscaractersticas.Sellevaacabobasndoseenlasrelacionesasi-
mtricasentrelosobjetos,quesonalavezrelacionesunidireccionales(comopuedenser,
porejemplo,laalturaoeltamao).Porejemplo,sielobjetoAesmsaltoqueelobjeto
B, la relacin entre ambos es asimtrica uno es ms alto que otro pero adems es
unidireccionalporquesimultneamenteBnopuedesermsaltoqueA.Si,adems,el
tipoderelacinentreAyBescuantitativacomoenesteejemplohablamosderela-
cionestransitivas:siAesmsaltoqueBytenemosuntercerobjeto,C,queesmsalto
queA, entonces, necesariamente C es ms alto que B. La toma de conciencia de este
esquematransitivoesloquepermitealosniosylasniasordenaryseriarlosobjetos
queguardanentreellosrelacionescuantitativasasimtricas.
En la realizacin de tareas de seriacin como por ejemplo, la de las tres varillas
(vaselatarea5delaFigura8.1)losniospasanportresestadios:1)estadiopreope-
ratorio:slosoncapacesdeagruparlasvarillasdedosendosytampocopuedenrealizar
inferenciastransitivas;2)transicinalasoperacionesconcretas:aveceslogranrealizar
lasseriacionesyotrasno,porqueactanporensayoyerror;fracasanenlastareasenque
tienen que ordenar ms de diez elementos y en las de seriacin mltiple en las que se
requiereordenarlosobjetosenfuncindedosdimensiones(vaseFigura8.2).Adems,
cuandoselespidequeintercalennuevoselementosenunaserieyaconstruida,tienenque
comenzar la serie de nuevo y tienen difcultades para realizar inferencias transitivas;
3)operacionesconcretas:soncapacesderealizarlasseriesmsrpidamentedeloque
lohacanenelestadioII;puedenrealizarseriacionesmltipleseinferenciastransitivas.
Tambinpuedenrealizarlaseriacindeformamentaleintercalarelementosnuevosen
laserieyaconstruida.Cuandoconstruyenseriesmltiplessoncapacesdeestablecerco-
rrespondenciasentreloselementosdecadaserie(p.ej.,sabenqueeltringulopequeo
secorrespondeconelcrculoyconelcuadradopequeos).
Laconstruccindelnmero
Otrodelosaspectosquelosniosaprendendurantelaetapadelasoperacionesconcretas
esquelosobjetospuedensercontadosyque,portanto,lacantidaddeobjetoseln-
meroylasrelacionesordinalesentrelosmismos1.,2.,3.,etc.ayudantambin
acomprenderyaestructurarlarealidad.
236 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Piagetysuscolaboradoresestudiarondistintosaspectosconrespectoalanocinde
nmero.Unodeellosesbajoqucondicioneslosniosylasniaslleganaestablecerla
equivalencia o correspondencia cardinal entre dos conjuntos de elementos; es decir, la
conservacin del nmero. Para ello se utilizaron tareas de conservacin en las que se
preguntaporlaigualdadenlacantidaddeelementosdedosflasenlasquesevariabala
disposicinperceptivadesuselementos(vaseCaptulo5,Figura5.2).Enlaresolucin
detareasdeconservacindelnmero,losniospasanporlosmismosestadiosqueenla
conservacindelosotroscontenidosyaanalizados.
Otradelascuestionesestudiadasescmosellegaacomprenderelsistemadelosn-
meros naturales y su relacin con otras operaciones lgico-matemticas. Piaget sostiene
queclases,seriesynmerossondominioscognitivosquesedesarrollandeformasincr-
nicaeinterdependiente.Lacapacidadparatrataralosobjetosdeformaequivalentebase
delaagrupacinydelaclasifcacinposibilitaahoraalniodesarrollarlanocinde
nmerocardinalylepermitecontarlosobjetosignorandosusdiferencias.As,cuando
seafrmaaquhay5cuadradoscomprendequeloimportanteeselnmero,lacantidad
de objetos, independientemente de que los cuadrados sean iguales o diferentes entre s.
Porotraparte,losnmerostambinguardanrelacionesdeinclusindeclases(1estin-
cluidoen2,2en3,etc.)ytienen,asimismo,unvalorordinalel1vaantesqueel2,el
2antesqueel3locualestmsrelacionadoconlaseriacin.Portanto,losnmeros
sonalavezelementosdeclaseydeseriey,comoconsecuencia,paracomprenderlano-
cindenmero,esnecesarioqueelnioseacapazderealizaroperacionesreversiblesde
clasesyderelaciones.Perolanocindenmeroesalgomsqueclasifcaryseriarobje-
tos, pues supone una nueva sntesis que implica: 1) tratar a los elementos equivalentes
comounidadesparaquepuedansercontadas;2)conservarlaestructuradeinclusin;y3)
tenerencuentaelordenserialdelasunidadesparapoderdistinguirlasentres.
1.1.3. El desarrollo de las nociones espacio-temporales
LasoperacionesdeclasesyderelacionesdenominadasporPiagetlgiconumricas
tienenquever,comohemosvisto,conconjuntosdeobjetos,sintenerencuentalasrela-
cionesespacio-temporalesentreellos.Sonoperacionesqueserealizanentreobjetos,sin
considerar lo que ocurre intraobjeto. Sin embargo, los nios a menudo se enfrentan a
problemas que requieren razonar a partir de las relaciones parte-todo o parte-parte con
respectoaunmismoobjeto,paralocualtienenquetenerencuentarelacionesdeproxi-
midadespacio-temporal.Parahacerlo,esnecesarioaplicarelmismotipodeoperaciones
ylosmismostiposdeagrupamientosquepararealizarlaconservacin,lasclasifcaciones
olasseriaciones,peroenunaescalainferioroinfralgica.Estasoperacionesinfral-
gicas permiten el establecimiento de conexiones en el interior de los objetos con inde-
pendenciadesusdimensionesylaconceptualizacindecadaobjetocomountodo,como
uncontinuoespacio-temporalnico.Estetipodeoperacionesseconstituyenalasmismas
edadesydeformaparalelaquelasoperacioneslgicasvistasenelpuntoanterior.
Eldesarrollodelasnocionesespaciales
ElanlisisquePiagetysuscolaboradoreshacendeldesarrollodelasrelacionesespa-
ciales se centra en tres aspectos distintos: las relaciones topolgicas, proyectivas y
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 237
euclidianas.Lasrelacionestopolgicastienenqueverconlaproximidad,orden,cierre
ycontinuidaddelosobjetos.Estetipodepropiedadespermitendistinguir,porejemplo,
unafguracerradadeunafguraabierta.Lasrelacionesproyectivastienenquevercon
laordenacindeobjetosenelespacioyconlaspropiedadesinvariablesdelosobjetos
cuando se cambia la perspectiva desde la cual se miran. Finalmente, las relaciones
euclidianastienenqueverconlasdistanciasentreobjetosysumedida.Enellassein-
cluyenlaslongitudes,superfciesyvolmenes,ngulosylaelaboracindelossistemas
dereferenciahorizontalyvertical.Lasnocionestopolgicasaexcepcindelacon-
tinuidad
3
sonlasprimerasqueaparecenyestnyabienestablecidasalrededordelos
7 aos. Posteriormente, alrededor de los 9-10 aos, aparecen de forma ms o menos
sincrnica las nociones proyectivas y las euclidianas.Adems se propone que las no-
cionestopolgicassirvendebaseparalaconstruccindelespacioproyectivoyeucli-
diano.
Eldesarrollodelasnocionestemporales
Comprender las relaciones temporales implica comprender la sucesin temporal de los
acontecimientos,lainclusindeintervalosdetiemposmenoresenintervalosmayores,y
laeleccindeunaunidaddemedidatemporalqueseapliquedeigualformaadiferentes
acontecimientos.
LosresultadosdelasdistintasinvestigacionesrealizadasporPiagetycolaboradores
sobreeltiempomuestranquelosniosmspequeos:1)tienendifcultadesparaesta-
blecerelordentemporal,lasucesinordenadadeloshechos;2)nocomprendenquedos
duracionespuedenserdiferentespesealasimultaneidaddelcomienzoodelafnaliza-
cin;y3)carecendeunaunidaddemedidadeltiempoquelespermitacompararladu-
racindediferentesintervalostemporales(Flavell,1978).
En resumen, a partir de los 7-8 aos, los nios son capaces de reunir objetos para
realizar con ellos operaciones lgico-matemticas clasifcarlos, ordenarlos o contar-
los, lo cual permite a su vez, que de forma paralela, se construyan las nociones de
tiempoyespacio.Hacialos8aossecoordinanlasrelacionesdeordentemporalantes
ydespusconlasduracionesmsomenostiempo,locualfacilitalaelaboracin
deunanocindetiempocomnparatodoslosmovimientos.Conrespectoalespacio,se
empiezanaestructurarsusrelacionescualitativas:distancias,conservacindelaslongi-
tudes,superfcies,elaboracindeunsistemadecoordenadasyperspectivas,etc.
Sinembargo,notodasestasnocionesseadquierenalmismotiempo.Primerohacia
los7aosseconstruyendeformasimultnealasoperacioneslgicasdelainclusin
jerrquicadeclases,ydeseriacinderelacionesasimtricas.Laconstruccinsimul-
tneadelainclusindeclasesylaseriacinllevaalaaparicindelsistemadelosn-
meros.
Laadquisicindetodasestasnocionesquecaracterizanalpensamientooperacional
esposibleporqueenestemomentodeldesarrollolaestructurapsicolgicadelosnios
permitequeselleguenacomprender,deformasimultnea,elconjuntodetransformacio-
nesqueseejemplifcanenlaTabla8.1:
3
Lacontinuidadnosealcanzahastaelperododelasoperacionesformales.
238 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Tabla 8.1. Conjunto de transformaciones que se adquieren durante la etapa de las operacio-
nes concretas
Transitividad:dosaccionessucesivassecoordinanenunasola.Porejemplo,elnioescapazdedarse
cuentadequelascomparacionessucesivasA<ByB<Csecoordinanenunasola,A<C,ycomo
consecuenciaescapazdehacerlaseriacincompleta.
Reversibilidad:losesquemasdeaccinpresentesenelpensamientointuitivosevuelven
reversibles.Elniotomaconcienciadequelarealizacindeunaaccinpuedecompensarseporla
realizacindelaaccincontraria.
Asociatividad:elmismoresultadopuedeseralcanzadoporcaminosdiferentes.Porejemplo,
eslomismosumarunconjuntodeelementosenunorden(3+2+1)queenotrodistinto
(2+1+3).
Identidad:siserepiteunaaccin,noagreganadaasmismaycadarepeticindelasmismasslo
tieneunefectoacumulativo.
Tautologa:larealizacindeunaoperacinysuinversaeslaoperacinidntica.Porejemplo,agrupar
objetosyluegosepararlos,equivaleanohacernada.
Todasestastransformacionessonlaconsecuenciadelprocesodedescentracindel
pensamiento.Elresultadoesquelosniosdejandetenerencuentaslosupropiopunto
devista,paracoordinarotrospuntosdevistadiferentes;ypasandeconsiderarunanica
dimensindelobjetodejandeladolosestadospararazonarapartirdelassucesivas
transformacionesdelmismo.Conlallegadadelasoperacionesmentales,elnioyano
necesita manipular directamente los objetos para comprobar la transformacin que se
produce;puedeanticiparmentalmentelavariacinqueseocasionarasiseejecutarauna
accin,yalainversa,reconstruirelestadoinicialanulandomentalmentelatransforma-
cinhipotticamenteproducida.Estoesposiblegraciasaquesehaalcanzadolareversi-
bilidaddelpensamiento.
Estetipodepensamientopermitealosniosunamejoranotableensucapacidadpara
resolverproblemas.Yanoslosecentranenelobjetoyensuspropiedadescomoen
etapasanterioressinoenlasrelacioneslgico-matemticasyespacio-temporalesque
guardanconotrosobjetosyacontecimientosdelmundo.Estolespermitetomarconcien-
cia de que, pese a las transformaciones, algunas propiedades de los objetos como la
cantidad, la materia, la longitud, el volumen o el peso se conservan, y, como hemos
vistopuedenestablecercorrespondenciasentrelosobjetosclasifcarlos,contarlos,or-
denarlos,etc.Sinembargo,sucapacidadpararazonartodavapresentalimitacionesim-
portantes:puedenrazonarsobrelarealidadquepuedenpercibiromanipulardirectamen-
te, pero son incapaces de razonar a partir de proposiciones exclusivamente verbales o
ideasabstractas.Porejemplo,aunquehemosvistoqueelniopuedeconstruirdistintas
seriesyrazonarsobreellasaplicandoelesquemadelatransitividad,slopuedehacerlo
cuandoestnpresenteslosobjetoscuandopuedeverlosymanipularlos,nocuando
elproblemasepresentaverbalmente.As,sipresentamosverbalmentealnioelproble-
maanlogo:AnaesmsaltaqueBertayBertaesmsaltaqueEsther,culesms
altadelastres?,losniosnoloresuelvenhastamuchomstarde,aunquesusolucin
implicalaaplicacindelmismoesquematransitivosiA>ByB>C,entoncesA>C.
Estamos,pues,anteuntipoderazonamientoqueoperasobreloconcreto,yqueportan-
toesttodavamuyligadoalaaccin,deahquehayasidodenominadoporPiagetcomo
operacionesconcretas.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 239
1.1.4. Estudios de replicacin sobre las operaciones concretas
Laconceptualizacinrealizadaporlateorapiagetianasobreeldesarrollodelpensamien-
to en la etapa comprendida entre los 6 y los 11 aos ha tenido un gran impacto en el
estudiodeldesarrollocognitivo.Durantelosaossetentayochentaserealizaronungran
nmerodeinvestigacionesdedicadasacontrastarlossupuestosbsicosdelateora.En
estalnea,serealizaronnumerososestudiosdereplicacindentroyfueradelaescuela
deGinebraconelobjetivodecomprobarlarealidadpsicolgicadeltipodeoperacio-
nespropuestasporPiaget.
LosestudiosdereplicacinrealizadosenelsenodelaescueladeGinebratiendena
confrmarlossupuestosfundamentalesdelateora.PiageteInhlder(1963)citan,eneste
sentido,unconjuntoderesultadostendentesareplicarespecialmentelastareasdecon-
servacinysusdesfaseshorizontalesconmuestrasdeniosingleses,americanosyca-
nadienses.Lamayoradelosestudiosquecitanparecencorroborarlashiptesispiage-
tianas con ligeras desviaciones y stas se interpretan como debidas a pequeas
variacionesenlatarea,enelprocedimientoseguidooeneltipodecuestionamientorea-
lizadoalosnios.
Engeneral,losestudiosdereplicacincrticosconPiagettiendenamostrarquelos
niospequeostienenmscapacidadesdeloquePiagetsupona.Estetipodecrticase
apoyafundamentalmenteentresargumentos:
1. Distincinentrecompetenciayactuacin.Piagetbasasuconceptualizacinte-
rica en la observacin de cmo los nios resuelven determinadas tareas (actua-
cin)yapartirdeelloinferelapresencia(oausencia)deciertascompetencias
enlosnios.LoquelascrticassugierenesquePiagetsecentraexcesivamente
en las competencias generales sin detenerse en otros factores distintos a la
competencia que pueden estar infuyendo en la resolucin de la tarea. La in-
fuenciadeestosotrosfactorescomoporejemplo,lafaltadecomprensinde
las instrucciones o de las demandas de la tarea, la falta de familiaridad con el
material,etc.nopermitirainferirdirectamentequecuandounnionoresuel-
veunproblemaesquenoestenposesindelosesquemasoperatorioscorres-
pondientes.Dehecho,cuandosesimplifcanlastareas,laejecucindelosnios
mejoraconsiderablemente.
2. Faltadehabilidadescomunicativasdelosnios.Enrelacinconelpuntoante-
rior, ha de tenerse en cuenta que la capacidad lingstica de los nios y nias
tambinvaaumentandoconlaedad.Portanto,esposiblequeenalgunoscasos
losniossepanresolverlatarea,peronosepanjustifcarlaverbalmente.
3. Tareasmuydifcilesparalaedad.OtracrticafrecuenteesquePiagetutilizata-
reasdemasiadodifcilesparaevaluareldesarrollocognitivo.Diferentesestudios
hanmostradoquelasimplifcacindelatareaensmismamejoraelrendimien-
todelosniosynias.
1.2. El desarrollo de la atencin y de la memoria
Como ya vimos anteriormente, el estudio de los procesos cognitivos se ha realizado
fundamentalmentedentrodelparadigmadelprocesamientodelainformacin,deacuer-
240 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
do con el cual cuando la informacin entra al sistema cognitivo, sta es codifcada y
manipuladaesdecir,interpretadaymodifcadaenfuncindeotrainformacinqueya
contieneelsistemapreviamenteodenuevainformacinqueentraalsistemayreteni-
daoalmacenadadeformasimblica.Elresultadodeesteprocesoesunarespuestapor
partedelindividuoqueeselproductodelarecuperacindelainformacinpreviamente
procesada(vaseFigura8.3).
Entrada de la
infomacin
sensorial
Codificacin
y manipulacin
Almacenamiento Recuperacin Respuesta
Figura 8.3. Fases del procesamiento de la informacin.
Desdeestaperspectivasepartedelaanalogamente-ordenador.Esdecir,sesupone
quelamenteprocesalainformacindeformasimilaracomolohacenlosordenadores.
Utilizando esta analoga los investigadores pueden detallar con claridad y precisinlos
pasosutilizadosporlosniospararealizardeterminadostiposdeproblemas.
Dentrodeestemarcogeneraldelprocesamientodelainformacin,elestudioinicial
delaatencinylamemoriahatomadocomomarcodereferenciaelmodelodenominado
modelomultialmacndeAtkinsonyShiffrin(1968)deacuerdoconelcual,lainforma-
cinqueentraatravsdenuestrossentidosesprocesadaentresgrandesalmacenes:el
almacnsensorial,lamemoriaacortoplazo(MCP)ylamemoriaalargoplazo(MLP)
(vaseTabla8.2).
Tabla 8.2. Componentes del modelo multialmacn de Atkinson y Shiffrin.
1. Almacnsensorial:enestealmacnseregistralainformacinvisualoauditivaquellegaanuestros
sentidos.Enlpermaneceduranteunperododetiempomuylimitado,sufcientecomoparaquela
informacinquehasidoatendidapasealaMCPylaotrasepierda.
2. MemoriaaCortoPlazo(MCP):enestealmacnlainformacinsecodifcaysetransforma,esdecir,
seoperaactivamenteconlainformacinaplicandoprocesosdecontroloestrategiasmentales.Tiene
unacapacidadlimitada(slosepuedeoperarsimultneamenteconunacantidadreducidadeinforma-
cin)ytambinunaduracinbreve,deformaquelainformacinsobrelaquenoseestaplicando
ningunaestrategiadecodifcacinacabaperdindose.
3. MemoriaaLargoPlazo(MLP):lainformacinquehasidocodifcadaadecuadamenteenlaMCP
pasaalaMLP,enlaqueseguardadeformapermanente.
Estostresalmacenesdememoriaseraninnatosyportantouniversales.Constituiran
elhardwaredelsistema.Losprocesosdecontrol,esdecirlosprocesosyestrategiasque
se aplican para codifcar y recuperar la informacin, seran anlogos al software. Los
almacenesdememoriasonestructuraspocofexiblesenlasqueconexcepcindela
MLPlacantidaddeinformacinquepuedeserprocesadaeslimitadayeltiempoque
lainformacinpuedepermanecerenellastambin.Lasestrategias,porelcontrario,no
son innatas, sino que pueden aprenderse. La aplicacin de diferentes estrategias para
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 241
manipularlainformacinaumentalaefcaciaconlaquestaseprocesay,portanto,las
probabilidades de que se registre de forma permanente en la MLP y de que pueda ser
utilizadaparasuusoposterior.
Sin embargo, recientemente se ha cuestionado la existencia de estos almacenes de
procesamientoafrmandoquelaretencindelainformacindependemsdelaprofun-
didadconqueesprocesadaquedeloslmitesestructuralesdelosdiferentesalmacenes.
Deacuerdoconestaperspectiva,lainformacinqueseanalizasuperfcialmenteseolvi-
darapronto,mientrasqueaqullaqueseprocesaysecodifcaentrminosmsprofun-
dos (p. ej., en funcin de su signifcado o relacionndola con otros conocimientos) se
retendradurantemstiempo.Portanto,lasdifcultadesqueseexperimentanalintentar
procesarmuchainformacinalmismotiempovendrandeterminadasnotantoporlaca-
pacidaddelosalmacenesdememoria,sinopornuestracapacidaddeatencinque,alser
limitada, no se puede distribuir efcientemente en la realizacin simultnea de distintas
tareas.Porello,sehasustituidoeltrminoMCPporeldememoriadetrabajoome-
moria operativa, para referirse al espacio de procesamiento, es decir, al conjunto de
recursosatencionalesdelosquedisponenuestrosistemacognitivoparallevaracaboel
procesamientodelainformacin.Estosrecursosatencionalessondenaturalezalimitada.
Loqueesfexibleeslaformaenlaqueseaplican,demaneraqueamedidaqueseauto-
matizalaejecucindeunadeterminadatarea,seliberanrecursosatencionalesquequedan
disponiblespararealizarotrastareasdeformasimultnea.Porejemplo,cuandounaper-
sonaestaprendiendoatocaruninstrumentomusical,suejecucineslentaytorpeyno
puedealavezrealizarotrastareas.Suatencintienequedividirseentrelosmovimientos
quetienequerealizarylalecturadelapartitura.Sinembargo,amedidaqueaumentala
prctica, tanto la ejecucin como la lectura se automatizan y permiten liberar recursos
quepuedendedicarseaotrasactividadescognitivascomolaimprovisacin.
Algunostericosneopiagetianoshanretomadoestasideasparaexplicareldesarrollo
cognitivo.Porejemplo,Pascual-Leone(1970)proponequeeldesarrollocognitivosera
laevolucindeunconstructosimilaraldememoriaoperativadenominadoespaciomen-
taloespacio-M,referidoalosrecursosatencionalesquepuedenaplicarseenunmomen-
todeterminadoalaresolucindeproblemasconcretos.Esteespaciomentalaumentacon
laedadyseraelresponsabledeloscambiosqueseproducendeunosestadiosaotros.
Por su parte, Case (1985) propone un modelo en el que postula una capacidad total de
procesamientoqueincluyedoscomponentes:unodealmacenamiento(almacnacorto
plazo)yotrodeprocesamiento(espaciodelasoperaciones).Loquecambiaconlaedad
noeslacapacidadtotaldeprocesamiento,sinolaefcaciaconlaqueserealizanlasope-
racionesolosprocesosdecontrol.Elincrementodeesteespaciomentalamedidaque
se avanza en el desarrollo se debera no slo a factores madurativos, sino tambin a la
prctica,puestoqueamedidaquelosprocesosseautomatizanconlaprcticarequieren
menoscapacidaddeatencinycomoconsecuencia,sedejanlibresmsrecursoscogni-
tivosyaumentalacapacidaddelalmacnacortoplazo.Otroautorneopiagetiano,Hal-
dford(1993),hapropuestounmodelodedesarrollocentradoenelincrementodelaca-
pacidad de lo que denomina memoria primaria o memoria activa para referirse al
sistemaquealmacenalainformacinqueestsiendoactualmenteprocesada.
Loquetienenencomnestasteorasneopiagetianasesquetodasasumenqueloque
cambiaconeldesarrolloeslacapacidaddeprocesamiento,queessimilaralacapacidad
atencional y a la memoria operativa. En los siguientes epgrafes abordaremos sucinta-
242 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
mente el desarrollo de estas dos capacidades as como la evolucin de las funciones
ejecutivas,estrechamenterelacionadastantoconlaatencincomoconlamemoriaope-
rativa.
1.2.1. El desarrollo de la atencin
Comohemosvisto,laatencinqueseprestaadeterminadainformacinhacequestase
mantengaosepierda.Portanto,esunprocesofundamentalpuestoquedeelladepende
lainformacinquesevaaconsiderarparalarealizacindecualquiertipodetareacog-
nitiva.
Cuando se han estudiado los procesos de atencin en los nios, en general, se ha
observadoquepresentandifcultadesparacentrarseenlainformacinrelevanteeignorar
lairrelevante(atencinselectiva)ylescuestamantenerlaatencinduranteperodospro-
longadosdetiempo.Sinembargo,amedidaqueaumentalaedad,losprocesosatencio-
nalessehacenprogresivamentemscontroladosyplanifcados.
Hasta los 7 aos aproximadamente se observa que los nios no pueden prestar una
atencinsostenidaadeterminadosestmulosdurantemsdeunos7minutos.Sinembar-
go,elmantenimientodelaatencinduranteperodosmslargosdetiempoesunrequi-
sitoimprescindibleparaquelosniospuedanatenderselectivamentealosaspectosque
son relevantes para la tarea e ignorar (inhibir o desatender) toda la informacin que es
irrelevante.Elestudiodelaatencinselectivasehallevadoacabo,porejemplo,intro-
duciendo en las tareas algn estmulo irrelevante y midiendo el tiempo que los nios
tardanenrealizarla.Medianteestetipodemanipulacionessehacomprobadoquelaca-
pacidadparamantenerlaatencinenlosaspectosrelevantesdelatareamejorahacialos
6-8aos,peroaestasedadestodavasiguendistrayndoseconlainformacinirrelevan-
te.Noserhastalaadolescenciacuandopuedaninhibirtotalmentelainformacinirrele-
vante.
Apartirdelos9aostambinaumentalacapacidaddeplanifcacinparacambiarel
focodeatencindeunaspectodelatareaaotroporejemplo,enunatareadeclasif-
cacinparapasardecentrarseenlaformaahacerloeneltamaooelcolordelasfgu-
rasascomoparadistribuirlaatencinenfuncindelasdemandasdelatareaoenlos
distintospasosdelaresolucindeunproblema.Esapartirdelos12aos,aproximada-
mente,cuandolacapacidadatencionalmejorasignifcativamente.
1.2.2. El desarrollo de la funcin ejecutiva y de la memoria operativa
Comohemosmencionadoanteriormente,lamemoriaoperativaesunespaciodetrabajo
dondesemantienelainformacintemporalmentealtiempoqueseprocesaparaserusa-
daendiferentestareascognitivascomorazonar,comprender,resolverproblemas,etc.La
informacin que llega a la memoria operativa puede ser nueva o puede ser tambin in-
formacinqueserecuperadelaMLP.Deacuerdoconunodelosprincipalesmodelosde
memoria operativa (Baddeley y Hitch, 1974; Baddeley, 2000), la memoria operativa
(MO) se conceptualiza como una estructura compleja compuesta por distintos compo-
nentes: un ejecutivo central y tres subsistemas esclavos de apoyo especializados en
tareasconcretas:laagendavisoespacial,elbuclefonolgicoyelretnepisdico(vase
Figura8.4).
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 243
Ejecutivo
central
Agenda
visoespacial
Retn
episdico
Bucle
fonolgico
Figura 8.4. Modelo de Memoria Operativa de Baddeley (2000).
Elbuclefonolgicoseraelencargadodeprocesaryretenerlainformacinoraldu-
ranteunoodossegundos.Laagendavisoespacialestespecializadaenlaproducciny
manejodeimgenesmentales.Elretnepisdicoseraunalmacntemporaldeinforma-
cindecapacidadlimitadacapazdeintegrarinformacinprocedentedeunavariedadde
fuentes,tantodelosdistintossubcomponentesdelaMO,comodelaMLP.Elejecutivo
central sera un dispositivo de capacidad limitada encargado de regular y coordinar el
funcionamientodelosdistintossubsistemascontresfuncionesbsicas(Miyake,Fried-
man,Emerson,WitzkiyHowerter,2000):cambioatencionalocapacidadparaejecutar
latarea;actualizacinymonitorizacindeinformacinenlamemoria;ycapacidadpara
inhibirdeliberadamente(activamente)lasrespuestasautomticasopredominantescuan-
doesnecesario.
Lasfuncionesllevadasacaboporelejecutivocentralhansidoconceptualizadasen
unamplioconstructodenominadofuncinejecutivayselashaasociadoconelfuncio-
namientodellbulofrontal,queeselresponsabledelaplanifcacinyelcontroldela
actividadcognitiva,ascomodelrazonamientoabstracto.
Engeneral,lafuncinejecutivaincluyeunampliorangodehabilidadescognitivas
relacionadasconelcontrolconscientedelaaccin,elpensamientoylasemociones.En-
treellasseincluyenlaautorregulacin,elcontroldelainhibicin,laplanifcacinestra-
tgica,lafexibilidadcognitivayelcontroldeimpulsos(Readeretal.,1994).Deacuer-
do con Zelazo (2005) la funcin ejecutiva es la capacidad que est implicada en la
planifcacindelospasospararesolverunproblemabienseadendolecognitivaoemo-
cional.Estoimplica,almenos,laorquestacindediferentessubfunciones:1)represen-
tarseelproblema(qunecesitoparallevarloacabo);2)tenerunplanpararesolverlo;3)
llevaracaboelplan;y4)evaluarlasolucin.Cuandoestafuncinestalteradasema-
nifestanproblemasdeimpulsividadydefaltadeatencin.
Debidoaquelosniospresentanproblemasdeplanifcacin,controlysupervisin
de sus actividades cognitivas, algunos psiclogos evolutivos piensan que estos dfcit
puedenserdebidosalafaltademaduracindellbulofrontal.Paraprobarestahiptesis
sehatratadodecompararlaejecucindelosadultosquehansufridolesionesenell-
bulofrontalconladelosnios.Porejemplo,sehaobservadoquelosadultosconlesio-
244 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
nes frontales muestran problemas en tareas de clasifcacin como las descritas en el
Epgrafe 1.1.2. Cuando se les da una regla al comienzo de la tarea por ejemplo que
clasifquenlasfgurasenfuncindelaformayamitaddelatareasecambialaregla
y se les pide que las clasifquen en funcin del tamao, les cuesta cambiar de regla y
siguenhacindoloenfuncindelaforma(Diamond,1988).Estosehainterpretadocomo
una difcultad para inhibir la respuesta prepotente (clasifcar en funcin de la primera
regladada).Tambinsehanrelacionadoconfallosejecutivosladifcultaddelosnios
hasta los 7 aos en las tareas de conservacin (Russell, 1996) en las que como hemos
vistoenelEpgrafe1.1.1,losfallosseproducenporquelosniossedejanllevarporla
informacinperceptiva.EstosresultadoshanllevadoaproponeraautorescomoPenning-
ton (1994) que los nios hasta los 7 aos son incapaces de inhibir las caractersticas
perceptivasmsllamativas(p.ej.,ladiferenciadealturadellquidoenlatareadecon-
servacin)yportanto,suaccinestdirigidaporlainformacinestimular,msquepor
laplanifcacinyaplicacindereglasoestrategiasmentalesadecuadasparasolucionar
elproblema.
Precisamente,lacapacidadparacambiardeunaspectodelatareaaotro(fexibilidad
cognitiva)ylacapacidadparainhibirtantolasconductasorespuestasprepotentescomo
lainformacinqueesirrelevanteparalasolucindelosproblemas,sondosdeloscom-
ponentesprincipalesdelafuncinejecutiva.Dehecho,algunosautorescomoDempster
(1991) afrman que existe una correlacin entre las diferencias individuales observadas
enlacapacidadinhibitoriadellbulofrontalylasdiferenciasindividualesobservadasen
eldesarrollo.
Conrespectoaldesarrollodelafuncinejecutiva,sehaobservadoquelosprimeros
signos de control del pensamiento, de la accin y de la emocin ya aparecen durante
el primer ao, pero son tremendamente limitados. Sin embargo, la funcin ejecutiva
mejoradeformaconsiderablealolargodelainfancia.RecientementeBrockiyBohlin
(2006;Brocki,2007)hanllevadoacabounestudioevolutivoenniosde6a13aos
parainvestigarlosdistintoscomponentesdelafuncinejecutiva.Estasautorasencon-
trarontresdimensionesdelafuncinejecutiva:1)desinhibicin,relacionadaconpro-
blemasdeinhibicinderespuestas;2)velocidad/activacinquerefejaraundfciten
laautorregulacindelaactivacin,atencinymotivacinparahacerfrenteademandas
delatarea;y3)memoriaoperativa/fuidezqueseraunndicedefuncionamientocog-
nitivoefcazquesemanifestaenlacapacidadpararealizardostareassimultneamen-
te(distribuirlosrecursosatencionalesestratgicamenteentreellas),lacapacidadpara
inhibirinformacinirrelevanteolafuidezsemnticayfontica.
Estasautorasencontrarondiferentespatronesevolutivosdependiendodeltipodefun-
cin ejecutiva. La dimensin velocidad/activacin parece ser la primera que alcanza la
madurez(hacialos8aos)seguidadelainhibicin(hacialos10)ydelamemoriaope-
rativa/fuidezquetendraunaprimeraaceleracinevolutivahacialos10,peronoacaba
deconsolidarsehastalaadolescencia.Estosdatoscoincidenconotrosestudiosevolutivos
enlosquesesealantresestadiosdemaduracindelafuncinejecutiva:tempranain-
fancia(6-8aos),infanciamedia(9-12aos)yadolescencia.
Unaspectoimportanteenrelacinconeldesarrollodelafuncinejecutivaesqueen
losltimosaossehapropuestoquesusdfcitspuedenestarenlabasedetrastornosdel
desarrollocomoelautismooeldfcitdeatencinehiperactividadqueabordaremos
enelCaptulo12.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 245
2. Desarrollo emocional y social
2.1. Adquisicin de la competencia emocional
Eldesarrolloemocionalalolargodelainfanciatienequeverconlaadquisicindelo
queSaarni,Campos,CamrasyWitherington(2006)denominancompetenciaemocio-
nal, la cual estara compuesta por ocho tipos de habilidades que se enumeran en la
Tabla8.3.
Tabla 8.3. Habilidades bsicas para la competencia emocional (Saarni et al., 2006).
1. Tomadeconcienciadelasemocionespropias.
2. Capacidadparaidentifcarycomprenderlasemocionesdelosdems.
3. Capacidadparaexpresarverbalmentelasemocionesdeformaapropiadaalosusosdelaculturaenla
quevive.
4. Capacidadparaempatizarconlasexperienciasemocionalesdelosdems.
5. Toma de conciencia de que un estado emocional interno no tiene por qu corresponderse con una
manifestacinemocionalexterna.
6. Capacidadparaenfrentarsedeformaadaptativaalasemocionesaversivasyalascircunstanciasestre-
santes.
7. Tomadeconcienciasobrecmosecomunicanlasemociones.
8. Capacidadparalaauto-efcienciaemocional.
Todasestashabilidadesqueformanpartedelacompetenciaemocionalestnrelacio-
nadasconlademostracindeauto-efcaciaensituacionessocialesenlasqueseelicitan
emociones.Ensumayora,comienzanaadquirirsealiniciarselaescolaridadytienensu
culminacinenlaadolescencia.Veamosmsdetalladamentecadaunadeellas.
1. Tomadeconcienciadelasemocionespropias.Apartirdelos2-3aosdeedad
losniospuedenhablarensusconversacionestantodesusemocionescomode
las de los dems. Sin embargo, estas conversaciones estn circunscritas a con-
textosmuyfamiliaresyenellasnosehacealusinalascausasdelasemociones,
exceptocuandosetratadelasemocionesasociadasaldolorfsico(p.ej.,estoy
llorandoporquemehanempujado).Alos5-6aos,losniosempiezanarela-
cionaryasusemocionesconlaconsecucinonodeunametayconlasconse-
cuenciasdelaaccin(p.ej.,relacionanlaalegraconellogrodeloquequieren
ylapenaoelenfadoconsituacionesenlasquelasconsecuenciassoncontrarias
aloqueellosdesean).Apartirdelos10aos,losniosempiezanacomprender
que se puede tener emociones simultneas de signo contrario sobre diferentes
aspectos de una misma situacin (p. ej., empiezan a comprender que se puede
estar contento porque ha recibido un regalo de cumpleaos, pero triste porque
sumejoramigonohapodidoveniralafestaalmismotiempo).Sinembargo,
hasta que no llegan a la adolescencia no pueden integrar completamente emo-
ciones con valencias opuestas con respecto al mismo aspecto (p. ej., saber que
sequiereaunaamigaaunqueenesemomentoseestenfadadoconella).Ade-
ms,cuandolleganalapreadolescencia,yasoncapacesderevelarsusemocio-
246 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
nes y sus opiniones a los otros como una manifestacin de autoafrmacin, a
pesar de que ello pueda tener consecuencias negativas en su relacin con los
dems.
Latomadeconcienciadelasemocionespropiasesmuyimportanteparain-
terpretarlasemocionesdelosdems,paraestablecerrelacionesconlosiguales,
ascomoparademostrarempata.Facilitalaresolucindeproblemasporquesa-
bercmoresponderemocionalmenteesmuyimportanteparadecidircmoactuar
yparaevitarconsecuenciasindeseablesderivadasdelaactuacinsinpensar,de-
jndosellevarporelprimerimpulso.Asimismo,elconocimientodesuspropias
formas de reaccionar emocionalmente es una fuente importante de informacin
paralaformacindelaidentidad.
2. Capacidad para identifcar y comprender las emociones de los dems. La
capacidadparacomprenderlasemocionesdelosdemsnosedesarrollainde-
pendientementedeotrosaspectosdeldesarrolloemocionalocognitivo.Ocurre
deformaparalelaalatomadeconcienciadelaspropiasemocionesyalaca-
pacidadparaempatizarconlosotros.Amedidaqueseavanzaeneldesarrollo,
losniosrealizaninferenciasmsprecisassobrelossentimientosylasemocio-
nes de los dems tomando como referecia sus expresiones faciales. Desde los
7aoshastalaadolescencia,losniosvanaprendiendoprogresivamenteacom-
binar la expresin facial con indicios situacionales y se dan cuenta de que a
veceslosotrospuedenmanifestarunamezcladeemociones.Porejemplo,pue-
dencoordinarlaexpresinfacialdealegra(sonrisa)conunasituacingratif-
cante para un amigo (recibir un regalo), pero tambin pueden darse cuenta de
queaveceslaexpresinemocionalmostradanoescongruenteconlosindicios
situacionales (p. ej., una situacin de miedo o angustia ante un castigo con la
expresin facial de sonrisa). Los nios de estas edades ya no piensan que su
amigoestcontentoporquesonre,sinoqueyasedancuentadequesuamigo
puedesentiransiedadaunqueintentesonrer.Asimismo,losniosmayoresson
capacesdeinterpretarlasemocionesdelosdemsteniendoencuentanoslo
lainformacinpresente,sinotambinloquehapasado,oloquepuedenestar
anticipandosobreelfuturo(GneppyChilamkurti,1988).Tambinsoncapaces
deinferirlaexpresinemocionaldelosdemsenfuncindesusrasgosdeper-
sonalidad.
3. Capacidadparaexpresarverbalmentelasemocionesdeformaapropiadaa
losusosdelaculturaenlaquevive.Aligualquelosadultos,losnioscuando
sesientenmaldeseancomunicarsussentimientosalosdems.Alprincipio,cuan-
dosonmspequeos,alaspersonasmscercanasespecialmentealamadre
y luego a sus amigos ms ntimos. Para ello, los nios tienen que desarrollar
cierta competencia lingstica relacionada con el conocimiento del lxico emo-
cional.Losniosaprendenaponernombrealasemociones,aidentifcarlasya
describirlasapartirdesusconversacionesconlosadultos.Estalexicalizacinde
la vida mental y emocional les ayuda en su incipiente comprensin psicolgica
delmundomental.Paraqueestoseproduzcalosniostienenqueadquirirlxico
relacionadoconlasemocionesquelespermitacompartirconlosdemssuexpe-
rienciaemocional,ascomobuscaryobtenerapoyoenlascircunstanciasqueles
resultan angustiosas. Por tanto, el desarrollo de la competencia lingstica del
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 247
nio es un factor clave para que se puedan compartir experiencias emocionales
conlosadultos;peroadems,tambinesimprescindiblequelosadultosmuestren
predisposicinahablarconlosniosdetemasrelacionadosconlamente(desus
sentimientososusdeseos).
ComosehavistoenelCaptulo7,durantelainfancia,lacomunicacindelas
emocionesserealizabsicamenteconlamadre,perocuandoempiezalaescolari-
dadycomienzanlasrelacionesdeamistad,losniossemuestranmsproclivesa
revelarsussentimientosdevulnerabilidad(ansiedad,penaodao)asusamigos.
4. Capacidadparaempatizarconlasexperienciasemocionalesdelosdems.La
empataesunarespuestaemocionalquenospermiteconectarconlosotros.Esla
emocinqueexperimentaunobservadoranteelestadoemocionaldeotro.Supo-
ne,enciertoscasos,elcontagiodelestadoemocionaldelosdems.Enlosnios
mayoresyenlosadultosimplica,adems,lacapacidadparaponerseenellugar
delotroy,comoconsecuencia,sercapazdeexperimentardeformavicariacmo
sesientelapersonaqueestviviendoemocionalmenteunasituacin.
Laempatatienesusorgenesenlasinteraccionesdeatencinconjunta,refe-
renciasocialeintersubjetividadquetienenlugarentrelamadreyelnioypare-
ceestarrelacionadaconelestilodecrianzadelospadres.Lospadresempticos
tienen nios que se enfadan menos y que muestran mayor empata. Los padres
quesonmenosempticossonmscontroladoresysushijosseenfadanmsyson
menosempticos(Snyder,Stoolmiller,WilsonyYamamoto,2003;StrayeryRo-
berts,2004).Porotraparte,lospadresquemuestranunestiloexpresivonegativo
limitan la capacidad de los nios para regular su respuesta emptica, de forma
que cuando observa una situacin angustiosa en otra persona, el nio tiende a
angustiarse personalmente, en lugar de mostrar lstima o compasin hacia los
dems(Valienteetal.,2004).Porelcontrario,lasmadresqueexpresanemocio-
nes positivas y tienen una comunicacin clida con sus hijos, tienen hijos ms
empticosqueademsexperimentanmenossituacionesangustiosas.Sinembar-
go,cuandosellegaalaadolescencia,lacapacidadempticadelasmadresnose
relacionaconlaempatadesushijos.
5. Toma de conciencia de que un estado emocional interno no tiene por qu
corresponderse con una manifestacin emocional externa. La capacidad de
losniosparadisociarlaexpresinemocionaldelestadoemocionaltieneimpor-
tantesventajasadaptativasconrespectoalasrelacionesconlosdems.Permite
evitarsituacionesnegativas;sirveparaprotegerlaautoestimaaltratardepreser-
varsuimagenantelosdems;ayudaatenermejoresrelacionessociales,ejercer
infuencia sobre los otros y obtener apoyo de los dems; y, desde luego, es un
vehculoquepermiteelajusteprogresivoalasnormasyalasconvencionesso-
ciales.
6. Capacidadparaenfrentarsedeformaadaptativaalasemocionesnegativas
yalascircunstanciasestresantes.Eldesarrollodeestacapacidadimplica,pri-
mero, que el nio tiene que ser capaz de regular su activacin emocional es
decircontrolarlaintensidadyduracindesusemociones,expresarlasadecuada-
menteyregularlaexperienciacognitivadelasmismasydespus,desarrollar
estrategiasdeafrontamientoquelepermitanhacerfrentealasemocionesnegati-
vas. En las sociedades occidentales las estrategias adecuadas de afrontamiento
248 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
implicanlatomadeconcienciadequeunomismotieneciertocontroldelasitua-
cin.Entreellassehadestacado:ladistraccin(contrarrestarlaemocinconun
cambiodeactividad);lareinterpretacindelasemociones(consideracindeun
problemadesdeperspectivasdistintas);olabsquedadeapoyosocialdelosadul-
tosodelgrupodeamigos.
Saarnietal.(2006)hananalizadoeldesarrollodeestasestrategiasdeafron-
tamientoenfuncindedosdimensiones:
Solitario-social: aunque algunos nios utilizan estrategias individuales de
afrontamiento para aliviar la tensin como el ejercicio fsico o la fantasa, la
mayorabuscanelapoyodelosdemsenformadeayudaodeconsuelo.As,
losniosde6a7aosbuscanpredominantementeesteapoyoensuspadres,
mientrasquelosniosmsmayoreslobuscanentresusamigos.
Interna-externa:amedidaqueelniosevahaciendomayor,losprogresosque
lograanivelcognitivoymetacognitivolecapacitanparalaauto-refexin,lo
quelepermitedesarrollarestrategiascognitivasquesontilesparaenfrentarse
asituacionesaversivas.Porejemplo,aprendenautilizarladistraccin,apensar
deformaoptimistayacambiardeperspectivaparapoderevaluarlasituacin
de una forma ms positiva e incluso son capaces de imaginar cmo pueden
resolverla.
7. Toma de conciencia de la forma en que se comunican las emociones. Esta
habilidadrequierelatomadeconcienciadequelacomunicacindelasemocio-
nesdependedeltipoderelacinquesemantengaconelinterlocutor.Porejemplo,
yaenlainfanciatarda,esmsfrecuentequeunniosemuestrevulnerablefren-
te a sus amigos ms ntimos y no frente a sus compaeros; o con sus madres
frenteasuspadres.Lacomunicacinemocionalestprofundamenteafectadapor
elgradodeconfanzaqueexistaentrelosinterlocutoresylosniosmayoresya
tienenconcienciadequeelgradodeconfanzarequiereciertareciprocidadymu-
tualidad.
8. Capacidadparalaauto-efcienciaemocional.Implicalaaceptacindelapropia
experienciaemocionalentodossustrminos,positivosonegativos,convencionales
ono.Estaaceptacinevitarsentirseagobiadoporemocionesnegativasyconsi-
derarlasreaccionesemocionalescomoinjustifcadas.Ellogrodelaauto-efcacia
emocionalestrelacionadoconeldesarrollodelaautoestimayesmuydependien-
tedeldesarrollocognitivo,porloquenosealcanzahastalaadolescencia.
Comoestamosviendo,enelanlisisquerealizanSaarnietal.(2006)relacionanex-
plcitamente el desarrollo de la competencia emocional con pautas de actuacin social
adaptativaspartiendodelsupuestodequelasemocionessonenprincipiosocialesyre-
lacionalesperotambinsonsindudaunaexperienciainterna.Estosautoressepreguntan
cundoocurreelprocesodeinteriorizacindelasemocionesysisteseproducedefor-
maparalelaalprocesodeinteriorizacindellenguajequetienelugaraproximadamente
a la edad de 5-6 aos y que es clave para el inicio del proceso de auto-regulacin del
pensamiento.Algunos estudios llevados a cabo por Holdodynski y Freidlmeier (2006)
apuntanalaposibilidaddequeesteprocesodeinteriorizacindelaregulacinemocional
seproduzcadelos6alos10aos.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 249
2.2. El mundo de las relaciones
Comosehavistoalolargodeloscaptulosprecedentes,losniossedesarrollanenun
entorno de relaciones sociales que tienen un efecto determinante en su conformacin
comopersona,tantoanivelcognitivocomosocial.Laimportanciadelainteraccinsocial
hasidosubrayadaespecialmenteporlateoradeVygotski(vaseCaptulo1),alotorgar
unpapelfundamentalalarelacinconlosdemsenlaformacindelasfuncionescog-
nitivassuperioresytambinfueconsideradaaunquedeformamssecundariacomo
unfactordeldesarrolloporPiaget.Perolainfuenciadelainteraccinconlosdemsno
secircunscribesloaldesarrollocognitivo.Tieneigualmentenotablesinfuenciasenel
desarrolloemocionaly,porsupuesto,enelmoralysocial.
Apartirdelainteraccinconlosdems,losniosconstruyenteorasintuitivassobre
smismosysobrelasotraspersonasqueguanlacomprensindelasemocionesycon-
trolansusesfuerzospararegularlaactivacinemocional;articulanlaformacindelau-
toconceptoydelapersonalidad;oregulanelcomportamientosocialymoral.Estasteo-
rasvansiendomselaboradasamedidaqueaumentanlascapacidadesinductivasdelos
nios,peronopodranconstruirsesinelandamiajedelosadultosysinlacolaboracin
delosiguales.Sedesarrollanapartirdelasinteraccionesconlosadultosenlasquese
etiquetan, se experimentan, se describen, y se explican las causas y consecuencias de
aspectosrelacionadosconelmundosocialymental.Estasteorasnopermanecenestti-
cas,sinoqueseactualizanytomancuerpoenelconjuntodeinteraccionessocialesque
losniosmantienenconsuscompaerosysusamigosyconotrasfgurasdereferencia
alolargodeldesarrollo.
En los siguientes epgrafes veremos cmo infuyen estas teoras intuitivas que
Bowlbydenominamodelosinternosdetrabajo(vaseCaptulo4)eneldesarrollopsi-
colgicoposterior.Sinembargo,amedidaqueseavanzaeneldesarrollonosonigual-
mente importantes todas los tipos de interaccin social.As, mientras que durante los
primerosaosesfundamentallainteraccinconlosadultos,delos7alos11aosem-
piezanacobrarunamayorimportancialasrelacionesconlosigualesque,atravsdela
amistad,sirvendeapoyoyreferenciabsicaparaeldesarrollosocial.
2.2.1. La inuencia del apego en el desarrollo psicolgico posterior
Unodelosaspectosfundamentalesquearticulalarelacindelnioconsuspadres,es-
pecialmenteconsumadre,eselapego.Laconstruccindelvnculodeapegodurantelos
primeroaosdelavidadelniosevioenelCaptulo4.Ahoranosinteresaprofundizar
encmoinfuyenlasrelacionesdeapegoeneldesarrollopsicosocialdelnioalolargo
delainfancia.
La mayora de las investigaciones que se centran en estos aspectos toman como
marcodereferenciaelmodelodeBowlby(1980,1988).Segnestemodelo,apartirde
las experiencias tempranas de cuidado, los nios construyen representaciones, esque-
masoteorasintuitivasdenominadosmodelosinternosdetrabajosobrelaaccesi-
bilidadyresponsividaddesuscuidadoresysobreelmerecimientodeloscuidadosque
reciben. Estas representaciones guiaran no slo la percepcin de uno mismo, sino
tambin la eleccin de las futuras relaciones y la conducta hacia los dems.As, los
nios con modelos de trabajo seguro buscan y esperan apoyo, establecen relaciones
250 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
positivas con los dems y se comportan con ellos de forma confada y abierta. Por el
contrario, los nios con modelos de trabajo inseguro anticipan menos apoyo de los
dems,desconfandequeseanaceptadosporellosysevenasmismoscomonome-
recedoresdetalapoyo.
Losmodelosdetrabajointernosactuarancomofltrosinconscientesapartirdelos
cualesseconstruyenlacomprensindeunomismo,delasrelacionesydeotrasexperien-
ciassociales.Asimismo,proporcionanreglasdedecisinimplcitaspararelacionarsecon
losdemsquesirvenparamantenerlasexpectativasintuitivassobrelosotrosysobreuno
mismo.DeacuerdoconThompson(1998),losmodelosdetrabajointernosonmultifa-
cticosyensuelaboracinintervienenalmenoscuatrotiposderepresentaciones,asaber:
1) las expectativas sociales sobre las caractersticas de los cuidadores que se elaboran
duranteelprimerao;2)larepresentacindelosacontecimientosydelasexperiencias
relacionados con ellos que tienen lugar durante el tercer ao; 3) los recuerdos autobio-
grfcosdeacontecimientosespecialesqueseincluyenennarraciones;y4)laadquisicin
delateoradelamenteduranteeltercerycuartoao.Laintegracindetodosestosfac-
toresenlosmodelosdetrabajointernospermitelacomprensindelmundosocial(delas
personasydelosacontecimientossociales),lacomprensindeunomismoylainterpre-
tacindelasrelacionessociales.
Estosmodelosinternostiendenaperpetuarsealolargodeldesarrolloenpartede-
bidoalatendenciaquetodostenemosaconfrmarnuestraspropiascreenciasperono
son estticos, sino representaciones en desarrollo que surgen y van actualizndose pro-
gresivamentealolargodelosaos.Loscambiosmsllamativosenlosmodelosinternos
detrabajocoincidiran,deacuerdoconThompson(2006),conlosperodosdeldesarrollo
enlosqueseproducenloscambiosrepresentacionalesmsimportantes:enlatransicin
al pensamiento simblico al fnal del perodo sensoriomotor y con la emergencia del
pensamientoabstractodurantelaadolescencia.
Lainfuenciadelosmodelosinternosdetrabajoeneldesarrollopsicosocialauna
determinadaedaddependerdelaseguridaddelasrepresentacionesqueseestnelabo-
rando en ese momento. Por tanto, los diferentes aspectos de los modelos de trabajo
expectativas sociales, recuerdos autobiogrfcos, narraciones, etc. no slo tienen
distinto curso evolutivo sino tambin diferentes perodos de infuencia crtica.As, la
infuenciadeestosmodelospuedesermayorenlosperodosenlosqueciertosfactores
estndesarrollndosedeformamssignifcativa.Porejemplo,losmodelosinternosde
apegoseguropuedentenerunamayorinfuenciasobrelacomprensindelasemociones
duranteelperododeconstruccindelateoradelamentequeenotrosmomentosdel
desarrollo.
ComosehavistoenelCaptulo4,existeciertodebatesobrelacontinuidadono
delvnculodeapegoalolargodelavidaysuinfuenciaeneldesarrollopsicosocial.
Losinvestigadoresqueaboganporlacontinuidadsehancentradoenelestudiolain-
fuenciadeltipodevnculodeapegotempranoeneldesarrollopsicolgicoposterior.
Dehecho,lainfuenciadelosvnculosdeapegosehaestudiadoenrelacinconuna
gran variedad de comportamientos y formas de relacionarse durante la infancia, la
adolescenciaylaedadadulta.Entreestasconductasseencuentranlarelacinpadres-
hijos,elestablecimientoderelacionesconlosiguales,lasrelacionesdeamistadyde
noviazgo,oeneldesarrollodelapersonalidad,entreotras.Sinembargo,otrosinves-
tigadorescriticanlainfuenciadeterministadelosprimerosapegossobreeldesarrollo
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 251
posterior,insistiendoenqueexistenotrosmuchosfactoresquematizanomodulantal
infuencia.ComoyasesealenelCaptulo4,laevidenciaempricaescontrovertida,
pero vamos a analizarla con ms detalle en relacin con las relaciones sociales y el
desarrollodelapersonalidadqueseproducedurantelainfanciahastallegaralaado-
lescencia.
Apegoyrelacionessociales
Unadelasmanifestacionesmsdirectasdelapegoseguroseencuentraenlasrelaciones
padres-hijos. La construccin del apego seguro durante el primer ao proporciona una
baseseguraparaunabuenainteraccinconlospadres,sobretododuranteelsegundoao
devida.Hastalosdosaos,sehaobservadoquelosniossegurostienenmejoresrela-
cionesconsusmadres,yasimismo,lasmadresdeniossegurosproporcionanmsayu-
dayapoyoysecomportandeformamsconsistenteysensible.Sinembargo,laeviden-
ciadelarelacinentreapegoseguroybuenainteraccinconlospadresamedidaquese
avanza en el desarrollo no es concluyente. Algunos estudios muestran que hay cierta
asociacinaedadesmstardas,mientrasqueenotrosnosehaobservado.Encualquier
caso, en los estudios en los que s se ha observando la relacin, sta va menguando a
medidaquepasaeltiempo.Parecepues,quelacontinuidaddelasbuenasrelacionesen-
trepadresehijosnoslodependedelaconstruccindelapegoseguroduranteelprimer
ao,sinoqueestaramediadaporotrasvariablesycondicionesqueafectanalavidafa-
miliar(Thompson,2006).
Algosimilarocurreconlarelacinentreapegoseguroyelestablecimientoderela-
cionesdeamistad.Sehaencontradociertaevidenciadequelosniosconapegoseguro
se socializan mejor, son ms populares y ms aceptados durante el perodo preescolar.
Sinembargo,enlosestudiosamslargoplazolaevidenciaesdenuevopococoncluyen-
te.Mientrasqueenalgunosestudiosnosehaencontradorelacinentreapegoeinterac-
cin con los iguales desde los 4 a los 7 aos, en otros s se obtiene a los 9-10 aos, e
inclusoenlaadolescenciamedia.
En resumen, la infuencia del apego seguro parece ser bastante considerable en la
calidad de las relaciones que el nio establece durante sus primeros aos de vida tanto
consuspadrescomoconsusiguales.Sinembargo,lainfuenciadelapegoamslargo
plazoaunqueenalgunoscasosexistenoestanevidente,pudiendoestarmodulada
porotrosfactorescomolacontinuidad(oloscambios)enlacalidaddeloscuidadospa-
ternosquelosniossiguenrecibiendoalolargodeldesarrollo,eltipoylacalidaddelas
relacionesqueseestablecenconlosigualesaedadesmstardasolaexposicinafac-
toressocialesestresantes,entreotros.
Apegoydesarrollodelapersonalidad
Elapegosegurooinsegurodurantelainfanciapuedemoldearmuchosaspectosdelde-
sarrollo de la personalidad como la sociabilidad, las predisposiciones emocionales, la
autoestima,laconfanza,lacuriosidadolaindependencia.Paraestudiarestosaspectos,
Sroufeetal.(2005)llevaronacabounestudiolongitudinalconniosdefamiliascon
pocos recursos econmicos desde los 12 meses hasta los 28 aos. Encontraron que el
apegoseguroalos12y18mesesserelacionabaconlasaludemocional,conelaumento
252 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
delaautoestima,unamayoriniciativayautoconfanza,manifestacionespositivasdelos
afectos,resilienciaycompetenciasocialenlainteraccinconlosdems(conlosiguales,
conlosprofesores,conlasparejas,etc.).Adems,puntualizanquelainfuenciadelape-
go sobre la personalidad se ve modulada a lo largo del desarrollo por las experiencias
subsiguientesenlaobtencindecuidadoyapoyo,ascomoporlasinteraccionesconlos
dems.
Enresumen,elestablecimientodelapegoseguroduranteelprimeraodevidaesun
factor que instaura una buena relacin entre padres e hijos que, en trminos generales,
predice una buena socializacin sobre todo en las primeras etapas del desarrollo. Pero
por s slo el apego seguro no predice buen desarrollo psicosocial a ms largo plazo.
Necesitadelaconcurrenciadeotrosfactorescomolacontinuidadenlacalidaddelos
cuidados y en el apoyo proporcionado para que su infuencia positiva se manifeste.
Peroadems,amedidaqueseprogresaeneldesarrolloaparecenotrosfactoresquetam-
bininfuyenenlaarmonadelasrelacionespadres-hijos,enlacompetenciasocialoen
el desarrollo de la personalidad. Estos otros factores no se han tenido en cuenta en los
estudiossobrelainfuenciadelapegoeneldesarrollopsicolgicoposterior,porloque
parece aventurado establecer una relacin causal y determinista entre apego seguro y
desarrollopsicosocialposterior.Porotraparte,enlamayoradelosestudiosrealizados,
sehaconsideradocomondicedeapegoseguroelquelosniosyniasestablecencon
susmadresduranteelprimeraodevida,cuandoyasesabeysereconocequelosnios
pueden tambin desarrollar relaciones de apego signifcativas con el padre y con otras
fguras de apego (abuelos, cuidadores, etc.). Como consecuencia, aunque el estableci-
mientodelapegoseguropareceinfuirdeformapositivaeneldesarrollopsicosocialy
dealgunamanerasesgaelestablecimientodefuturasrelacionessenecesitanmses-
tudiosenlosqueseanalicelainfuenciadeotrosfactoresquejuntoconelapegose-
guropuedenestardeterminandolacalidaddelasrelacionessocialesoeldesarrollode
lapersonalidad.Enespecial,estudiosqueanalicenlarelacinentreelapegoseguroylos
modelosinternosdeunomismo,delosotrosydelasrelaciones;ycmoestosmodelos
mentalesvancambiandoalolargodeldesarrolloenfuncindelasnuevasrelacionesque
sevanestableciendo.
Cuandosehanrealizadoestetipodeestudios,sehanobtenidoresultadosesclarece-
doressobrelosfactoresquemedianlarelacinentreelapegoseguroylacompetencia
social, entre los que cabe destacar: las representaciones mentales de las intenciones de
losdems;lasinferenciasemocionales;losprocesosdiscursivosentrepadresehijosque
moldeanlacomprensindelasemocionesylatransmisindeexpectativasycreencias;
las prcticas de crianza de los nios y la historia de las relaciones, entre otros. Lo que
nosmuestranestosresultadosesquelarelacinentreelestablecimientodeapegoseguro
duranteelprimeraoyeldesarrollopsicosocialposteriornoesunarelacindirecta,sino
queestmediadaporlainteriorizacinquehaceelpropioniodelaspautasderelacin
ydeinteraccinsocialporlasquepasaalolargodelprocesodedesarrollo.Estoquiere
decirquelaconstruccindelapego,siendoimportantsimoparalasprimerasadaptacio-
nesindividualesysocialesdurantelosdosprimerosaos,noacabaah,sinoquecontina
formndose a lo largo del desarrollo a partir de pautas de interaccin con las distintas
fgurassociales:padres,amigos,maestros,etc.;pautasdeinteraccinquesonfundamen-
talesparaunadecuadodesarrollopsicosocial.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 253
2.2.2. Las relaciones con los iguales
A partir de los 6-7 aos se produce un gran aumento en las interacciones sociales que
mantienenlosnios,nosloencantidadsinotambinencalidad.Encantidad,porqueel
entornoescolarproporcionamuchasoportunidadesdeinteraccinconotrosadultosycon
losdemsnios.Encalidad,porqueempiezanarelacionarsedeformamsintensa,con-
sistente y prolongada con sus iguales y aparecen nuevos contextos de interaccin: el
hogarcedeimportanciaafavordelaescuelayaparecennuevasformasdeinteraccina
travs de los medios tecnolgicos. El telfono, Internet o la televisin se convierten en
mediosyentornosqueestnasociadosadistintostiposdeinteraccinentreigualesyque
sustituyenaladiadapadres-hijos.
Delarelacinconlospadresalarelacinconlosiguales
Comohemosmencionadoanteriormente,durantelosprimerosaosdelavidadelnio,
lafamiliaconstituyeelescenariofundamentalderelacinenelquelafguradereferen-
ciaporexcelenciasonlospadresycuidadores,especialmentelamadre.Delos6alos12
aos,sinembargo,empiezaacobrarimportancialainteraccinenotroscontextoscomo
laescuela,internetuotrosespaciosquefavorecenlaactividadldicayconotrasfguras
sociales:losiguales.
Cuandosehancomparadolasinteraccionesentreigualesduranteestaetapaenrela-
cinconelperodopreescolar,sehaconstatadoqueduranteestaetapadisminuyencon-
siderablemente las agresiones fsicas, pero aumentan las agresiones verbales (insultos,
amenazas,etc.)yaumentaeljuegodereglas.Alprincipio,losniosconsideranqueen
eljuegolasreglassoninmutablesyquetodosdebencumplirlas,perohacialos8aos,
puedenellosmismosestablecerlaspropiasreglasdeljuego,aunqueseesperaquetodos
los que participan en l las cumplan.Asimismo, tambin se ha observado que a estas
edadesaumentaeljuegoviolento,especialmenteentreloschicos;eigualmenteesmuy
frecuenteelcotilleo.Estaprcticadeinteraccinsehaconsideradounamanifestacinde
loqueesunapreocupacinfundamentaldelosniosaestasedades:laaceptacinsocial.
En este sentido, el cotilleo puede servir para reafrmar el sentimiento de pertenencia al
grupoyrevelaelconjuntodeactitudes,creenciasycomportamientosquesonimportan-
tesparalainclusinoexclusindelosniosenlosgrupos.
Los compaeros y los amigos a travs de la amistad se convierten en el principal
marcodereferenciaydeapoyoemocional.Diversosestudioshanencontradounacorre-
lacinentrelasrelacionesestablecidasconlosigualesenlainfanciayelajustepsicol-
gico posterior. Cuando las relaciones sociales son positivas, se augura un mejor ajuste
futuroporqueafanzanlasensacindepertenenciaalgrupoypotencianlasactitudesy
las creencias positivas, como por ejemplo, la conducta prosocial y de ayuda. Tambin
facilitanelaprendizajeencontextosdecolaboracin.Sinembargo,nosiemprelasinter-
accionessocialestienenconsecuenciaspositivas.Entrelasconsecuenciasnegativasdela
relacinconlosigualesRubin,BokowskyyParker(2006)sealanelentrenamientodes-
viado,laco-rumiacin,elacoso(bullying)ylavictimizacin.Elentrenamientodesviado
tienelugarcuandoloschicosychicasserefuerzanentrescomportamientosagresivosy
conducta antisocial. La co-rumiacin de pensamientos y sentimientos negativos se ha
observado en la comunicacin entre amigas ntimas, especialmente en la adolescencia
254 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
temprana.Elacoso(msconocidoporbullying)consisteenagresionesverbalesyfsicas
queserealizandeformareiteradayconsistentehaciadeterminadosmiembrosdelgrupo.
Lavictimizacinestasociadaalaagresividadyalrechazosocial.Elnioagresivoes
victimizado porque su conducta resulta irritante para los dems. Por su parte, el nio
rechazado puede ser victimizado por el grupo porque es incapaz de tomar represalias
cuandoesprovocado.Enelsiguienteepgrafenoscentraremosenelanlisisdelasrela-
ciones de amistad; el acoso y otras conductas sociales desviadas lo abordaremos en el
Captulo12.
Laamistad
Apartirdelos7aoslosniosempiezanaelaborarelconceptodeamistadbasadoenla
continuidaddelasrelacionesconlosdemsquenoestncircunscritasalarealizacinde
actividades concretas. Durante los primeros aos (7-8 aos) el concepto de amistad es
instrumental;estbasadoenloscostesybenefciosdelainteraccinconlosdems.Se
es amigo de los que viven ms cerca, o de los que tienen juguetes ms bonitos o ms
apetecibles.Sinembargo,hacialos10-11aos,elconceptodeamistadcambiahaciael
reconocimientodelaimportanciadepodercompartirvaloresydesentirsecomprendido
porlosotrosyaparecenasociadosalaamistadsentimientoscomolalealtad,lacercana,
laconfanzamutuaolaintimidademocional.Aunqueestossentimientosasociadosala
nocindeamistadvandesarrollndoseconlaedad,sehanobservadomsfrecuentemen-
teenlaschicasqueenloschicos.
Deformaconcurrentealoscambiosqueocurrenenlanocindeamistad,tambinlo
hacenlospatronesdecomportamientoylaimplicacinparaconlosamigos.Enlainfan-
ciamedia,lasamistadessonmsestablesqueenlosaosprecedentesyademssonms
recprocas.Lasamistadesestableshastalaadolescenciasuelenincluirdiadasenlasque
semuestranconductasprosocialesyaltruistasyestnasociadasainteraccionespositivas.
Enlainteraccinconlosamigoslosniosmuestranunareciprocidadmsefectiva,mayor
intensidadycomprensinemocionalqueenlainteraccinconotroscompaerosnoami-
gos. En este sentido, la amistad proporciona un contexto positivo para la expresin y
regulacinemocionalqueaumenta,especialmente,alllegaralaadolescencia(vaseCa-
ptulo10).
Porelcontrario,ladisolucindelasamistadesduranteesteperodopuedetenerserias
implicacionesenelajustedelosniosyesespecialmentedolorosoenlapreadolescencia,
conduciendo en algunos casos a la aparicin de episodios depresivos, al aumento de la
sensacindesoledadyalriesgodeservictimizadoporloscompaeros.
Engeneral,conrespectoalasrelacionesdeamistad,seobservaquetantochicoscomo
chicassesientenatradosyeligencomomejoresamigosachicosychicasquesonsimi-
laresaellosenedad,sexoycontendenciascomportamentalessemejantes.Sinembargo,
ensusrelacionesdeamistad,chicosychicasmuestranpatronesdecomportamientocua-
litativamentediferentes.Lasrelacionesdeamistaddelaschicasestnmarcadasporuna
mayor intimidad, autoconfanza, validacin y proteccin o cuidado, aunque, paradjica-
mente,susrelacionesdeamistadsonmsinestablesquelasdeloschicos.Porelcontrario,
lasamistadesdeloschicosestnmscentradasenlasactividadesfsicasqueenlaintimi-
dad y normalmente no requieren el intercambio de informacin personal. Sin embargo,
cuandoelmejoramigodeunchicoesunachica,elgradodeintimidadesmayor.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 255
2.3. El desarrollo moral
Enloscomienzosdelestudiodeldesarrollomoralsteseconsiderabacomoelproducto
delejerciciodelcontrolsocial(delaautoridad)sobrelosdeseosylosimpulsosdelindi-
viduo.Desdeestaperspectivacompartidacondistintosmaticesporelpsicoanlisisy
elconductismolaansiedadylaculpaeranconsideradaslosmotivosbsicosparaque
elnioacatelasnormassocialesacostadeinhibirsusnecesidades.
LapropuestadePiaget
4
sobreeldesarrollomoral,enlugardecentrarseenlosmotivos
bsicosparaelacatamientodelasnormassocialestratadeanalizarcmoseconstruyen
las nociones morales a lo largo del desarrollo a partir de las interacciones sociales con
los adultos y con los iguales. Como ya se vio en el Captulo 7, Piaget propone que el
desarrollomoralprogresadesdeconcepcionesdelamoralidadbasadasenlaobediencia
alosadultosoalaautoridadyelacatamientodenormassociales(moralidadheterno-
ma),haciaunamoralidadmsautnomaguiadaporelrespetomutuoentrelaspersonas,
porlaindependenciadelosindividuosyporlaparticipacinactivadelaspersonasenla
elaboracindelasnormas.Portanto,elrespetoeslabasefundamentaldelapropuesta
piagetiana del desarrollo moral, que evoluciona desde el respeto unilateral a la norma
hacialaconsideracindelrespetomutuo.
Sinembargo,elverdaderogirocopernicanoenrelacinconelestudiodeldesarrollo
moralfueprotagonizadoporKohlberg,quiencriticelestudiodeldesarrollomoraldes-
de las perspectivas psicoanalticas y conductistas demandando una aproximacin ms
centradaenlafundamentacinflosfcadeloqueconstituyeelpensamientomoral;es
decir,teniendoencuentaladefnicindeloqueconstituyelamoralidadysusignifcado
(Turiel,2006).
Apartirdelapropuestapiagetiana,Kohlbergpresentsupropiaformulacindelde-
sarrollo moral partiendo de dos supuestos fundamentales: a) las ideas morales no se
construyenslonifundamentalmentemediantelaimposicindelasnormasporpartede
losadultosy,portanto,nosonelresultadodelconfictoentrelasnecesidadeseintereses
de los nios y los requerimientos de la sociedad, y b) los conceptos morales no se ad-
quierensloparaevitaremocionesnegativascomoansiedadoculpa.Porelcontrario,los
niostratandecomprenderelmundosocialquelesrodeay,apartirdelasinteracciones
socialesconlosadultosyconlosiguales,vanelaborandoconceptosmoralescomojus-
ticia,igualdad,bienestaroderechos.Enestesentido,losniosactuarancomopequeos
flsofosmorales.
De acuerdo con este planteamiento, Kohlberg sostiene que las nociones morales se
construyenensentidopositivo.Losniosestnintegradosenuncontextosocialenelque
interactanconlosadultosyconlosiguales,yesapartirdeestasinteraccionessociales
como van desarrollando emociones de empata hacia los otros, y comportamientos de
ayuda y respeto hacia los dems. Emociones y comportamientos que son clave para la
construccindeconceptosmoralescomojusticia,derechos,igualdad,etc.Portanto,para
Kohlberg,eldesarrollomoralseconstruyeapartirdelasinteraccionessocialescuando
losniossoncapacesdetenerencuentalaperspectivadelosotros.
4
EnelCaptulo7yasevieronlasnocionesbsicasdeldesarrollomoraldeacuerdoconlateorapiage-
tiana.Afndeevitarreiteracionesinnecesariasnonosvamosadetenerensuexplicacindetalladaenestos
momentos,perossedebentenerpresentessusaportacionesparalacomprensindeesteepgrafe,ascomo
paraestablecerlasoportunasrelacionesconlasotraspropuestassobredesarrollomoral.
256 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Paraestudiareldesarrollomoral,Kohlbergpresentabaalosniosyalosadolescen-
tesdilemasmoralesylespedaqueemitieranunjuiciosobreellos.EnlaTabla8.4,pue-
den verse algunos ejemplos de estos dilemas. Estas situaciones estn concebidas para
poner en juego distintos conceptos morales. Por ejemplo, en la primera situacin para
emitirunjuiciomoralhayquetenerencuentaconsideracionessobreelvalordelavida,
losderechosdepropiedad,siescorrectorobar,sisepuededejaraalguienmorir,lavio-
lacindelasleyes,lasobligacionespersonales,etc.
Tabla 8.4. Ejemplos de algunos de los dilemas morales utilizados por Kohlberg
EnEuropahayunamujerquepadeceuntipoespecialdecnceryvaamorirpronto.Hayunmedicamento
que los mdicos piensan que la puede salvar. Es una forma de radio que un farmacutico de la misma
ciudadacabadedescubrir.Lamedicinaescara,peroelfarmacuticoestcobrandodiezvecesloquele
ha costado a l hacerla. l pag 200 $ por radio y est cobrando 2.000 $ por una pequea dosis del
medicamento. El esposo de la mujer enferma, Heinz, acude a todo el mundo que conoce para pedir
prestado el dinero, pero slo puede reunir unos 1.000 $ que es la mitad de lo que cuesta. Le dice al
farmacuticoquesuesposaseestmuriendoylepidequelevendaelmedicamentomsbaratooledeje
pagar ms tarde. El farmacutico dice: No; yo lo descubr y voy a sacar dinero de l. Heinz est
desesperadoypiensaenatracarelestablecimientopararobarlamedicinaparasumujer.
DebeHeinzrobarlamedicina?Porquoporquno?
Joeesunmuchachodecatorceaosquedeseairauncampamento.Supadrelehaprometidoquepuede
irsiconsigueahorrareldinerolmismo.Joehatrabajadomuchorepartiendoperidicosyhaahorrado
los 40 $ que cuesta ir, y un poco ms. Pero justo antes de que deba empezar el campamento, su padre
cambiadeidea.Algunosdelosamigosdesupadrehandecididoirdepescayltienepocodineropara
lo que le costara. Le dice que le d el dinero que ha ahorrado repartiendo peridicos. Joe no quiere
renunciarairalcampamento,asquepiensaennegarseadarleasupadreeldinero.
DebeJoenegarseadarleasupadreeldinero?Porquoporquno?
A partir del anlisis de estos juicios, Kohlberg establece seis estadios de desarrollo
moralqueseagrupanentresniveles:
1. Nivel preconvencional (estadios I y II): Los nios dan respuestas basadas en la
obedienciayenlaevitacindelcastigo.
2. Nivel convencional (estadios III y IV): Comenzara a manifestarse hacia los 10
aoshastalaadolescenciatarda.Losniosdanrespuestasbasadasenlasobliga-
cionesasociadasalosrolessocialmenteestablecidos,enconcepcionesestereoti-
padasdeloqueesserunabuenapersonayelrespetoalasnormasyalaautori-
dadlegitimadasporelsistemasocial.
3. Nivelpostconvencional(estadiosVyVI):Lasrespuestasdelosadultosestnba-
sadasenacuerdoscontractuales,procedimientosacordadospararesolverconfic-
tos, respeto mutuo y diferenciacin entre justicia y derechos. Los juicios estn
basadosnoenlasnormasestablecidassinoenlabsquedadelbiencomn,enla
justiciayenlaequidad.
ParaKohlbergestosestadiosseranformasuniversalesdejuiciomoralcomunesalos
individuosqueparticipaneninteraccionessociales,aunqueelcontenidodelamoralidad
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 257
podravariardeunasculturasaotras.Engeneral,sehaobservadoqueexistenbastantes
similitudes entre distintas culturas en relacin con los tres o cuatro primeros estadios
correspondientesalnivelpreconvencionalyconvencional.Sinembargo,haydiferen-
cias culturales en relacin con el nivel postconvencional. De hecho, se han encontrado
muypocaspersonasquehayanllegadoalltimoestadio.
Noobstante,comohemosvisto,lostiposdedilemasqueutilizabaKohlbergsonmuy
complejosymultifacticos.Pararazonarsobreellosserequiereponerenjuegodistintas
posibilidadeseinformacinprocedentedemuydistintasfuentes,locualpuedeserexce-
sivamentedemandanteparalosniosmspequeos.AjuiciodeTuriel(2006)stapue-
deserunadelasrazonesporlaquelosniosmspequeosparecenmscentradosenla
obedienciaalaautoridadynoenotrotipodeargumentosorazones.Lacuestinquese
planteaessiestolohacendebidoasuniveldedesarrollomoral,oporqueenrealidadlas
situacionesplanteadassonexcesivamentecomplejasparasunivelcognitivo.Enestesen-
tido, algunas investigaciones muestran que cuando se simplifcan las situaciones sobre
las que los nios tienen que razonar, los ms pequeos s son capaces de hacer juicios
moralessobreaspectoscomolajusticiadistributiva,oaccionespositivasenrelacincon
losotros(ayudaogenerosidad)ensituacionesenlasquenoestnobligadosporninguna
normasocial.
Enrelacinconlajusticiadistributiva,losjuiciosmoralessedesarrollanatravs
de cuatro niveles. El primer nivel est centrado en sus propios deseos e intereses (4
aos),perolosotrostresincluyennocionesdeigualdad(apartirdelos6-7aos),m-
rito y reciprocidad (a partir de 10-11 aos) y benevolencia que implican ya tener en
cuentalosinteresesydeseosdelosdems.Algosimilarocurreconlaevolucindela
adquisicindelasnocionesrelacionadasconlaconductaprosocial.Losniosprogre-
sandesdejuiciosfundamentadosenunaorientacinhedonistabasadaensuspropios
intereseshacianocionesquerefejanunaorientacinquetieneencuentaalosdems.
Eisenbergetal.(1991)identifcancinconiveleseneldesarrollodelaconductaproso-
cial:orientacinhedonista;orientacinbasadaenlasrelacionesconlosdems(enlo
quesedeseaparalosdems);juiciosbasadosenlasnecesidadesdelosdems;orien-
tacinempticacaracterizadaporlosjuiciosautorrefexivos;y,fnalmente,internaliza-
cindelafectobasadoenelrespetomutuoyenlainternalizacindelasnormas,leyes,
obligacionesyresponsabilidadesascomoenformasderazonamientoabstractosobre
lasociedadylajusticia.Engeneral,seprogresadesdelosnivelesinferioresalossu-
periores, pero puede haber circunstancias en las que se producen regresiones en la
forma de razonar en las edades ms avanzadas en funcin de las circunstancias. Por
ejemplo,aunqueelrazonamientohedonistadisminuyehacialaadolescenciamedia,en
la adolescencia tarda junto con formas de razonamiento ms empticas, pueden co-
existirrazonamientoshedonistasensituacionesenlasqueloscostesdelaayudasean
muygrandes.
Esreseablequeenamboscasostantoeneldesarrollodelasnocionesdejusticia
distributivacomoenlasasociadasalcomportamientoprosociallaevolucinporlaque
pasanlosnios,nosonestadiosoetapasgeneralessinoqueestnligadosalaexperiencia
social(asituacionesparticularesyacircunstanciasdelavida),porloquepuedenobser-
varsediferenciasindividualesy,comohemosvisto,secuenciasnolineales.Portanto,los
juiciosmoralesdelosniossonelproductodelainteraccinentrelaformaderazonar
caractersticaydelasinfuenciascontextuales.Loquesesgeneralesquesudesarrollo
258 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
estasociado,comoyaproponaKohlberg,alacapacidadparacambiarlaperspectivay
pasardeestarcentradosenunomismoaadoptarlaperspectivadelosotros.Estecambio
de perspectiva que permite el desarrollo moral est ligado a los cambios que se estn
produciendoanivelcognitivoyquehemosanalizadoenlaprimerapartedeestecaptu-
lo,enespecial,alprocesogeneraldedescentracindelpensamiento.Sinembargo,enel
desarrollo moral no slo intervienen factores cognitivos, tambin est infuido por el
concepto del yo y la construccin de la identidad (Blasi, 1993) as como por factores
emocionales.
Enresumen,laadquisicindelasnocionesmoralesdelosniosimplicaunacombi-
nacin tanto de orientaciones cooperativas como de oposicin a las normas sociales.
Algunosestudiosencuentranyacomportamientosdenoaceptacinciegadelaautoridad
odelasnormassocialesenniospequeosquesemanifestanenlanoaceptacindelas
normas de la autoridad cuando son contrarias a sus propios juicios morales, o cuando
percibeninjusticiaodao.Estoimplicaquelosniosaedadesmstempranasdeloque
PiagetoKohlbergproponanpuedenhacerjuiciosmoralesbasndoseensupropiocon-
cepto de justicia y no slo en funcin de caractersticas externas como la obediencia o
lassanciones.
Lecturas complementarias
AlonsoTapia,J.yGutirrezMartnez,F.(1986).Comprensindelainclusinjerrquicadeclases:
Estudioevolutivo.InfanciayAprendizaje(35-36),pp.69-95.
Harris,P.(1989).Losniosylaemociones.Madrid:Alianza.
Goleman,D.(1996).Inteligenciaemocional.Barcelona:Kairs.
Piaget,J.eInhlder,B.(1963).Lasoperacionesintelectualesysudesarrollo.EnJ.Delval(1978).
Lecturasdepsicologadelnio.Madrid:AlianzaEditorial.
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 259
Actividades
Actividad 1
Complete el mapa conceptual correspondiente a este captulo. Las elipses representan
los conceptos, y las lneas las relaciones entre conceptos. Su tarea consiste en rellenar
los espacios en blanco del mapa conceptual que se le presenta eligiendo, en cada caso,
un concepto o una relacin de la lista que se ofrece a continuacin. Tenga en cuenta
que para la realizacin de esta actividad deber relacionar el desarrollo cognitivo duran-
te el perodo preoperatorio (Captulo 5) con los logros conseguidos a nivel cognitivo
durante el perodo de las operaciones concretas.
Conceptos Relaciones
reversibilidad
simblicoopreconceptual
leydeladescentracin
identidaddelosobjetos
egocentrismo
artifcialismo
lenguajeinterno
desfases
accinmentalinteriorizada
lgico-aritmticas
infralgicas
tiposdeoperaciones
laconstruccindelnmero
clases
animismo
conceptodeoperacin
operacionestemporales
identidad
opuestoa
organizadassegnlaspropiedadesdetransitividad
es
son
secaracterizapor
llevaal
semanifestaen
evolucionahacia
es
seproducen
evolucionahacia
graciasa
conducea
semanifesta
en
atribucin
decausalidad
realismo
secaracteriza
por
centracin
lenguaje
egocntrico
evoluciona
hacia
intuitivo
lenguaje
socializado
razonamiento
razonamiento
basadoen
transformaciones
conceptode
operacin
nula
asociatividad
permite
conservaciones
relaciones
permiten
operaciones
especiales
operaciones
concretas
invariante
cognitiva
es
es
son
es
perodo
preoperatorio
son
260 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Actividad 2
A continuacin se presentan las respuestas de algunas personas ante el dilema vida-ley
(tambin conocido como dilema de Heinz)
5
. Teniendo en cuenta lo que ha estudiado a
lo largo del captulo sobre el desarrollo del juicio moral y la informacin adicional que
presentamos en la Tabla 8.5:
1. Determine el estadio y nivel de juicio moral a partir de las respuestas que dan
al dilema y justique sus respuestas.
2. Decida cul o cules de las respuestas dadas es ms probable que se correspon-
dan con las que daran los nios de 7 a 11 aos.
Otra forma de hacer esta actividad es presentar el dilema a gente que conozca,
recoger sus respuestas y establecer el nivel de desarrollo moral en que se encuentran.
Dilema:
En Europa hay una mujer que padece un tipo especial de cncer y va a morir pronto.
Hay un medicamento que los mdicos piensan que la puede salvar. Es una forma de
radio que un farmacutico de la misma ciudad acaba de descubrir. La medicina es cara,
pero el farmacutico est cobrando diez veces lo que le ha costado a l hacerla. l pag
200 $ por el radio y est cobrando 2.000 $ por una pequea dosis del medicamento.
El esposo de la mujer enferma, Heinz, acude a todo el mundo que conoce para pedir
prestado el dinero, pero slo puede reunir unos 1.000 $ que es la mitad de lo que cues-
ta. Le dice al farmacutico que su esposa se est muriendo y le pide que le venda el
medicamento ms barato o le deje pagar ms tarde. El farmacutico dice: No; yo lo
descubr y voy a sacar dinero de l. Heinz est desesperado y piensa en atracar el es-
tablecimiento para robar la medicina para su mujer.
Debe Heinz robar la medicina? Por qu o por qu no?
Respuestas:
a) Heinz debe robar la medicina por su mujer o por cualquier otra persona, porque
el derecho de cualquier ser humano a la vida es superior que el derecho a la
propiedad. Y la ley as debera defenderlo. Sin embargo, en este caso la ley de-
ende al farmacutico. Por eso es injusta.
b) Heinz debe robar la medicina para salvar la vida de su mujer porque hay que
ayudar a los dems. Y por qu hay que ayudar a los dems? Porque si l estu-
viera en esa situacin tambin le gustara que lo hicieran por l. Por eso l tam-
bin debe hacerlo por ella. Se debe hacer por los dems lo que te gustara que
hicieran por ti.
c) Heinz no debe robar la medicina porque est prohibido. Por qu est prohibi-
do robar?, porque te pueden meter en la crcel. Y por algo ms? No.
d) Heinz debe robar la medicina porque su mujer le puede devolver el favor algn
da.
e) Heinz debe robar la medicina porque la vida es ms importante para la sociedad
que obedecer la ley. El farmacutico est aprovechndose de la situacin y de-
bera ser denunciado. No tiene derecho a subir tanto la medicina cuando est
en juego la vida humana.
5
RespuestastomadasdeDaz-Aguado(1997).
Captulo 8. El desarrollo cognitivo y socio-afectivo desde los 7 hasta los 11 aos 261
Tabla 8.5. Los seis estadios del juicio moral descritos por Kohlberg (tomado de Daz-
Aguado, 1997).
EL NIVEL
PRECONVENCIONAL
EL NIVEL
CONVENCIONAL
EL NIVEL DE LOS
PRINCIPIOS
I.
Elestadio
heternomo
II.
Elestadio
hedonista
instrumental
del
intercambio
III.
Elestadiode
conformidada
las
expectativasy
relaciones
interpersonales
IV.
Elestadiodel
sistemasocial
ylaconciencia
V.
Elestadiodel
contrato
social,la
utilidadylos
derechosdel
individuo
VI.
Elestadiode
losprincipios
ticos
universales
Elbiense
defnecomo
obediencia
ciegaalas
reglasyala
autoridad,la
evitacindel
castigo,yelno
hacerdao
fsicoalas
personas.
Elbiense
defnecomo
satisfaccinde
necesidadesy
el
mantenimiento
deunaestricta
igualdaden
intercambios
concretos.
Elbiense
defnecomo
unbuen
desempeodel
papelsocial
conformndose
alas
expectativasde
losdems.
Elbiense
defnecomoel
cumplimiento
deldeber
socialen
funcindel
ordeny
bienestardela
sociedad.
Elbiense
defneen
funcinde
derechos
bsicos,
valores,o
contratos
legalesdeuna
sociedad.
Elbiense
defneen
funcinde
principios
ticos
universalesque
todala
humanidad
debera
mantener.
Laperspectiva
sociales
egocntrica.Se
confundecon
ladela
autoridad.No
relaciona
puntosdevista
niconsiderala
intencionalidad
olosintereses
psicolgicos.
Juzgasegnlas
dimensiones
fsicasdelas
acciones.
Laperspectiva
sociales
individualista
yconcreta.
Separasus
propios
interesesde
todolodems.
Elbienes,por
tanto,relativo.
Losintereses
individualesse
tratancomo
intercambios
industrialesde
servicios,de
forma
estrictamente
igual.
Laperspectiva
socialeslade
unindividuo
entre
individuos.
Consideralas
expectativasy
sentimientos
delosdems.
Relaciona
puntosdevista
segnlaRegla
deOro
6

aplicadade
forma
concreta.Se
sitaen
relaciones
dialcticas
interpersonales.
Distingue
claramenteel
puntodevista
socialdel
acuerdo
interpersonal.
Adoptala
perspectivadel
sistemaque
defnepapeles
yreglas,
juzgandoa
travsdellas
relaciones
interpersonales.
Esla
perspectivade
unindividuo
racionalque
conocevalores
yderechos
previosala
sociedad.
Integra
perspectivasa
travsde
mecanismos
formalesy
legales.
Reconoceel
puntodevista
moralyel
puntodevista
legal,perolos
integracon
difcultad.
Esla
perspectivadel
puntodevista
moralenel
cualdeben
basarsetodos
losacuerdos
sociales.Esla
perspectivade
unindividuo
racionalque
reconocela
esenciadela
moralidad,el
respetoporla
personacomo
unfnens
mismoyno
comoun
medio.
6
Trataralosdemscomotegustaraqueellostetrataran.
262 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Soluciones a las actividades
Solucin a la actividad 1
egocentrismo
semanifesta
en
atribucin
decausalidad
animismo
realismo
secaracteriza
por
centracin
secaracteriza
por
lenguaje
egocntrico
artifcialismo
simblicoo
preconceptual
evoluciona
hacia
evoluciona
hacia
intuitivo
graciasa
leydela
descentracin
lenguaje
socializado
razonamiento
semanifesta
en
opuestoa
razonamiento
basadoen
transformaciones
conceptode
operacin
tiposde
operacin
lleva
al
es
accinmental
interiorizada
organizadas
segnlas
propiedades
de
identidad
nula transitividad
asociatividad
permite
reversibilidad
lgico-
aritmticas
infralgicas

conservaciones
relaciones clases
desfases
permiten
la
construccin
delnmero
operaciones
especiales
operaciones
especiales
operaciones
concretas
invariante
cognitiva
es es
es
son
son

es
seproducen

perodo
preoperatorio
son
lenguaje
interno
2. Conducta comunicativa
Solucin a la actividad 2
1. a) Estadio 5. Jerarqua de los derechos universales. Nivel postconvencional.
b) Estadio 3. Normas compartidas y regla de oro. Nivel convencional.
c) Estadio 1. Orientacin al castigo, realismo moral y absolutismo. Est de-
niendo el bien como obediencia a las reglas y a la autoridad y evitacin del
castigo. Nivel preconvencional.
d) Estadio 2. Perspectiva individualista, concreta e instrumental. Nivel precon-
vencional
e) Estadio 4. Perspectiva del sistema social.
2. La mayora de los nios de 7 a 11 aos se sitan en un nivel de desarrollo mo-
ral preconvencional, que se corresponde con las respuestas c y d. Los adoles-
centes muestran ya niveles de juicio moral convencionales (respuestas b y e). La
respuesta a se corresponde con respuestas ms propias de los adultos.
263 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
El desarrollo cognitivo
durante la adolescencia
y la primera juventud
263
9
MARTA GIMNEZ-DAS
Esquema-resumen
Objetivos
Introduccin
1. La llegada del pensamiento formal
2. Crticas a la visin de Piaget
3. Cambios cognitivos y sensaciones adolescentes
Lecturas complementarias
Actividades
Soluciones a las actividades
264 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Esquema-resumen
1. La llegada del pensamiento formal
Segn la formulacin de Piaget, el pensamiento formal aparece de forma incipiente
hacia los 11-12 aos y se consolida hacia los 14-15. Este tipo de pensamiento es uni-
versal, constituye la culminacin del desarrollo cognitivo y presenta una serie de impor-
tantes avances. Sus principales rasgos son:
Utiliza el pensamiento abstracto.
Formula hiptesis.
Emplea el razonamiento hipottico-deductivo.
Subordina lo real a lo posible.
Utiliza la combinatoria.
Utiliza la lgica de proposiciones.
Posee una estructura de conjunto.
2. Crticas a la visin de Piaget
Numerosos estudios encontraron resultados contradictorios con algunos aspectos de la
visin de Piaget. Se ha criticado, sobre todo, la universalidad del pensamiento formal,
la edad de adquisicin y la existencia de una estructura de conjunto. Piaget reformul
estos principios admitiendo que la edad de adquisicin es ms tarda, que la adquisicin
depende en parte de la educacin formal y que el contenido y la familiaridad de las
tareas afecta a su resolucin. Por ltimo, los estudios sobre desarrollo cerebral empiezan
a aportar algunos datos sobre cmo se transforma el cerebro durante la adolescencia.
El aumento de mielinizacin y la poda de conexiones neuronales en el cortex frontal
son los ms relevantes hasta el momento.
3. Cambios cognitivos y sensaciones adolescentes
Algunos rasgos del pensamiento adolescente pueden explicar ciertas conductas, tenden-
cias o sentimientos tpicos de este perodo. El egocentrismo, la fbula personal, la au-
diencia imaginaria y la fbula de la invencibilidad son constructos tiles para compren-
der cmo son, cmo actan y cmo se sienten los adolescentes.
Objetivos
Conocer las principales caractersticas del pensamiento formal segn la formula-
cin de Piaget.
Comprender las principales crticas que se realizaron a esta formulacin y sus re-
percusiones en cuestiones ms generales de la visin piagetiana.
Asimilar los conceptos de egocentrismo adolescente, fbula personal, audiencia
imaginaria y fbula de la invencibilidad.
Comparar los conceptos de egocentrismo infantil y adolescente estableciendo sus
semejanzas y diferencias.
Establecer los vnculos oportunos entre los rasgos del pensamiento y algunas de
las conductas o sensaciones ms caractersticas de la adolescencia.
Conocer los datos bsicos que proporcionan los estudios sobre desarrollo cerebral
en la adolescencia.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 265
Introduccin
Laadolescenciaeslapocadelavidaquetranscurreentrelainfanciaylaedadadulta.
Comienzaconlapubertad,cuandoseempiezanadarunaseriedecambiosfsicosque
modifcanelcuerpohumanoylopreparanparalareproduccin,ysuelefnalizarcuando
se asumen tareas y responsabilidades propias de la edad adulta o la juventud como el
trabajo,laindependenciadelospadres,etc.Setratadeunperodomarcadopormuchos
cambios que se refejan tanto en la apariencia fsica como en el pensamiento y la vida
social.
Respectodeloscambiosfsicos,lasvariacioneshormonalesprovocanunrpidocre-
cimientodelosrganossexualesquepermitenlareproduccincaractersticassexuales
primariasydeotrosrasgosasociadosaloshombresylasmujeresaunquenodirecta-
mente relacionados con la reproduccin caractersticas sexuales secundarias. Como
hemosmencionado,esteperodoenelquesealcanzalamadurezsexualylacapacidad
dereproducirsesedenominapubertadymarcaelcomienzodelaadolescencia.Noobs-
tante,laedaddecomienzodelapubertadvaramucho.Puededarseentrelosochoylos
catorceaosy,engeneral,apareceunoodosaosantesenlaschicas.Lanutricin,los
factoresgenticosyelmediosocialyfamiliarsonfactoresquepuedenretrasaroacelerar
laaparicindelapubertad.
Estos cambios fsicos junto con otros cognitivos y sociales marcan el inicio de una
etapacompleja,muydistintadelasanterioresyconunosrasgosespeciales.Lamadura-
cinsexual,laimportanciadelaimagencorporal,lasrelacionesconpadresyamigosy
la nueva forma de pensar son algunos de los elementos especfcos de la adolescencia.
Muchos factores infuyen en cmo los adolescentes afrontan tanta novedad: el tipo de
relacin establecido con los padres, la forma de interactuar con los iguales, la propia
aceptacindeesamaduracinylosvaloresculturalestienenmuchoqueverconlama-
nera de reaccionar.A lo largo de este captulo describiremos los cambios relacionados
conlaformadepensaryrazonardeladolescente.Comenzaremosexponiendolateora
dePiagetsobrelaadquisicindelpensamientoformal.Despusveremoslascrticasms
importantes que se formularon a la visin piagetiana. Por ltimo, repasaremos algunas
caractersticasdelpensamientoenlaadolescenciaeintentaremosligarlasaciertoscam-
bioscomportamentalestpicosdeestaetapadeldesarrollo.
1. La llegada del pensamiento formal
Paracomenzaraexplicareltipodepensamientoqueapareceenlaadolescenciayseex-
tiendedurantetodalavidaadultavamosaplantearunatarea.Latareaconsisteenesta-
blecer qu factores infuyen en la velocidad de un pndulo, es decir, qu hace que un
pndulooscilemsrpidaomslentamente.EnlaFigura9.1apareceunpnduloforma-
doporunacuerdayunpesoatadoalfnal.Enrealidad,haytrescuerdasconlongitudes
diferentes y cuatro pesos.Adems de estos dos elementos, vamos a introducir la altura
desdelaquelanzamoselpnduloylafuerzaconlaquelolanzamoscomovariablesque
podranestarimplicadasenlavelocidad.Sutareaconsisteenexplicarqutipodepruebas
tendraquerealizarparallegaradeterminarlosfactoresqueinfuyenenlavelocidaddel
pndulo.
266 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Fuerza
20 gr 50 gr 100 gr 200 gr
Figura 9.1. Elementos para resolver la tarea del pndulo.
Siharealizadolatarea,seguramentehabrpodidodeterminarculseraelmtodoque
habraqueseguirparasaberquvariablesinfuyenenlavelocidaddelpndulo.Enrealidad,
elmtodoconsisteeniraislandofactoreseirprobandoculestienenefecto.Porejemplo,
parasabersielpesovaralavelocidad,habraquemantenerconstantelalongituddelacuer-
da,lafuerzaylaalturadelanzamientoeirprobandolosdistintospesos.Siseprodujeraalgn
cambioenlavelocidad,podramosestarsegurosdequesedebealpeso.Elmismoprocedi-
mientohabraqueaplicaracadaunadelasvariables,deformaqueunasevamodifcando
mientraselrestopermanececonstante.Sirealmentellevaraacabolatarea,podracompro-
barqueslounadelasvariablespropuestaslalongituddelacuerdaafectaalavelo-
cidaddelpndulo.Pararesolverestatareasonnecesariasunaseriedehabilidadescogniti-
vas:esnecesarioformularhiptesis,comprobarlas,establecertodaslascombinacionesde
variables,probarlasdemanerasistemticaydisociarvariablesparairmodifcandocadauna
mientrassemantienenconstantestodaslasdems.Todasestashabilidadessonpropiasde
unanuevaformadepensarqueaparecehacialaadolescenciayconformanloquePiaget
denomin pensamiento formal. Si planteamos la misma tarea del pndulo a nios ms
pequeos,veremosatravsdesusrespuestasquenopuedenplantearhiptesis,nidisociar
factores,niestablecercombinacionesdevariablesdeformasistemtica.EnlaTabla9.1se
recogenalgunosejemplosdelmododeprocederylasrespuestasqueofrecensujetosdedos
edadesdiferentesantelatareadelpndulo.Estayotrastareas,querequierenunpensamien-
tosemejantealpensamientocientfco,fueronpresentadasaniosyadolescentesyatravs
desusrespuestas,InhelderyPiagetdescribieronlascaractersticasdelpensamientoformal.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 267
Tabla 9.1. Ejemplos de respuestas ante la tarea del pndulo (adaptado de Delval, 1994)
Sujeto 1: 6 aos Sujeto 2: 15 aos
Daimpulsosconfuerzasdiferentes:Estavezva
deprisaEstavezvaairmsdeprisa.Est
bien?Oh!S(nohaylecturaobjetivadelaex-
periencia). Coloca a continuacin un gran peso
conunacuerdacorta:Vamsdeprisa(daimpul-
so). Va todava ms deprisa. Y para que vaya
msdeprisa?Esnecesarioquitartodoslospesos
yhacerfuncionarlacuerdasola(lohaceperocon
impulso). Los vuelvo a colocar todos, va deprisa
estavez(nuevosimpulsos).Encuantoalaaltura:
Sisecolocamuyaltovadeprisa(daungranim-
pulso)Despusvuelvealpeso:Sisecolocaun
peso pequeo puede ir ms deprisa. Se le pide
como conclusin si cree verdaderamente haber
cambiadolasvelocidades:No,nosepuede,sse
puedecambiarlavelocidad.
Cree primero en la infuencia de cada uno de los
cuatro factores. Estudia diferentes pesos con la
misma longitud de cuerda (media) y no observa
ningn cambio apreciable: No cambia el ritmo.
Despushacevariarlalongituddelacuerdaconun
mismopesode200gryencuentraquecuandola
cuerda es pequea, el balanceo va ms deprisa.
Finalmente hace variar la altura de cada y el im-
pulso (sucesivamente) con una misma cuerda me-
dia y con un mismo peso de 200 gr concluyendo
para cada uno de estos factores: No cambia
nada.
Con la adolescencia temprana, hacia los 11-12 aos, se adquieren segn Piaget las
operacionesformales.Estetipodepensamientoutilizacomobaselasoperacionescon-
cretas,peroescualitativamentedistintodelexhibidoporlosniosqueseencuentranen
laetapaanteriorypermiteenfocarlosproblemasyrazonardeotramanera.Comovere-
mosmsadelante,algunasdelascaractersticasdelpensamientoformalpuedenayudar
aentenderciertoscomportamientosoactitudestpicasdelaadolescencia.
LasoperacionesformalesconstituyenparaPiagetelltimoperododeldesarrollo,es
decir,laformadepensamientomscomplejaquesepuedealcanzaralolargodelavida.
Msalldelasoperacionesformalesnoexistenoperacioneslgicasmssofsticadasy,
portanto,eldesarrollocognitivohallegadoasufn.Aspues,apartirdeaquydurante
todalaedadadultasepuedenacumularconocimientossobredistintasmaterias,perola
maneradepensaryanocambiar.LadescripcinquehizoPiagetdelpensamientoformal
dividasuadquisicinendosetapas:unaprimeraetapaemergentehacialos11-12aos
y otra de consolidacin hacia los 14-15 aos. La diferencia fundamental entre las dos
etapasesquedurantelaprimeralosadolescentesslomanejanciertasoperacionesfor-
malesylasempleanenalgunasocasiones,mientrasqueenlasegundaseadquierenms
operacionesysuutilizacinsegeneralizaamssituaciones.ParaPiagetesteperododel
desarrolloesuniversalyposeeunaestructuradeconjuntodeformaquelasoperaciones
seaplicanatodaslastareas.Peroculessonloscambiosqueseproducenconlallega-
dadelasoperacionesformales?Veamoslosmsimportantessiguiendoladescripcinde
InhelderyPiaget(1955).
Unodeloscambiosmsimportantesrespectodelpensamientoconcretosereferea
lacapacidaddepensarenabstracto.Apartirdeestemomento,lossujetosyanotienen
querazonaracercadeobjetososituacionesconcretassinoquepuedendespegarsedela
realidadypensardeformaabstracta.Estesuponeunodelosgrandeslogrosdelpensa-
miento humano porque posibilita toda una serie de cambios a la hora de plantearse y
resolverproblemas.Porejemplo,pararesolverunproblemanoseemitirnconductasal
268 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
azar,sinoqueseplantearnhiptesisqueirnguiandonuestraactuacin.As,elpensa-
mientoserconducidoporideasverdaderasofalsasquenosereducenalosdatos
concretos e inmediatos y que incorporan toda la informacin que se posee sobre un
tema.
Muyrelacionadoconestepensamientoabstractoest,comoacabamosdemencionar,
lacapacidadparaformularhiptesisquetambinapareceenesteperodo.Losniospe-
queos,duranteelperododelasoperacionesconcretas,slopuedenpensarsobrecosas
con las que tienen una experiencia directa (vase Captulo 8). Cuando deben razonar a
partir de hiptesis que contradicen su experiencia tienen muchas difcultades porque no
puedenponerapruebalaveracidadofalsedaddeproposicionesabstractas.Alcontrario,
apartirdelaadolescenciaseempiezanaconcebiralternativasposiblesquenosedande
formaconcretaenlarealidadysepuedenirponiendoapruebademaneraordenadapara
decidirsisonverdaderasofalsas.Estacapacidadparaplantearhiptesis,ponerlasaprue-
baeinterpretarresultadosconvierteelrazonamientodeladolescenteenunrazonamiento
hipottico-deductivo.Estetipodepensamientoessimilaralqueseempleaenlaciencia.
Todas estas nuevas habilidades del pensamiento formal encuentran su base en la
capacidadparaconcebirloposible.Eladolescenteempiezaaconcebirloquepodra
serademsdeloquees.Lorealsetransformaenunaopcinmsentrelasposibles,
esdecir,lorealsetratacomounsubconjuntodeloposible.Elpensamientoadolescen-
te ya no parte de lo real y lo concreto, sino de lo posible y hasta de lo ideal. Esta es,
quiz, la transformacin ms importante del pensamiento formal puesto que posibilita
el pensamiento abstracto, el planteamiento de hiptesis y el razonamiento hipottico-
deductivo.
Paramanejarmentalmenteloposibleesnecesarioutilizaruninstrumentolgicoque
permitacombinartodosloselementosyorganizarlos.Esteinstrumentoeslacombinato-
riaytienelagranventajadedisponerdeformasistemticatodaslasvariablesparaob-
tenertodosloscasosposibles.Aspues,enlasolucindeunproblemaesnecesarioes-
tablecertodaslasposiblessolucionesparadespusrefexionaracercadeculeslams
probableoponerlastodasapruebaparadeterminarculeslaverdadera.Lacapacidadde
generar todas las combinaciones posibles de elementos implica otra capacidad mental:
poder disociar factores. Es decir, el establecimiento de combinaciones requiere que se
aslen unos elementos de otros para determinar cul es su papel en el resultado fnal.
Retomemoslatareadelpnduloeimaginemos,porejemplo,queslotenemosdosposi-
blesvariablesqueafectanalavelocidaddelpndulo:lalongituddelacuerdaylafuerza
con que lo lanzamos. Si queremos saber cul de las dos variables est implicada en la
velocidaddelaoscilacin,tendremosqueestablecertodaslascombinacionesdelongi-
tudesyfuerzasposiblesyprobarlasunaaunaparadescubrircultieneefecto.Peroade-
ms,paraestableceradecuadamentelascombinacionesesnecesarioirmodifcandouna
delasvariablesydejarconstanteelresto.Tomandonuestroejemplo,tendremosquepro-
barlasdistintaslongitudeslanzandosiempreconlamismafuerzaparaversilalongitud
tieneefecto.Simodifcamosalavezlalongituddelacuerdaylafuerzadelanzamiento
serimposibledeterminarculdelasdosvariablesestrelacionadaconlavelocidady
nopodremosresolverelproblema.Mientrasquelosadolescentesyapuedenestablecer
todaslascombinacionesdevariablesaislandofactores,losniospequeosnosuelenser
sistemticosymezclanlasdiferentesvariablesencadaensayo.Losejemplosderespues-
tasdelaTabla9.1sonunabuenamuestradeestasdiferencias.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 269
Unltimorasgodelpensamientoformalesqueparaescaparalrazonamientosobrelo
concretoypoderpensarsobreloposible,esnecesarioutilizarunalgicaproposicional,
esdecir,verbalyenformadeproposicionesquetienenunvalordeverdaddeterminado
poreltipodecombinacin.Elrazonamientosobreloposibleimplicaquesea,principal-
mente,verbalporqueelvehculoqueutilizamosparareferirnosacosashipotticasesel
lenguaje.Enestesentido,pues,losadolescentesempiezanautilizarunalgicaproposi-
cional,esdecir,unalgicaverbalquepermiteafrmarlaverdadofalsedaddelosenun-
ciadossinpensarensucorrespondenciaconlarealidad.Elpensamientoformalpartede
enunciadosverbalesenlosqueseutilizanlasconectivaslgicascuyaverdadofalsedad
dependedesutabladeverdad.Porejemplo,sinosplanteanlaproposicinlafchaque
tengoenlamanoesverdeynoesverdepodemosafrmarqueesfalsasinnecesidadde
vermaterialmentelafcha.Alcontrario,siplanteamosestamismaproposicinaunnio
que se encuentre en el perodo de las operaciones concretas, para poder contestar dira
algocomoensamelafcha,avercmoes(OshersonyMarkman,1975).
Todasestaspropiedadesqueacabamosdesealarconstituyenlascaractersticasfun-
cionalesdelpensamientoformal.Peroexisteademsunaestructuradeconjuntosubya-
centequePiagetdescribientrminoslgico-matemticos.Estaestructuraestcompues-
ta por el denominado retculo de las 16 combinaciones de la lgica proposicional, el
grupoINRCyunaseriedeesquemasoperatoriosformales.Laformulacinlgico-mate-
mticadelaestructuradelasoperacionesformalesesexcesivamentecomplejaysobre-
pasanuestrosobjetivos.Porello,nonosdetendremosenunadescripcindetalladayslo
daremosunasimpledefnicinquepermitasobretodocomprenderelalcanceylasim-
plicaciones de la existencia de esta estructura de conjunto (el lector interesado puede
consultarlaobraoriginaldeInhelderyPiaget,Delalgicadelnioalalgicadelado-
lescente).
El retculo de las 16 combinaciones de la lgica proposicional se refere a las 16
combinaciones lgicas que se pueden establecer entre dos proposiciones cualesquiera.
Estascombinacionesimplicanelusodeconectivaslgicascomolaconjuncin,lanega-
cin,laexclusin,etc.Lautilizacindeestasoperacioneslgicasentredosproposiciones
dalugaraunatabladeverdadquepermiteestablecerlaverdadofalsedaddelenuncia-
dosinpensarensucorrespondenciaconlarealidadrecuerdeelejemplosobreelcolor
delasfchasqueveamosantes.Elconjuntodeestasposibles16combinacioneslgicas
conformanunaestructuramatemticadenominadaretculo.ElgrupoINRCesunaestruc-
tura de conjunto resultante de los dos grandes sistemas de reversibilidad que permiten,
entreotrascosas,solucionarlastareasdelaconservacin:lareversibilidadporinversin
ylareversibilidadporreciprocidad(vaseCaptulo8).ElgrupoINRC,tambinllamado
grupodeKlein,permitequeelsujetopuedarealizarcuatrooperacionessobrelas16com-
binacionesproposicionales.Estasoperacionesotransformacionessonlaidentidad(I),la
negacin(N),lareciprocidad(R)ylacorrelacin(C).Porltimo,losesquemasopera-
toriosformalessonherramientascognitivasqueseempleanenlaresolucindelospro-
blemasformalesyposibilitanlaorganizacindelainformacin,laprediccinderesul-
tados y la seleccin de la respuesta adecuada. Inhelder y Piaget describieron ocho
esquemasoperatoriosformalesyatravsdediferentestareasrelacionadasconlafsica
ylamatemtica,estudiaroncmoeranutilizadosporlosadolescentes.Estosochoesque-
masincluan,entreotros,lanocindeprobabilidad,lanocindecorrelacin,lanocin
deequilibriomecnico,lasproporcionesolacombinatoria(vaseTabla9.2).
270 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Tabla 9.2. Principales diferencias entre el pensamiento concreto y el pensamiento formal
Pensamiento concreto Pensamiento formal
Resuelveproblemasalazar Resuelveproblemasplanteandohiptesis
Apegadoalarealidadconcreta Razonasobreloposible
Utilizadatosinmediatos Incorporaconocimientoprevio
Actuacinsobrelosobjetos Razonamientoverbal
Combinaelementoscomparandocombinaciones
anteriores
Combinaelementosdeformasistemtica
Multiplicacindeensayos Aislamientodefactores
Lgicadeclases Lgicaproposicional
Razonamientoemprico-inductivo Razonamientohipottico-deductivo
2. Crticas a la visin de Piaget
La formulacin de Piaget sobre el perodo formal recibi en su da numerosas crticas.
Estascrticassedirigieronprincipalmenteacuatroaspectos.Enprimerlugar,secritic
la idea de que todos los sujetos alcanzaban este nivel de desarrollo cognitivo. Muchos
estudioshallaronquelamayorpartedelossujetosnoaplicabanpatronesdepensamien-
to formal ante tareas que deban incitar este tipo de operaciones. En segundo lugar, se
observ que la edad de adquisicin no era tan temprana como Piaget haba supuesto.
Adems, se encontr que muchos adolescentes y adultos slo resolvan ciertas tareas
formalesyqueelcontenidoylafamiliaridadafectabanasuresolucin.Estosdatospo-
nanendudalaexistenciadelaestructuradeconjuntopostuladaporInhelderyPiaget.
Por ltimo, otros autores dudaron de que el pensamiento formal constituyera el punto
fnaleneldesarrollocognitivoyplantearonlaexistenciadeotrasformasdepensamien-
tomscomplejasytardas.Veamosmsendetalleestascrticas.
Como ya mencionamos, Piaget plante que el pensamiento formal era universal.
Estosignifcaquetodoslossujetos,llegadalaedadaproximadadeadquisicin,lograrn
razonarutilizandolasoperacionesformales.Noobstante,algunosestudiosposteriores
mostraronque,enmuchoscasos,lautilizacindelpensamientoformalesmuyescasa.
Porejemplo,Dulit(1972)realizunestudioenelqueplantedosdelastareasdepen-
samiento formal utilizadas por Piaget a personas de 14, 16, 17, 20 y 25 aos y a un
subgrupodeadolescentesde16y17aosqueasistanauncolegiodemuybuenren-
dimiento.Losresultadosmostraronquemuypocosindividuosemplearonoperaciones
formalespararesolverlastareas.Alos14aos,nisiquierael20%lasresolvieronco-
rrectamente,mientrasquesloel33%delosadultoslograrondarrespuestasadecuadas.
Alcontrario,elgrupode16y17aosqueasistaauncolegiodealtorendimientoal-
canznivelesderesolucinmuchomayoresqueelrestodelamuestra.Estosresultados,
queconstituyenunejemploentremuchosotros,pusierondemanifestoquelasopera-
cionesformalesnosonuniversales,quelaedaddeadquisicinesmstardayquela
educacinformalesunelementodecisivoensuadquisicin.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 271
Aspues,eldesarrolloplenodelpensamientoformaldepende,engranmedida,dela
educacinformal.Noesqueatravsdelaeducacinseenseedirectamenteapensar
de manera formal, sino que el tipo de actividades que se suelen realizar en los ltimos
aosdelaescolarizacinrequierenelusodehabilidadesformales.Enmuchoscasosel
pensamientoformalnosurgedeformaespontneaporquenecesitaciertoentrenamiento
(vaseCaptulo11).Adems,demanerasistemticasehaencontradoquelaspersonas
de niveles sociales ms elevados resuelven mejor las tareas de pensamiento formal. En
defnitiva,parecequelaculturayelnivelsocioeconmicoinfuyendeformarelevanteen
lautilizacindelasoperacionesformales.DouglasyWong(1977)presentarontareasque
requeran pensamiento formal a adolescentes de 13 y 15 aos de dos nacionalidades
chinosyestadounidenses.Losresultadosmostraronqueelgrupodeadolescenteses-
tadounidensesde15aosobtuvoelmejorrendimiento,mientrasqueelgrupodeadoles-
centeschinosde13aosfueelquepeorresolvilastareas.Adems,entreelgrupode
adolescenteschinos,laschicasalcanzaronpeoresresultadosyestadiferenciaentresexos
noseencontrenelgrupodelosestadounidenses.Esposiblequeestasdiferenciastengan
queverconlaculturayquelasociedadchinadehace30aosrestringieralasposibili-
dadesdelasmujeresparaexperimentarycriticar,limitandoassucapacidadparaalcan-
zarymanejarlasoperacionesformales.Entodocaso,yseacualsealaexplicacincon-
creta para estos resultados, este trabajo viene a sealar la infuencia de la cultura y la
educacinenlaadquisicindelpensamientoformal.Enotrocontextodiferente,Lauren-
deau-Bendavid(1977)comparlaactuacindesujetoscanadiensesyruandeses,conclu-
yendoquelautilizacindelpensamientoformalenculturasdiferentesalaoccidentales
escasaonula.Apesardequeestetipoderesultadossehanencontradodeformarepeti-
da,otrosautores,estudiandolossistemaslegislativosdeculturasnooccidentales,llegaron
alaconclusindequeexistensociedadesqueserigenmediantesistemasmuycomplejos
cuyodominiocotidianoexigelautilizacindelpensamientoformal(Gluckman,1967).
Esteaspectonosllevadeformadirectaaplantearsielcontenidodelatareaylafamilia-
ridadcondichocontenidopuedenservariablesrelevantesquedeterminenlautilizacin
delpensamientoformal.
Enefecto,comohanencontradonumerosasinvestigaciones,elcontenidodelatarea
quesepresentaylafamiliaridaddelossujetoscondichocontenidosonelementosque
determinan claramente cmo se resuelven los problemas. Veamos a continuacin un
ejemplodecmoinfuyeestavariable(vaseelcuadroConlospiesenlatierradela
pginasiguienteeintenteresolverlatareaqueseplantea).
Si ha realizado la tarea que se indica en el cuadro, habr comprobado que hay dos
elementosqueaparecendeformaindisociableenlasplantassanasyque,portanto,no
podemossaberculdeellosdeterminasuestadodesalud.Lasdosplantassanascoinci-
denentenerabonoclaroyvitaminas,peroningunadelasenfermasrecibeestetratamien-
to.Considerandoestasvariables,podemospredecirconseguridadquelaplanta5estar
sana, puesto que tiene abono claro y vitaminas, pero no podemos saber cmo estar la
planta 6. De forma general, se puede concluir que hay dos variables que no afectan al
estadodelasplantas:eltamaodelvasodeaguayelaceiteparalashojas.Cadaunade
lasplantassanashasidoregadaconuntamaodevasoysloaunadeellasseleaplic
aceite en las hojas, pero ambas estn sanas.Al contrario, el abono oscuro tendra algo
queverconlaenfermedaddelasplantaspuestoqueslolasdosenfermasrecibieronese
tipodeabono.
272 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Cuandosecomparalaactuacindelossujetosenunatareaconcontenidofamiliary
otraconuncontenidodesconocidoonofamiliar,seencuentranclarosdesfases
1
.Porejem-
plo, si planteamos la tarea de las plantas y la tarea del pndulo a un grupo de sujetos,
podremosconstatarlasdiferenciasenlaactuacin.Elprocesoderazonamientoquehay
querealizarenambastareasessimilarinferenciacausal,sinembargo,muchasms
personasresolvernlatareadelasplantasquelatareadelpndulo.Estainfuenciadela
familiaridadodelcontenidoponedemanifestounaspectomsrelevantesobreelpensa-
mientoformal:queenrealidadnoexisteunaestructuradeconjuntoqueactadeforma
global.Esdecir,quenoesuntipodepensamientoqueseaplicadeformageneralycon-
sistenteantecualquiertareaquelorequiera,sinoqueexistenciertasvariablescomo,por
ejemplo, el contenido y la familiaridad con la tarea, o el nivel educativo y cultural que
condicionansuaparicin.
Porltimo,algunosautoreshanllegadoalaconclusindequeexisteunpensamien-
topostformal.Esdecir,quehayformasdepensamientomssofsticadasquelasopera-
cionesformalesdescritasporPiagetyque,portanto,elpensamientoformalnoconstitu-
1
Recordemos que, tambin en otras etapas, se ha demostrado la infuencia crtica del contenido y las
instruccionesdelatarea(vanseCaptulos5y8).
Intente resolver el siguiente problema planteado por Kuhn, Pennington y Leadbeater
(1995). A continuacin presentamos las caractersticas y los cuidados que han recibido
cuatro plantas. Con los datos que se proporcionan, hay que predecir si otras dos plantas
estarn sanas o enfermas.
PLANTA 1: SANA
Vaso pequeo de agua
Abono claro
Vitaminas
PLANTA 2: ENFERMA
Vaso pequeo de agua
Abono oscuro
Aceite para las hojas
PLANTA 3: SANA
Vaso grande de agua
Abono claro
Vitaminas
Aceite para las hojas
PLANTA 4: ENFERMA
Vaso grande de agua
Abono oscuro
Cmo estarn las plantas 5 y 6 si les proporcionamos estos cuidados?:
PLANTA 5: ?
Vaso grande de agua
Abono claro
Vitaminas
PLANTA 6: ?
Vaso grande de agua
Abono claro
Comente, de forma general, cules son las variables que inuyen en el estado de las
plantas.
CON LOS PIES
EN LA TIERRA
La inuencia del contenido
en el razonamiento: la tarea de las plantas
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 273
yeelltimoestadioeneldesarrollocognitivo.Porejemplo,elpensamientorelativistay
elpensamientodialcticoimplicanotrasoperacionesmentalesquenosedanenlasope-
racionesformalesyqueresultanmscomplejas(vaseCaptulo11).
Todas estas crticas sobre el pensamiento formal y la evidencia que muchos tra-
bajos encontraron, forzaron a Piaget a modifcar algunos aspectos de su teora que
reformul en 1970. Sobre la edad de adquisicin, afrm que todos los sujetos nor-
malesalcanzanlasoperacionesformales,sinoenlasedadesquehabapropuesto,s
entodosloscasosentrelos15ylos20aos.Sobrelauniversalidaddelpensamiento
formal,admitiqueestetipodepensamientoseadquieresiemprequeelmediosocial
y la experiencia proporcionen las herramientas cognitivas y la incitacin intelectual
necesaria.Porltimo,sobrelainfuenciadelafamiliaridadyelcontenidoreconoci
quelasoperacionesformalessepuedenalcanzarenterrenosdiferentesenfuncinde
Los estudios sobre funcionamiento y cambio cerebral en la adolescencia son muy esca-
sos y recientes. La utilizacin de tcnicas modernas, gracias a las cuales se pueden ob-
tener imgenes del cerebro en funcionamiento, han permitido estudiar los cambios
estructurales que se producen durante la adolescencia. A continuacin resumimos los
resultados ms importantes que se han hallado en las ltimas dcadas siguiendo a
Blakemore y Frith (2005). Una de las principales diferencias que se observan, en com-
paracin con el cerebro infantil, es un aumento de mielina en el crtex frontal. Esto
signica que la velocidad de transmisin de las neuronas en esta parte del cerebro es
mayor despus de la pubertad. Por otra parte, la observacin tambin ha revelado una
importante disminucin de la densidad de las sinapsis en el lbulo frontal. Parece que
durante la adolescencia se realiza una poda, eliminndose todas aquellas conexiones
neuronales que se han ido acumulando pero que no se utilizan. Estas podas se rea-
lizan mucho antes en otras reas cerebrales, pero en el lbulo frontal no tienen lugar
hasta la adolescencia. En realidad los dos fenmenos se dan de forma complementaria:
entre los 7 y los 12 aos se produce una importante proliferacin de conexiones neu-
ronales en el lbulo frontal y despus comienza a disminuir la densidad neuronal. A la
vez que disminuye la densidad empieza a aumentar la mielinizacin. Dado que el crtex
frontal se relaciona con el control ejecutivo es decir, la atencin, la toma de decisiones,
la solucin de problemas, etc., se podra esperar que los cambios que se observan en
el cerebro se reejaran en una mejora en la actuacin de los adolescentes en este tipo
de tareas. Aunque algunos estudios han hallado evidencias a favor de esta relacin, no
todos los resultados son unnimes y se necesita ms investigacin para aclarar esta
cuestin.
Independientemente de esta relacin, los estudios s muestran que durante la ado-
lescencia e incluso despus se producen reorganizaciones masivas en ciertas reas
cerebrales. Estas reorganizaciones repercuten en un mayor control y una planicacin
ms ecaz de las tareas complejas. Este dato pone de maniesto que durante este pe-
rodo y probablemente durante todo el ciclo vital, el cerebro sigue siendo adapta-
ble, moldeable y, por tanto, educable. As pues, las antiguas teoras que defendan la
inecacia de la educacin despus de la infancia, parecen perder vigencia ante los datos
ms recientes sobre desarrollo cerebral.
CON LOS PIES
EN LA TIERRA Qu sabemos sobre el cerebro adolescente?
274 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
las aptitudes y la especializacin profesional, de forma que su utilizacin no ser
siemprelamisma.Esteltimopunto,quereconocelaexistenciadedesfases,entraen
especial contradiccin con la visin piagetiana de los estadios del desarrollo conce-
bidoscomoentidadesglobalesdepensamientoqueseaplicanatodoslosproblemas
porigual.
3. Cambios cognitivos y sensaciones adolescentes
Enesteapartadovamosadescribirciertoscambiosqueaparecenenlaformadepensar
deladolescente,peroquetienenunarelacindirectaopuedenexplicaralgunassensa-
ciones y emociones que tambin surgen en este perodo del desarrollo. Como hemos
mencionado,durantelaadolescenciaseproducennumerososcambiosqueafectanato-
daslasfacetasdelavida.Porunaparte,sedesencadenanunaseriedecambiosfsicos
quecondicionanymodifcanlasrelacionesconlosiguales,alavezquerepercutenen
laimagenqueconstruyendesmismos.Porotra,aparecennuevasoperacioneslgicas
yformasdepensamientoqueincidenenlaconcepcindelmundo,delosotrosydeuno
mismo.Deestasnuevasformasdepensar,quizunadelasquemsrepercusionesprc-
ticastienesealacapacidaddepensamientoabstracto.Graciasaestanuevahabilidad,
eladolescenteyapuededespegarsedelarealidadypensarenloposible,enloquepodra
seroencmopodranserlascosas.Estacapacidadparatomarlorealcomounaposi-
bilidad ms entre las concebibles constituye la base intelectual de un rasgo tpico del
adolescente:elidealismo.As,eladolescentesevuelveidealistaporqueyapuedecon-
cebircmopodranserlascosasocmolegustaraquefuesenypuede,adems,com-
pararsuvisinidealconlareal.Porejemplo,losconfictospropiosdeestaetapaquese
danentrelosadolescentesysuspadres,tienenmuchoqueverconlacapacidaddelado-
lescenteparaimaginarcmolegustaraquefuesensuspadres,surelacinconellos,etc.
Delmismomodo,enestapocacomienzanaadoptarseposicionespolticasosociales
quemuchasvecessonprecisamentecalifcadasdeidealistasporlosadultos.Labase
paraadquirirestasposicionespolticasosocialesseencuentratambinenesacapacidad
paraconcebirotromundoposible.Lacomparacinentrelarealidadylaposibilidadde
unarealidaddiferentehacequeeladolescenteidealiceeinclusoserebelecontraloes-
tablecido.
Porotraparte,eladolescenteexperimentaduranteunosaosunossentimientosex-
traos:sesuelesentirincomprendidoporlosadultos,soloperoconlasensacindeque
podracomerseelmundoymuyobservadoyjuzgadoporlosdems.Muchasdeestas
sensacionestienenqueverconunrasgopropiodelpensamientoadolescentedenominado
egocentrismo. Como ya hemos visto, el nio pequeo tambin fue descrito por Piaget
comoegocntrico(vaseCaptulo5),peroestanuevaformadeegocentrismoqueapare-
ceenlaadolescencianodebeconfundirseconladelniopreescolar.Sirecordamos,el
nio pequeo es egocntrico porque se centra en su propio punto de vista y no puede
despegarsedelparaadoptarotravisin.Eladolescenteesegocntricoporqueseconsi-
deramuchomsesencialycentralenlavidasocialdeloquerealmentees(Elkind,1967).
Al contrario que el nio pequeo, el adolescente es capaz de entender y adoptar otros
puntosdevistadistintosalsuyo,peronoconsigue:
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 275
[...] diferenciar entre lo nico y lo universal. Una joven que se enamore por
primeravezquedaprendadadelaexperiencia,queestotalmentenuevayestre-
mecedora.Peronologradiferenciarentreloqueesnuevoyestremecedorpara
ellayloqueesnuevoyestremecedorparalahumanidad.Asquenodebesor-
prendernosqueestajovenledigaasumadre:Pero,mam,tnosabesloquesesienteal
enamorarse.(Elkind,1978,p.164.)
Este egocentrismo, defnido como la falta de diferenciacin entre lo universal y lo
nicoylaconsideracindeunomismocomocentralenlavidapblica,tienevariascon-
secuencias. En primer lugar, el adolescente tiene la sensacin de ser permanentemente
observadoyjuzgadoporlosdems.Ensegundolugar,seconsideraunserexcepcional,
nico, irrepetible y con un destino especial. Por ltimo, se siente incomprendido, tal y
comorefejalacitaanterior.
El adolescente siente que es el centro de atencin y cree que existe una audiencia
imaginariaantelacualhayqueactuar(Elkind,1967,1978).Muchospasangranparte
desutiempoanticipandolasreaccionesrealesoimaginadasdeesaaudiencia.As,
porunaparte,losadolescentesestnmuypreocupadosporloquelosdemspiensany,
porotra,sesientencontinuamenteobservadoscreyendoquesuaparienciaesloquems
interesaalosdems.Elintersporlosjuiciosdelosotrosmuestraquesoncapacesde
separarsupensamientodelajeno,perocreerquesonelcentrodeatencinsuponeatribuir
alosdemsunapreocupacinqueesenrealidadslopropia.
Elegocentrismoadolescentetambinsemanifestaatravsdelallamadafbulaper-
sonal(Elkind,1967,1978).Esteconstructosereferealaideaolasensacindequeson
seresnicos,excepcionaleseirrepetibles.Comoyahemosmencionado,paraalgunosau-
toresestoocurreporquenodiferencianentreloqueesnuevoparaellosyloqueesnuevo
paralahumanidad.Lasensacindesernicoprovocatambinqueeladolescentesecon-
sideresocialmentemuchomsimportanteycentraldeloquerealmentees.As,unadoles-
centequevivaunaexperiencianuevalatomarcomoalgoexcepcionalynicoquenadie
mshavividoyquenadiemspuedecomprenderalgoseguramentefalso.Esesentimien-
to lo pueden extrapolar a todos los mbitos y llegar a considerarse ellos mismos nicos.
Elegocentrismoadolescenteysusdiferentesderivacionesexplican,pues,algunasde
lassensacionesqueantesmencionbamos.Porejemplo,lasensacindesernicoyde
vivirexperienciasquenadiemsconoceexplicaesasensacindesoledadeincompren-
sinpropiadelaadolescencia.Unosaosmstarde,lamayorpartedelosadultossedan
cuentadequelasexperienciasvitalessuelenserparecidasysepuedencompartir.Ade-
ms,estasensacindesentirsenicoeirrepetibletambinexplica,enparte,queelado-
lescentesepercibacomomuchomsrelevantedeloqueesy,deah,quesesientaper-
manentemente observado y juzgado por los dems. Esta supuesta relevancia social da
cuentaasimismodelacentuadosentidodelridculoquesesufreduranteesosaos.Aun-
que los juicios de los dems siguen siendo importantes para el ajuste social durante la
vidaadulta,sinembargo,pierdeneseprotagonismotanfundamentalqueadquierendu-
rante la adolescencia. El adulto ya no suele considerarse tan relevante socialmente y
pierdelapresindesentirsetanobservado.Adems,elautoconceptoestyamsasen-
tadoylavaloracindelosotrospierdepeso.
276 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Otroelementocaractersticodelaadolescencia,muyrelacionadoconelegocentris-
moylafbulapersonalyquepreocupamuchoalospadres,tienequeverconelriesgo
quecorrenalrealizardeterminadasconductas.Muchosadolescentesnotomanlaspre-
cauciones necesarias en situaciones potencialmente peligrosas. Por ejemplo, pueden
mantenerrelacionessexualessinemplearmtodosanticonceptivosopuedenconsumir
drogassinpensarenelpeligroqueelloentraa.Enrealidad,noesquelosadolescen-
tesdesconozcanlosriesgosdeestasconductas,sinoqueestnconvencidosdequeellos
nopuedenservctimas.Porejemplo,unrazonamientotpicodeladolescenteserahay
chicasquesequedanembarazadaspornoutilizaranticonceptivosperoamesonome
puedepasar.Estasensacindeestarprotegidodetodopeligro,quesehadenominado
fbula de la invencibilidad, hace que los adolescentes asuman riesgos que pueden
tenerconsecuenciasdesastrosasparasusvidas.Estaformadepensartienemuchoque
verconelegocentrismoylafbulapersonal,puestoquesedesprendedeesaconcep-
cin de s mismos como seres nicos, excepcionales e irrepetibles.A alguien tan ex-
cepcionalnopuedenafectarleniocurrirlelasmismascosasquealosdems,demodo
que la proteccin no es necesaria. Muchos padres perciben esta forma de pensar del
adolescente y pueden advertrselo, pero las frases propias de los adultos como por
ejemplotcreesqueatinotepuedepasarnada,nosuelenserefcacesparapre-
venir la drogadiccin, el alcoholismo, los accidentes o los embarazos. Por otra parte,
esciertoquemuchosadultosmantienenestospatronesderazonamientoyasumenries-
goscomo,porejemplo,noponerseelcinturndeseguridadenelcoche.Comovemos,
elegocentrismocognitivoesunrasgopropiodelpensamientohumanoynonosaban-
donaenningunadelasetapasdelciclovital.Anas,laprevencindediversosriesgos
puedeserefcazcuandoincorporaelementosqueenganchanconeladolescente.Vea-
mos,paraconcluir,enquejespuedehacerhincapiunprogramaefcazparaprevenir
ladrogodependencia.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 277
Lecturas complementarias
Carretero, M. y Len, J. A. (1995). Desarrollo cognitivo y aprendizaje en la adolescencia. En
Garca-Madruga,J.yCarreteroM.(eds.),LecturasdePsicologadelpensamiento.Madrid:
Alianza.
Delval,J.(1994).Loscomienzosdelpensamientocientfco.EnJ.Delval,Eldesarrollohumano.
Madrid:SigloXXI.
Como hemos visto, los adolescentes pueden asumir riesgos importantes basndose en
la creencia de que estn protegidos de todo mal. Los padres y educadores se han roto
la cabeza para hacer ver a sus hijos o alumnos lo equivocado de esa creencia, pero sue-
len encontrar que ni las charlas ni las regainas ni la prohibicin resultan ecaces. Y es
que esta asuncin de riesgos est relacionada con una cuestin cognitiva profunda que
es difcil de modicar. No obstante, algunos programas de prevencin de riesgos para
adolescentes pueden obtener buenos resultados. Parece que la clave est en dar infor-
macin realista, aunque sin asustar, y desarrollar en el adolescente una serie de factores
de proteccin. Entre los principales objetivos que se plantea el plan Prevenir en Ma-
drid estn:
Mejorar el vnculo del adolescente con el centro educativo.
Desarrollar una actitud crtica frente a valores sociales que pueden resultar nega-
tivos o perjudiciales.
Proporcionar informacin realista y veraz acerca de los riesgos que conlleva el
consumo de drogas.
Aumentar la capacidad para solucionar conictos en situaciones de riesgo y para
resistir a las presiones del grupo de iguales.
Incrementar habilidades para el dilogo y la comunicacin favoreciendo la solici-
tud de ayuda a los adultos.
Fomentar un ocio distinto al margen del consumo.
A travs de estos objetivos, los programas consiguen que los adolescentes tomen
verdadera conciencia del riesgo que corren asumiendo que ellos tambin pueden ser
vctimas. Adems, fomentan una serie de recursos que reducen el riesgo de inicio en
el consumo y les preparan para afrontar las posibles situaciones de riesgo. Al igual que
en otros mbitos, proporcionar informacin y recursos personales parece ser la combi-
nacin ms ecaz para lograr la prevencin de riesgos.
CON LOS PIES
EN LA TIERRA
Un ejemplo sobre drogodependencias:
Plan Prevenir en Madrid
278 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Actividades
1. Preguntas
1.1. Los estudios realizados sobre el desarrollo del cerebro adolescente ponen de
maniesto que:
a) Se produce un aumento masivo de las conexiones sinpticas en el
lbulo frontal.
b) Se dan reorganizaciones masivas similares a las que aparecen a edades
ms tempranas.
c) La mielinizacin del lbulo frontal repercute en la mejora de las tareas
que requieren control ejecutivo.
1.2. Uno de los aspectos que pone de maniesto la ausencia de una estructura
lgica de conjunto en el pensamiento formal es:
a) La inuencia de la familiaridad y el contenido de la tarea.
b) El retraso en la edad de su adquisicin respecto de la primera formula-
cin de Piaget.
c) La adquisicin de estas operaciones en sujetos de todos los niveles
sociales y culturales.
2. Una pequea investigacin
Como se ha explicado en el texto, el contenido y la familiaridad de los sujetos con las
tareas formales tienen una importante incidencia en su resolucin. La comparacin entre
la tarea de las plantas y la del pndulo constituyen buenos ejemplos de la inuencia de
estas variables. Para que lo compruebe por s mismo, le proponemos que presente la
tarea de las plantas y la del pndulo y compare la actuacin para cada caso. Puede plan-
tear su investigacin de dos formas: bien escoger dos grupos de sujetos diferentes y
proponer una sola tarea a cada uno un grupo soluciona slo la tarea del pndulo y
otro slo la tarea de las plantas, o bien escoger un nico grupo de sujetos y propo-
nerles las dos tareas los mismos sujetos solucionan ambas tareas. Anote las diferencias
que encuentra entre las dos tareas e intente explicarlas.
Captulo 9. El desarrollo cognitivo durante la adolescencia y la primera juventud 279
Soluciones a las actividades
1. Preguntas
1.1. La respuesta correcta es b. Como hemos visto en el texto, en la adolescencia
hay reorganizaciones masivas que producen cambios a la hora de afrontar
deferentes tareas. Estas reorganizaciones ponen de maniesto que el cerebro
sigue siendo tan moldeable y plstico como en etapas anteriores. La alterna-
tiva a es falsa porque se produce un aumento y una poda de las conexio-
nes. Por ltimo, la alternativa c es falsa porque, dado que hay estudios que
encuentran datos a favor y otros en contra, no se sabe cul es la relacin
exacta entre estos dos fenmenos.
1.2. La respuesta correcta es a. Es precisamente el que los sujetos acten mejor
en unas tareas que en otras en funcin del contenido lo que hace dudar de
la estructura de conjunto. Si dicha estructura funcionara, se activara siempre
que se planteara un problema formal, independientemente de su contenido.
Las alternativas b y c son falsas porque ni la edad de adquisicin ni la cultura
prueban o falsan la existencia de la estructura de pensamiento.
2. Una pequea investigacin
Seguramente habr podido comprobar cmo hay ms personas que resuelven la tarea
de las plantas que la del pndulo o, en todo caso, que la primera entraa menor di-
cultad para la mayor parte de los sujetos. Si han participado los mismos sujetos en las
dos tareas, los resultados sern ms seguros; si ha pasado las pruebas a personas dife-
rentes necesitara establecer algn control para asegurar que el nivel cognitivo y de
familiaridad con el contenido es equivalente para todos los sujetos. Si, por casualidad,
planteara la tarea del pndulo slo a personas que conocen muy bien esos problemas,
los resultados no apoyaran la hiptesis de partida. Si, por ejemplo, uno de los grupos
pertenece a un nivel social muy diferente del otro o incluso a otra cultura, es posible
que esas diferencias provoquen la variabilidad entre los dos grupos. En todo caso, no
podra estar seguro de cul de las variables el contenido de la tarea o el nivel social
o cultural explica las diferencias.
281 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
El desarrollo
socio-emocional
del adolescente
281
10
INMACULADA SNCHEZ QUEIJA
Esquema-resumen
Objetivos
Introduccin
1. Modelo del cambio individual: la teora de Erikson
1.1. Los estatus de identidad: J. Marcia
2. Autoconcepto y autoestima
2.1. Autoconcepto
2.2. La autoestima
3. Relaciones familiares
3.1. El mito de los continuos conictos familiares
3.2. Continuidad entre las relaciones familiares en la infancia
y en la adolescencia
4. Relaciones con los iguales
4.1. La amistad ntima en la adolescencia
4.1.1. La amistad y otras relaciones cercanas
4.2. La inuencia de los amigos
4.3. Relaciones de pareja y sexuales
4.3.1. Las relaciones de pareja
4.3.2. Las relaciones sexuales
Lecturas complementarias
Actividades
Soluciones a las actividades
282 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Esquema-resumen
1. Modelo del cambio individual: la teora de Erikson
Entre los primeros trabajos que analizaron la adolescencia destaca la teora de Erikson,
quien propuso que el principal objetivo del adolescente es encontrar su propia identidad
tras los vertiginosos cambios que ocurren en su aspecto fsico, y los consiguientes cam-
bios en las demandas sociales, aspectos ambos que desafan el sentido de la identidad
del individuo. El peligro que corre el adolescente es adquirir compromisos precipitada-
mente o no comprometerse en absoluto, cayendo en la confusin de roles ante las di-
ferentes posibilidades que se le presentan. El trabajo de Erikson lo desarrolla Marcia
estableciendo 4 etapas en el logro de la identidad: la difusin o etapa previa a la bs-
queda de identidad; la moratoria o etapa adolescente por excelencia; la identidad hipo-
tecada o el asumir una identidad que es de otros y el logro de la identidad.
2. Autoconcepto y autoestima
Los cambios fsicos, cognitivos y sociales que suponen la transicin a la adolescencia
derivan, necesariamente, en cambios tanto en el autoconcepto como en la autoestima
de los chicos y chicas que transitan por esta etapa evolutiva. As, el desarrollo cognitivo
acaecido durante la adolescencia permitir una mayor diversicacin de la idea de uno
mismo, que derivar al nal de la adolescencia en un autoconcepto que integre a los
diferentes yoes que han ido surgiendo a lo largo de nuestra vida en un todo cohesio-
nado y jerarquizado que admite la ambivalencia. Respecto a la autoestima, aunque al
inicio de la adolescencia suele decrecer, ir aumentando a lo largo de este perodo evo-
lutivo hasta alcanzar niveles previos. Las diferencias individuales se explican, en parte,
por la inuencia del contexto familiar y de los iguales durante la adolescencia.
3. Relaciones familiares
La familia contina siendo un entorno fundamental en el desarrollo del adolescente,
que ser bsico para el desarrollo de la identidad, la bsqueda de autonoma o el ajus-
te adolescente. A pesar de ello, los rpidos cambios del adolescente supondrn algunos
reajustes en el sistema familiar. A pesar del mito de los continuos conictos familiares,
las discusiones en las familias con adolescentes suelen estar relacionados con aspectos
de la vida cotidiana del adolescente, suceden ms en la adolescencia inicial y no implican
la disminucin de afecto de los hijos hacia los padres, ni viceversa. Los datos muestran
que con la llegada a la adolescencia prevalece la continuidad sobre el cambio y sern
aquellos adolescentes que de nios tenan malas relaciones con sus familias quienes
mantengan estas relaciones dicultosas con los padres.
4. Relaciones con los iguales
El contexto de los iguales cobra una fuerza especial durante la adolescencia, las relacio-
nes con los amigos adoptarn nuevas caractersticas (compromiso, lealtad, autorrevela-
cin, resolucin de problemas, etc.) y se convertirn en centrales durante esta etapa
evolutiva. Chicos y chicas pasan mucho tiempo con sus amigos y amigas con los que
comparten pensamientos y actividades (homolia conductual). Este hecho no implica
que los adolescentes sean presionados por el grupo para ser todos similares, sino que
a la hora de escoger amigos seleccionan a aquellos que ms se les parecen, y si los pa-
recidos disminuyen se separan de ese grupo. Curiosamente, los adolescentes sobreesti-
man los parecidos con sus amigos y consideran que se asemejan ms a sus amigos de
lo que realmente lo hacen.
Captulo 10. El desarrollo socio-emocional del adolescente 283
Introduccin
Laadolescenciaesunaetapaquepreocupaapadres,profesores,trabajadoresyeduca-
doressocialesy,engeneral,atodosaquellosadultosquepersonaloprofesionalmente
serelacionanconpersonasquetransitanporestaetapaevolutiva.Encualquierlibrera
podremos encontrar multitud de ttulos referidos a este perodo y que pretenden, con
mayoromenorxito,ayudaralosadultosaenfrentarseconlosadolescentes.Aparecen,
incluso, programas televisivos que nos alertan sobre la difcultad del trato con adoles-
centesycmoafrontarlos.Yesque,sihayunaetapaevolutivaconmalaprensa,esaes
laadolescente(CascoyOliva,2005a).Sinembargo,nodebemosolvidarqueeladoles-
centenoesunsermuydiferentealnioquefuehaceunosaos,ycomointentaremos
esbozarenestecaptulo,apesardequelaetapaadolescenteesunmomentoevolutivo
decambios,primamslacontinuidadquelarupturaconelmundoanteriordelchicoo
lachica.
Elconocimientosobreelmundosocialdeladolescentesehaincrementadodeforma
exponencialenlosltimos20aos,debidofundamentalmentealcambiodeparadigma
delestudiodeladolescentecomounserindividual(anivelemocional,cognitivoofsico)
aunparadigmaenelqueeldesarrolloseproduceenentornossociales.Elpresentecap-
tulosebasar,portanto,enlosavancesobtenidosenestosltimosaos.Sinembargo,
nopodemosobviarlateoradeldesarrollopsicosocialdeErikson,enmarcadaenelprimer
paradigmaque,consuideadelabsquedadeidentidad,supusolabaseparafuturasin-
Existe una continuidad importante entre las relaciones familiares y con los iguales:
quienes mejores relaciones familiares describen son tambin quienes gozan de relacio-
nes con iguales ms satisfactorias. Esta continuidad tambin se da con la relacin de
pareja, disfrutando de mejores relaciones de pareja quienes en su familia o con los ami-
gos han aprendido las habilidades de cercana necesarias en las relaciones romnticas.
Objetivos
Adquirir una visin realista y no sesgada de los cambios sociales que ocurren en
la vida durante la adolescencia.
Conceptualizar la adolescencia como un perodo de bsqueda de la identidad
personal.
Analizar y comprender los cambios que se producen en el autoconcepto y la au-
toestima durante la adolescencia.
Valorar la importancia de las relaciones familiares durante la etapa adolescente.
Conocer y apreciar la relevancia de los vnculos con los iguales en el perodo ado-
lescente.
Valorar la importancia que para el adolescente tienen las relaciones de pareja.
Reconocer al adolescente como persona sexuada que comienza a sentir deseo
fsico por otros.
Adquirir conocimientos relevantes sobre el desarrollo normativo que permitan la
deteccin de problemas reales durante la adolescencia.
284 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
vestigaciones y contina siendo actualmente un referente terico para explicar buena
partedelosresultadosobtenidosenlainvestigacin.
1. Modelo de cambio individual: la teora de Erikson
AunquelateoradeErikErikson(1902-1994)hacereferenciaalciclovitalcompletode
lapersona,hasidosuformulacindelaetapaadolescentelaquemshacaladoenlos
textossobrepsicologaevolutiva.Erikson,deformacinpsicoanaltica,seapartadelpsi-
coanlisisclsicoparaotorgarunpapelprimordialalasociedadeneldesarrollodelin-
dividuo. En su teora, el Yo debe evolucionar a lo largo del ciclo vital asegurando un
comportamientoefcazdelapersona,siendoentodomomentolasociedadquiengualas
eleccionesquevaefectuandoelindividuo(Erikson,1968).Lasociedadprovocacrisisen
lapersona,yparalelamente,establecemediosparasuperaresascrisis.Cadasuperacin
supondr mayor apertura a la sociedad. Erikson propone el desarrollo de la persona en
ochoetapassecuenciadas.Cadaetapasuponeelafrontamientodeunacrisis.Enelcaso
de que la crisis sea resuelta, elYo saldr fortalecido e incorporar una nueva cualidad.
Cuandolacrisisnoessuperada,irnquedandorestosneurticosenlapersonalidaddel
individuoysedifcultarlasuperacindelasnuevascrisis,deformaquesermsdif-
cultoso incorporar nuevas cualidades alYo de la persona. Por tanto, en cada etapa se
establecen dos opuestos: la cualidad a alcanzar y su contraria. Las etapas de Erikson
quedandefnidasenlaTabla10.1.
Tabla 10.1. Etapas del desarrollo segn Erikson (1980)
Etapa Descripcin Cualidad desarrollada
Confanza
frentea
desconfanzabsica
(0-1ao)
Si hay consistencia en los cuidados que el beb
recibe,adquirirlaexpectativadequeaunquelas
cosaspuedanirmalduranteuntiempo,luegome-
jorarn.
Confanza
enlosotros
Autonoma
frenteavergenza
yduda
(2-3aos)
Elniorealizaelecciones:retencindeheces,co-
mer solo, oposicin a los padres, vestirse solo.
Debe, sin embargo, compatibilizar su deseo de
autonomaconlasnormassocialesquelospadres
representan.
Voluntad
Libertaddentro
deloslmitesimpuestos
porlasociedad.
Iniciativa
frentea
culpa
(3-6aos)
El nio toma la iniciativa para intentar conseguir
objetivospersonales.Peronosiempreloconsegui-
r porque chocar con los deseos o normas de
otros.Deberaprenderaprocurarmetasrealizables.
Propsito
Permiteperseguir
objetivossignifcativos.
Diligencia
frentea
inferioridad
(6/7-12aos)
El nio debe aprender a manejar herramientas
culturales mientras se compara con el grupo de
iguales, con los que debe aprender a trabajar y
jugar.
Competencia
Capacidadparautilizar
lasherramientas
culturales.
Identidad
frentea
confusinderoles
(adolescencia)
Eladolescenteseenfrentaacambiosfsicosynue-
vas demandas sociales que le harn dudar de su
identidad,desaberquinesl.Debercomprome-
terseanivelideolgico,profesionalypersonal.
Fidelidad,lealtad
Captulo 10. El desarrollo socio-emocional del adolescente 285
Etapa Descripcin Cualidad desarrollada
Intimidad
frentea
aislamiento
(adultojoven)
Lapersonadebearriesgarsuidentidadparalograr
el vnculo de intimidad con otra persona (la fu-
sindeidentidades),peromanteniendolapropia
identidad.
Capacidaddeamar
Generatividad
frentea
estancamiento
(adultomedio)
Msalldelaidentidadylaintimidad,lapersona
debecomprometerseconlosotros,consutrabajo,
conloshijos,consiguiendoproductividadysatis-
faccinelevadas.
Productividad,cuidado
Integridad
delYofrente
adesesperanza
(adultoviejo)
Lapersonadebeestardeacuerdoconlasdecisio-
nesvitalesadoptadas,considerandolapropiavida
comountodosignifcativo.
Sabidura
1.1. Los estatus de identidad: J. Marcia
DesdequeEriksonestablecieraellogrodelaidentidadcomolatareafundamentalque
debenresolverlosadolescentes,numerosostericossededicaronalestudiodeesteas-
pecto.Marcia,apartirdelestudiosistemticomedianteencuestas,sugiricuatroestatus
deidentidadquesurgendelacombinacindedosdimensiones:porunaparteelhabero
noatravesadoporunacrisisdeidentidadentendidacomomomentodebsquedaycriba
dediferentesalternativasy,porotraelhaberadoptadocompromisosvocacionales,ideo-
lgicosopersonales(vaseTabla10.2).
Tabla 10.2. Niveles o estatus de identidad segn Marcia (1966)
Crisis
Compromiso
S No
S Identidaddelogro Identidadhipotecada
No Moratoria Identidaddifusa
Existeunasecuenciahabitualparapasarporestasetapas,sinquesealaquenecesa-
riamentehayaqueseguirse.Lomsfrecuenteesquealiniciodelaadolescenciaelchico
olachicasesiteenelestatusdeidentidaddifusa,dondenihaadoptadocompromisos
niestexplorandolasalternativasqueseleplantean;parapasarposteriormentealaeta-
pademoratoria,dondeeladolescentebusca,explora,pruebadiferentesopcionesoal-
ternativas sin llegar a tomar decisiones sobre cul es la correcta para l; el chico o la
chica est en plena crisis de identidad. Finalmente, se llegar a la identidad de logro,
estatusenelquetraselprocesodebsquedaypruebadediferentesopciones,eladoles-
centesecomprometeconaquellasalternativasquelehayanresultadomejores.Sinem-
bargo, existen otros posibles trnsitos por estas etapas.As, alguien puede no pasar la
etapadecrisisomoratoriayadoptarcompromisospersonalesposiblementesugeridospor
otrosadultos,estapersonatendraunaidentidadhipotecada.
286 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Encualquiercaso,labsquedadelaidentidadtambinpuedeseruncaminodeida
y vuelta, y por ejemplo, un chico que trabaja en la construccin porque sus padres y
abuelos lo hicieron sin plantearse qu es lo que quiere realmente y probar/buscar otras
opciones(identidadhipotecada),puedeentrarencrisisposteriormente(moratoria),ylo-
grarsupropiaidentidadmstardamente.Estonoimplicacambiardetrabajooquene-
cesariamenteeladolescentequelogralaidentidadllevesistemticamentelacontrariaa
suspadresenideologaoaspiracionesdefuturo,sinoqueladecisinfnalqueadoptay
elcaminoaseguirsurgedelaconviccindequesloquequierehacerdespusdehaber
analizadodiferentesopciones.Dehecho,talycomoveremosenelsiguienteepgrafe,es
habitualquelosadolescentescoincidanconsuspadresenideologaolespidanopinin
parasaberquhacerenelfuturo.
2. Autoconcepto y autoestima
Los cambios fsicos, cognitivos y sociales que suponen la transicin a la adolescencia
derivan,necesariamente,encambiostantoenelautoconcepto,comoenlaautoestimade
loschicosychicasquetransitanporestaetapaevolutiva.
2.1. Autoconcepto
Autoconceptoeidentidadsondostrminosntimamenterelacionados,peromientrasla
identidadesunfenmenocomplejodenaturalezapsicosocial,elautoconcepto,encuan-
to que es la construccin y elaboracin del conocimiento de uno mismo, depende en
mayormedidadeloscambioscognitivosdescritosenelCaptulo9.
Durantelaadolescencia,elautoconceptoquesehabaelaboradoalfnaldelaniez
vaasufrircambiosdeestructuraydecontenidos.Anivelestructural,lacapacidadde
abstraccinpermitiraladolescenteinicialrelacionaralgunascaractersticasvinculadas
entre s. Sin embargo, este primer momento del pensamiento formal, con las primeras
abstraccionessobrequinesl/ella,nopermitedetectarincoherenciasentresusdiferen-
tesfacetas,loqueporotraparte,evitaaladolescenteelsufrimientoemocionalquesu-
pondra detectarlas. En una segunda etapa, las abstracciones elaboradas en la primera
faseserelacionanentres,ascomoalgunosrasgosqueenprincipioparecenopuestos.
Para comprender mejor esta etapa es necesario tener en cuenta que el adolescente se
relacionacadavezenmscontextossociales,talycomoveremosenestecaptulo:fa-
milia, amigos, relaciones de pareja e incluso escuela o trabajo. En cada uno de estos
contextossevaademandaraladolescenteuncomportamientoyunosvalores,quefaci-
litarnladiversifcacindelautoconcepto.Enlaterceraetapadeformacindelautocon-
cepto durante la adolescencia, el pensamiento formal ya est asentado, lo que permite
relacionarabstraccionesentresyjerarquizarlas,deformaquesepuedelograrunauto-
conceptonoslomltipleydiversifcado,sinotambinintegrado,dondelosrolesopues-
tos y los diferentes yoes no produzcan sentimiento de incongruencia e insatisfaccin
(vaseTabla10.3).
Traslosrpidoscambiospuberales,elaspectofsicovaaocuparunlugarcentralen
elcontenidodelautoconcepto.Noesdeextraar,yaqueestoscambiosfsicossevana
convertir en una de las preocupaciones centrales de los adolescentes, llegando a infuir
Captulo 10. El desarrollo socio-emocional del adolescente 287
deformaimportanteenlaautoestima,comoveremosmsadelante.Sinembargo,elpaso
deltiempoconelaumentodelacapacidaddeabstraccinqueconlleva,yconlashoras
dedicadasalaintrospeccin,vaapermitirqueapartirdelaadolescenciamediaelauto-
conceptoseenriquezcadedefnicionesrelativasalaspectomenosvisibledelosadoles-
centes,elpsicolgico:creencias,flosofadevida,personalidad,etc.
2.2. La autoestima
La autoestima es el componente valorativo del autoconcepto y uno de los principales
predictores de bienestar personal entre adolescentes y adultos.A lo largo de la adoles-
cencia,laautoestimasediversifcaraltiempoqueelautoconcepto,aadiendocadavez
ms componentes, por ejemplo autoestima fsica, autoestima relacional o autoestima
afectivo-sexual.Enfuncindelasexperienciasycompetenciasencadamateria,losado-
lescentestendrnmayoromenorvaloracinencadaunodeloscomponentes.Apesarde
estadiversifcacin,continaexistiendounaautoestimaglobalqueseverinfuidapor
losdiferentescomponentes
1
enfuncindelaimportanciaquetengaparalapersona.De
esta forma, un chico que obtenga buenas califcaciones y pobre rendimiento en los de-
portestendrmejorautoestimaglobalsivaloraespecialmentelasactividadesacadmicas,
quesialoquedaimportanciaesalxitodeportivo.
Enloreferentealasdiferenciasdegneroencontramosqueloschicossuelentener
mejoresnivelesdeautoestimaglobalquelaschicas.Sinembargo,estudiosquecompa-
randiferentescomponentesdelaautoestimamatizanestaidea,deformaqueloschicos
tendrnmejorautoestimaenlasreasrelativasamatemticas,aparienciafsicaodepor-
tes,ylaschicasenlasreasreferidasalascompetenciasverbalesylasrelacionesinter-
personales(WilgenbushyMerrell,1999).Encualquiercaso,paraambossexos,aunque
msenelcasodelaschicas,laaparienciafsica(yelatractivoparaelotrosexo)ser
untemacentralenlaconsecucindelniveldeautoestima.Quizeslaimportanciadel
1
Algunosautorespreferenreservareltrminoautoestimaparalaautoestimaglobalyutilizanlatermi-
nologadepercepcindeautoefcaciaovaloracinpersonalparaloqueaquhemosdenominadocomponentes
delaautoestima.
Tabla 10.3. Ejemplos de autoconcepto (adaptado de Palacios, 1999)
Adolescencia inicial (11-14 aos)
Soytmido,mecortoconlosadultosperotambinconmiscompaeros.
Enmicasasemeocurrenmuchascosasdivertidas,peroconmisamigosno.
Adolescencia media-tarda (15-17 aos)
Soymuyinteligenteparaunascosas,peronoparaotras.
Noentiendocmomellevotanbienconmiscompaerosytanmalconmishermanas.
Adultez emergente (18 - 21 aos)
Soyunachicafexible:seriayformalparatrabajar,perojaraneraparadivertirme.
Meinteresanmuchascosas,perosoyalgoindeciso.
288 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
fsico,sobretodoenlaadolescenciainicial,laquehacequelosnivelesdeautoestima
globalseanmenoresenlaschicasqueenloschicos,yaqueloscambiospuberalesale-
jan el cuerpo real de las chicas del estereotipo actual de belleza femenina, aunque no
faltanautoresqueapuntanaotrascausas:lasfamiliasaceptanmejorlaautonomasila
demanda un chico que si lo hace una chica; o los profesores atribuyen la disminucin
derendimientoacadmicoafaltademotivacinenloschicosyafaltadecapacidaden
laschicas.
Evolutivamente,laautoestimasueledecreceraliniciodelaadolescencia.Noesde
extraar,pueseselmomentoenelquechicosychicasseenfrentanalosmayorescam-
bios: fsicos, hormonales, sociales, emocionales y escolares. Posteriormente, segn se
vaaceptandoelnuevocuerpo,sevaadaptandoalanuevaposicinsocialysevanabor-
dandolasrelacionesinterpersonalesdeunaformamsmadura,laautoestimavuelvea
subir.
Encuantoalosfactoresqueafectanalaautoestima,losdatosnuevamentesoncon-
gruentesconlosdeetapasanteriores,uncontextofamiliarafectuosoycohesionado,con
estiloeducativodemocrticoorelacindeapegoseguro,ascomorelacionesdecomu-
nicacinyconfanzaconelgrupodeigualesfavorecenlaautoestimapositivadechicos
ychicas(Parra,OlivaySnchez-Queija,2004).
3. Relaciones familiares
Lafamiliaesuncontextofundamentaleneldesarrollodelaspersonas,yestonocambia
en la etapa adolescente. Muy al contrario, es un entorno bsico para superar tareas del
desarrollocaractersticasdelaadolescencia,talescomolaformacindelaidentidad,la
adquisicindeautonomaoelajustepsicosocialdeladolescente(Lila,VanAken,Musi-
tuyBuelga,2006).Sinembargo,enlasociedadpermanecelaideadeladolescentecon-
fictivo que rompe con todas las normas familiares, idea probablemente promovida por
la visin psicoanaltica de la adolescencia y, ms contemporneamente, por la visin
evolucionista,segnlascualesparaconseguirlaindividuacinesnecesarioqueelado-
lescente rompa y se distancie de los vnculos familiares, al tiempo que gira hacia otro
tipo de relacin ms igualitaria que le permite crear nuevos vnculos afectivos (Bloss,
1979).Deestaideaderelacionesfamiliaresconfictivasydedistanciamientodurantela
adolescencia se pas a la versin contraria y, durante un tiempo, algunos de nuestros
colegasinsistieronenquelaadolescenciaeraunaetapams,quenoimplicabaconfictos
en la familia.Actualmente, los datos acumulados en los ltimos aos de investigacin
muestranunpanoramamenosdramticodelmitodeladolescenteconfictivoquedesgra-
ciadamente permanece an en la sociedad, y menos buclico que apareca en aquellos
textos que se esforzaban en convencernos de que los cambios que ocurren durante la
adolescencianoimplicabanningnreajusteenlafamilia.
3.1. El mito de los continuos conictos familiares
Cuandounchicoounachicallegaalaadolescencia,estsufriendoimportantescambios
cognitivos(vaseCaptulo9)yfsicos,nosloenlaaparienciaexterna,cadavezms
cercanaaladeunadulto,sinotambininternamenteconlosreajusteshormonales.Las
Captulo 10. El desarrollo socio-emocional del adolescente 289
recin estrenadas capacidades cognitivas van a permitir al adolescente cuestionar las
normasfamiliaresqueacatabaanteriormente,einclusorebatirlasconargumentos,con
elconsiguientedesconciertodesuspadresymadres;igualmente,vanapermitirdesidea-
lizaralospadresyalasmadres.Aquellaspersonasquecuandoeranniosconsideraban
omnipotentesysabiasseconviertenahoraenindividuosconsuspropiosdeseos,nece-
sidades e incluso errores. Los cambios fsicos externos van a suponer que se les exija
un comportamiento ms maduro en algunas reas o desde algunos sectores sociales;
mientrasqueloscambioshormonalessupondrnalgunasalteracionesbruscasdehumor
que,denuevo,desconcertarnaquienesvivencercadeellos.Estoscambiosfsicossu-
pondrnigualmenteunaumentodeldeseosexualydelaposibilidaddealiviarlo,loque
provocar en los padres un intento de controlar y restringir el ocio y las amistades de
los adolescentes, especialmente en el caso de las chicas (Oliva, 2006; Oliva y Parra,
2004).
Elrestodemiembrosdelafamiliatambinestexperimentandocambiosquepueden
sumarse a la transicin a la adolescencia del hijo. De esta forma, no es extrao que la
pubertadyadolescenciadeloshijoscoincidaeinclusoquelaaparienciadeadultezde
loshijosehijasdesencadeneunmomentoderefexinyevaluacindelospadressobre
silavidaqueestnllevandoesrealmentelaquequeranohabanimaginadocuandoellos
mismoseranjvenes,loquesehadenominadocrisisdemitaddevida.
Enestecontexto,noesextraoquelosprimerosmomentosdelaadolescenciasean
unbuencaldodecultivoparaquesurjanconfictosfamiliares.Hijosquedemandanau-
tonoma,quecuestionannormas,concambiosdehumorypadresqueseresistenaestos
cambios.Sinembargo,unanlisisenprofundidadyteniendoencuentamsdimensiones
nosmuestraque,apesardeestosconfictos,losadolescentessiguenconsiderandoasu
familiacomofundamentalensusvidas.ElinformeJvenesespaoles2005muestraque
lafamiliaeslainstitucinmsvaloradaentreloschicosychicasdeentre15y24aos
(Gonzlez-Blasco,2006)y,apesardelosproblemas,losadolescentesseconsideranque-
ridosensuscasas.Adems,estosconfictosnoocurrenantecualquiertemtica,sinoque
las discusiones ms frecuentes en la familia de los adolescentes tienen que ver con as-
pectosdelavidacotidiana,aquellosqueeladolescenteconsideradesuesferapersonal,
aunqueanestnbajolatuteladesuspadres,talescomolahoradellegaracasa,laves-
timentaolastareasdelhogar(Noller,1994;ParrayOliva,2007).Sinembargo,alahora
detomardecisionessobreelfuturocomoquestudiar,oenelcasodediscusionessobre
temaspolticos,chicasychicosacudenaconocerlaopinindesusmayores,conquienes
suelenestardeacuerdoyseguirsusindicaciones.
Estasdiscusionesquevenimosdescribiendoseproducenaliniciodelaadolescencia.
Comparandodatosdepreadolescentesyadolescentesencontramosquelosadolescentes
percibenmenorcercana,compaaeintimidaddelospadresymadresquelospreado-
lescentes(CollinsyLaursen,2004)e,igualmente,lospadresylasmadresconsideranque
sushijosadolescentesrompensusexpectativasconmsfrecuenciaquecuandoeranprea-
dolescentes,interpretandolasdisrupcionescomointencionadasconmayorfrecuenciaque
cuandoeranpreadolescentes(Collins,1989).Estafotografadediscusiones,afortunada-
mente,parecequetiendeadisminuirgradualmenteamedidaquetranscurrelaadolescen-
cia(Laursen,CoyyCollins,1998),segnpadresehijosvanencontrandounnuevoequi-
librio ms igualitario y menos jerrquico que con el que haba funcionado el sistema
familiar previamente.Adems, es importante no ver estos confictos slo desde la ver-
290 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
tientenegativadelmomento,yaquecuandoseproducenenunclimadeafectoycario,
supondrnunmejorajustedeladolescentequesedejarveryaenlaadolescenciatarda
(Oliva,Parra,Jimnez,Snchez-Queija,2005).
Encualquiercaso,estepatrncomocualquieraenpsicologa,dondenohaydosper-
sonasodossistemasdepersonasiguales,puedetenervariacionesy,porejemplo,enun
sistemafamiliarenelquelospadresestnmuypreocupadosporsucarreraprofesional,
eldeseodeautonomadeloshijosehijaspuedeserconsideradocomoaguademayo,
yportantonogenerarningntipodeconfictofamiliar(vaseTabla10.4).
Tabla 10.4. Grupo de discusin con chicos y chicas adolescentes I*.
Sobre los conictos en la familia y el cambio de la adolescencia (13 aos)
Chica1:tenemosmsedad,pensamosdiferente...
Moderadora:quepensisdiferente?
Chica1:hombre,quecuandoramoschicos,yoqus,tegustabamsestartodoelratocontuspadres
pegadito,peroahorategustamsestarmsdespegadounpoquito.
Moderadora:yvuestrospadres,qupasa?,quenoosdejandespegarosdeltodo?
Chica1:quiz,yoqus,elloscreenquetodavasomossusnioschicos.
Murmullo
Chica3:degrande(ahora)sehablamsconellos,puedesdartuopininoalgo,cuandoeraschicotenas
quehacerloqueellosdijeran,yaahorapuedesdecir:no,estoesquenoloquierohacer,nomevie-
nebien...
Moderadora:yesoentoncesqueesunmotivoconficto,oalrevs,demejora.
Chica3:depende,porquesi,porejemplo,leschillasolescontestasdemalamanera,yocreoqueesun
conficto.Ahora,silesdices:esquenomevienebienyseloexplicasyeso,nocreoqueseamalo.
Sobre la bsqueda de autonoma (15 aos)
Chica:yadems,yoporejemplosoylamschicademicasaymipadreammetienemsprotegidaque
a nadie, mis hermanos son todos mayores y entonces yo no le puedo decir que me voy a este lado:
tenmscuidado!,nopasesporaqu!Lotpico.Yyosilecuentoalgodechicospuesentoncesya
medice:Carmela,nosalgasdeaqu!
Risas
Chico1:esomepasaam.Yosoyelmschicodemicasaysiledigoamimadrequevoyaalgnlado,
siemprelosveopasandoconelcoche,mirando...
Chico2:esverdad!,esverdad!Poresoyonolesdigoamispadresdndevoy.
Moderadora:yporqucreesquetupadresepasaporall?
Chico1:yoques...siesqueessiempre...yocomosoyelmschicosiempremecuidamsyeso...es
mspesado!,poresoledigo:pap,yomevengoalacalleparaestarconmisamigosynocontigo!
Porquemuchasvecesmepara,medice:venaqu!Yseponeahablarconmigodeyoqusy
meponelacabeza...sabes?
* DatosobtenidosenlainvestigacinCambioyContinuidadenlaAdolescencia,dirigidaporelprofesorDr.Alfredo
Oliva.(FinanciadoporMinisteriodeEducacin,CulturayDeporte:BS02022-03022.)
3.2. Continuidad entre las relaciones familiares en la infancia
y en la adolescencia
No queremos terminar este apartado sin hablar de la continuidad en la relacin, tal y
comoavanzramosenlaintroduccin.Segnlateoradelapego,eltipodeapegoes-
Captulo 10. El desarrollo socio-emocional del adolescente 291
tablecidodurantelanieztiendeaserestable,yaquelloschicosychicasqueestable-
cieron un vnculo seguro con sus madres y padres, a priori tienden a mantener ese
mismotipodeapego(vanselosCaptulos4y8).Encualquiercaso,hayqueteneren
cuenta que la forma externa de la expresin de las emociones va a variar durante la
adolescencia,yenlugardelasmuestrasdeafectoexplcito,losadolescentesmostrarn
su cario a los padres de otra forma, como preocupndose por sus asuntos e incluso
cuidndoles,bromeando,etc.Durantelaadolescencialafamiliacontinaejerciendola
funcindebaseseguraquepermitelaexploracinendiferentescampos.Estableciendo
unparalelismoconotrasedades,enlasituacindelextrao,elbebconapegoseguro
jugartranquilamenteenlasalacuandosumadreestpresente.HaformadounMode-
loInternodeTrabajo(MIT)quelepermiteconfarenquesiocurrealgo,sumadreest
all,porloqueexploralasalacontotaltranquilidad.Enelcasodelnio,noesnece-
sario que la madre est presente porque su capacidad de representar le permite saber
quelamadrevendrcuandollallame.Enlaadolescencia,estafuncindebasesegu-
ra se concretar de otra forma, y el chico o la chica con apego seguro tendrn ms
confanza para explorar en las relaciones con los iguales, con la pareja, e incluso en
otrasreasdiferentesalasinterpersonales.Hanformadounmodelomentalenelque
sondignosdeserqueridos,ysabenquecuandonecesitenasuspadres,estarnahpara
ayudarles. En cualquier caso, lo que queremos destacar es la idea de continuidad, y
queaquellasfamiliasquemejorseajustanalatransicinadolescentedesushijos,son
las que previamente mantenan relaciones ms clidas con ellos.A pesar de que las
muestrasdeafectoexplcitodisminuyanydequealprincipiodelaadolescenciaapa-
rezcan algunos confictos, slo el 5% de los nios que durante la infancia mantienen
relaciones positivas con sus padres se convierten en adolescentes confictivos (Stein-
berg,2001),porloquelasfamiliasquequieranpromoverunaadolescenciadebuenas
relacionesconsushijos,deberncomenzarporestablecerunclimadeconfanzayca-
riodurantelaniez.
4. Relaciones con los iguales
Lafamiliaeselprimeryprobablementeprincipalcontextodedesarrollodurantetodala
vida.Sinembargo,durantelaadolescenciacobraespecialimportanciaotrocontexto,el
delgrupodeamigosoiguales,conelquesepasacadavezmstiempo,sedisfrutadel
tiempolibre,seexperimentannuevasalternativasysecompartenaquellascuestionesque
losadolescentesconsideraninapropiadasoincomprensiblesparaelmundoadulto.
Dehecho,paramuchosautoresesenlapreadolescencia(Sullivan,1953)oenlaado-
lescencia (Savin-Williams y Berndt, 1990) cuando surge la verdadera amistad, aquella
queesdiferentealsimplecompaerismo.Estemosonodeacuerdoconestaidea,enla
adolescenciasurgeuntipodeamistadconcaractersticaspropias(Buhrmester,1996):
1. La amistad pasa de estar centrada en el juego a estar centrada en la conversa-
cin.
2. Losamigosyamigassalendelosconfnesdelrecreo(opatiodejuego)ydela
clase.Ahorasurgeniniciativasdeconversarsobrelasinquietudes,aumentanlas
llamadasdetelfonoysehacenmuchosplanesparapasarjuntoseltiempo.
292 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
3. Losamigosyamigasseconviertenenunimportanteforodeautoexploraciny
deapoyoemocional.Estorequiereaprenderapensarsobreellosmismos,aauto-
rrevelarseoloqueeslomismo,acompartirconelamigolascosasmsntimas
deladolescente,asercapacesdeempatizarparadarapoyoemocionalalotro.
4. Al necesitar ms de los amigos y amigas para satisfacer ciertas necesidades, es
frecuente que tengan que trabajar con los confictos y desacuerdos.Ahora se
requieredeladolescentequeseacapazderesolverlosconfictosconelamigoo
amigadeformaquesereduzcalatensinsinperderlaintimidaddelarelacin.
4.1. La amistad ntima en la adolescencia
Noesextraoescucharalospadresquejarsedequesushijaseinclusohijospasan
horashablandoportelfonoochateandoconsusamigos,preguntndosequsecontarn
siacabandeestarjuntosenelinstitutooenlacalle.Yesquesinduda,elconceptoes-
trellaparadescribirlaintimidadenlarelacindeamistaddurantelaadolescenciaesel
deautorrevelacin.Conesteconceptoestamoshaciendoreferenciaalhechodequeel
adolescenteconfa(orevela)espontneamentealamigoaquellascuestionesquerealmen-
telepreocupan,sussentimientosydeseosmsprofundos(BerndtyKeefe,1995),yel
compaero responde positivamente a estas revelaciones, comprendiendo y apoyando a
quien expone sus problemas (Laurenceau, Barret, y Poietromonaco, 2004). Hablar con
losamigosdecuestionespersonalescomosexualidad,lafamiliaolosproblemasecon-
micospromuevecercanaenlarelacin.Estecomportamientopuedehabersidoeldes-
encadenantedeque,comoexplicamosanteriormente,desdealgunasposturasseconside-
raranormativoeldistanciamientofamiliaryelacercamientoalosiguales.Sinembargo,
yahemosmostradoquelaseparacinfamiliardurantelaadolescencianoesmsqueuna
simpleapariencia,ydehecho,sonaquelloshijosehijasdefamiliasconapegoseguro,o
quecombinanlasnormasfamiliaresconunclimadeafectoycario(vaseCaptulo7)
quienesmejoresrelacionesestablecenconsusamigos(FurmanyWehner,1994;Snchez-
QueijayOliva,2003).Noesdeextraar,yaqueenunentornocercanocomoeslafami-
liahanaprendidolospatronesconductuales,habilidadesrelacionalesysocialesnecesa-
riasparaestablecerunclimadecercanaenlarelacin.
En nuestro pas, el 88,2% de chicos y 94,6% de chicas de entre 11 y 17 aos dicen
tenerunamigooamigaespecial,alguienenquienconfar,aquiencontarlesuscosas,que
le hace sentir bien y le ayuda cuando lo necesita (Moreno et al., en prensa). Durante la
adolescencia,teneramigoscercanosseconvierteenunanecesidad.Alcompararadolescen-
tesconpreadolescentes,sehaencontradoqueeldesarrollaramistadesntimasyrecprocas
se relaciona con el bienestar emocional y la competencia relacional cuando los chicos y
chicassonadolescentes,peronocuandosonpreadolescentes.Adems,losadolescentescon
buenosamigostienenunmejorajusteemocional(BrownyKlute,2003),mientrasquela
ausenciadeamigosderivaensoledad,malestarpsicosocialyalienacin(Buhrmester,1990).
Sinembargo,parecequechicosychicascubrenestanecesidaddeformadiferente.
Mientrasqueellascharlanconlasamigasdesuscuestionespersonales,ellospreferen
hacercosasjuntos.Dichodeotraforma,laschicasbasanlaamistadenlaautorrevelacin
ylaintimidad,yloschicosencompartiractividadesyenlainstrumentalidad.Estasdi-
ferenciasnosurgenenlaadolescencia,sinoqueyadesdepequeos,losniosjueganen
grupo y no suelen tener un mejor amigo, jugando a competiciones con reglas claras,
Captulo 10. El desarrollo socio-emocional del adolescente 293
mientrasquelasniastienenunamejoramigaconlaquehablanycompartensecretos
(vaseCaptulo8).Portanto,mientrasloschicosaprendenanegociar,cooperarycom-
petirconelgrupo,lasniasaprendenacomunicarse,aescucharyabuscarlacontinui-
dad de la relacin (Coleman y Hendry, 1990). Durante la adolescencia, por tanto, se
mantienen los diferentes roles que ya se han aprendido antes. Sin embargo, no parece
queestasdiferenciassebasenencuestionesinmodifcables.Porejemplo,JonesyDem-
bo(1989)mostraronquechicosychicasandrginos(quepuntanaltoenlascuestiones
tpicamentemasculinasyenlastpicamentefemeninas)formanpartedeunmismogru-
po de chicos y chicas con niveles elevados de intimidad en las relaciones de amistad
(vaseTabla10.5).
Tabla 10.5. Grupo de discusin con chicos y chicas adolescentes II*
Sobre la comunicacin con padres y amigos (15 aos)
Moderadora: pero aparte de las relaciones as con chicos/as, qu cosas no podis contarles a los pa-
dres?
Chica1:lascosasquesepuedenhacerfueradecasa,yoqus,comoalomejorquevasahacerunbo-
telln,osibebesocualquiercosa,osifumas...esonoselovasadecir:oyepap,queayercoguna
borrachera!(risas).
Moderadora: y si por ejemplo un da os sents mal por cualquier cosa, porque una amiga os ha hecho
algoqueoshadolidooloqueseaaquinselocontis?
Chico1:amimadre.
Chica2:yoselocuentoamimadre.
Chico2:yotambin.
Chica1:yoamimadreyamihermana.
Sobre la importancia de los amigos (13 aos)
Moderadora:vamosaver,quocurrirasiundatequedassinamigos?,enqucambiaralavida?
Chico 1: en que tendras que estar todo el da en tu casa aburrido, no hacer nada, estar solo en tu casa,
aburridoytodo.
Moderadora:yvosotras?,enqucambiaralavidasiundaosquedissinamigos?
Chica2:entodo.
Moderadora:entodo,porqu?
Chica2:porquesitnopuedesestarcontusamigosporlatarde,nolespuedesconfarnada,nopuedes
hablarconellos...
Chico2(interrumpiendo):nopuedesdivertirteconellos.
* DatosobtenidosenlainvestigacinCambioyContinuidadenlaAdolescencia,dirigidaporelprofesorDr.Alfredo
Oliva(BS02022-03022).
4.1.1. La amistad y otras relaciones cercanas
Elcontextodelaamistadbebedelcontextofamiliarcomoyahemosmostrado,perotam-
binaportaadichocontexto,siendodosentornosqueseinfuyenmutuamente.Conlos
amigossepuedenaprenderestrategiasderesolucindeproblemasoalgunosaspectosde
laintimidadrelacionalenuncontextodeigualdadqueposte riormentesetrasladenalas
relacionesfamiliares,ayudandoamejorarlassegnsevanconvirtiendoenrelacionesms
igualitarias,menosjerarquizadasyasimtricas(vaseFigura10.1).
294 Bloque III. El desarrollo durante la etapa escolar y la adolescencia
Figura 10.1. Un ejemplo de homolia conductual en un grupo de adolescentes.
Ahora bien, probablemente, los aprendizajes que se dan en la relacin de amistad
durantelaadolescencia,afectarnmsalaposteriorrelacindepareja.Lasrelacionesde
amistadsonsimtricas,entreiguales,horizontales,frentealasrelacionesconlosadultos
enlafamiliaquesonverticalesoasimtricas.Conelamigontimoseaprendearesolver
problemasenuncontextodecercanaycario,solventandolasdifcultadessinperderla
relacin,seaprendeanotenermiedoalaintimidadrelacional,aconfarenlaotraper-
sona,todosellosaprendizajesnecesariosenlarelacindepareja.
Desdelateoradelapego,algunosautoresestudiancmosetrasvasalarelacinde
apegodelospadresalosigualesydeestosalapareja.Engeneral,losestudioshablan
delsiguientepatrnenfuncindeloscuatrocomponentesbsicosdelvnculodeapego:
ansiedadantelaseparacin,baseseguraquepermitelaexploracin,bsquedadeproxi-
midad y refugio emocional (vase Captulo 4). Nios y nias buscan la proximidad de
lospadresyacudenaellosasolicitarrefugioemocionalantelasadversidades.Durante
lapreadolescenciasecomienzaacompartirentrepadresyamigoseldeseodeproximi-
dad,parayaenlaadolescencia,preferirlaproximidaddelosamigosaladelospadres.
Habr que esperar tambin a la adolescencia, aproximadamente los 14 aos, para que
utilicenalosamigoscomorefugioemocionalanteaquellascuestionesquepreocupanal
adolescente.Alfnaldelaadolescencia,conlallegadadelaadultezemergent